Citrus Sinensis ID: 001242


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------
MTMMTPPPLDQEEEEMLVPHSDIVEGPQPMEVVSQVEPASTVENQQVEDPPTMKFTWTIENFSRLNTKKHYSDVFVVGGYKWRILIFPKGNNVDHLSMYLDVADSGTLPYGWSRYAQFSLAVVNQIHSKYSIRKDTQHQFNARESDWGFTSFMPLGDLYDPSRGYLVNDSVVVEAEVAVRKVLDYWSYDSKKETGYVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTENDLPSGSIPLALQSLFYKLQYNDTSVATKELTKSFGWDTYDSFMQHDVQELNRVLCEKLEDKMKGTVVEGTIQQLFEGHHMNYIECINVDYKSTRKESFYDLQLDVKGCRDVYASFDKYVEVERLEGDNKYHAEEHGLQDAKKGVLFIDFPPVLQLQLKRFEYDFMRDAMVKINDRYEFPLQLDLDRENGKYLSPDADRSVRNLYTLHSVLVHSGGVHGGHYYAFIRPTLSDQWYKFDDERVTKEDVKRALEEQYGGEEELPPTNPGFNNTPFKFTKYSNAYMLVYIRESDKDKIICNVDEKDIAEHLRIRLKKEQEEKEDKRRYKAQAHLYTIIKVARDEDLAEQIGRDIYFDLVDHDKVRSFRVQKQTSFMAFKEEIAKEFGIPIQLQRFWIWAKRQNHTYRPNRPLLPQEEAQTVGQLREVSNKTHTAELRLFLEVEFGPDLHPIAPPDKSKDDILLFFKLYDPEKGELRYVGRLFLKSSSKPIEILRKLNQMAGFDPDEEIELYEEIKFEPCVMCEHLDKRTSFRLSQIEDGDIICFQKSPPLESEQECRYPDVPSFLEYVHNRQIVRFRALDRPKEDAFCLELSKQHSYDEVVERVARKIGLDDPSKIRLTPHNCYSQQPKPQPIKYRGVEHLSDMLVHYNQTSDILYYEVLDIPLPELQGLKNLKVAFHHATKDEVVIHNIRLPKQSTVGDVINELKTKVELSHPNAELRLLEVFYHKIYKIFAPNEKIENINDQYWTLRAEEIPEEEKNLGPNDRLIHVYHFTKESAQNQMQVQNFGEPFFLVIHEGETLAEVKERIQRKLQVLDEEFSKWKFAFLSLGRPEYLVDTDTVFNRFQRRDVYGAWEQYLGLEHSDNAPKRAYSVNQNRHTYEKPVKIYN
ccccccccccccHHcccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccccccEEEcccCEEEEEEEcccccccEEEEEECccccccccccEEEEEEEEEEEEccccccEEEEEEEEEEccccccccccccccccccccccccccccccEEEEEEEEEEccccccccccccccccccccccccHHHHHHHHHHHHccHHHHHHHccccccccccccccHHHHHHHHHHHHHccccccccHHHHHHcccccccccccccHHHHHHHHHHHHHHHHcccccccccccccEEEEEEEEEEcccccccccccccEEEEEEEcccccHHHHHHHccccEEcccccccccccccccccEEEEEEccccccEEEEEcccEEccccccEEEcccCEEccccccccccccccccccccccccccEEEEEEEEEEccccccEEEEEEccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccEEEEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccHHHHHccccccccccccccccEEEEEEccccHHHHHHHHHHHcccccccEEEEEEEEcccccccccccccccHHHHHHHHHHHHccccccccEEEEEEEEcccccccccccccccccEEEEEEEEcccccEEEEEEEEEEcccccHHHHHHHHHHHccccccccEEEEEEEcccccCECccccccccccccccccccEEEEEEccccccccccccccHHHHHHHHccEEEEEEECccccccccEEEEEcccccHHHHHHHHHHHHcccccccEEEEEcccccccccccccccccccccHHHHccccccccEEEEEEEccccccccccCEEEEEEEcccccEEEEEEEEccccccHHHHHHHHHHHcccccccccEEEEEEEccEEEEEcccccccccccccccEEEEEEccccccccccccCEEEEEEEEccccccccccccccccEEEEEEccccHHHHHHHHHHHHcccccccccEEEEEEEcccccccccccHHHccccccccccccccEEECcccccccccccccccccccccccEEEcc
************************************************DPPTMKFTWTIENFSRLNTKKHYSDVFVVGGYKWRILIFPKGNNVDHLSMYLDVADSGTLPYGWSRYAQFSLAVVNQIHSKYSIRKDTQHQFNARESDWGFTSFMPLGDLYDPSRGYLVNDSVVVEAEVAVRKVLDYWSYDSKKETGYVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTENDLPSGSIPLALQSLFYKLQYNDTSVATKELTKSFGWDTYDSFMQHDVQELNRVLCEKLEDKMKGTVVEGTIQQLFEGHHMNYIECINVDYKSTRKESFYDLQLDVKGCRDVYASFDKYVEVERLEGDNKYHAEEHGLQDAKKGVLFIDFPPVLQLQLKRFEYDFMRDAMVKINDRYEFPLQLDLDRENGKYLSPDADRSVRNLYTLHSVLVHSGGVHGGHYYAFIRPTLSDQWYKFDDERVTKEDVKRAL*EQYGG***********NNTPFKFTKYSNAYMLVYIRESDKDKIICNVDEKDIAEHLRIRLKKEQEEKEDKRRYKAQAHLYTIIKVARDEDLAEQIGRDIYFDLVDHDKVRSFRVQKQTSFMAFKEEIAKEFGIPIQLQRFWIWAKRQNHTYRPNRPLLPQEEAQTVGQLREVSNKTHTAELRLFLEVEFGPDLHPIAPPDKSKDDILLFFKLYDPEKGELRYVGRLFLKSSSKPIEILRKLNQMAGFDPDEEIELYEEIKFEPCVMCEHLDKRTSFRLSQIEDGDIICFQKSPPLESEQECRYPDVPSFLEYVHNRQIVRFRALDRPKEDAFCLELSKQHSYDEVVERVARKIGLDDPSKIRLTPHNCYSQQ****PIKYRGVEHLSDMLVHYNQTSDILYYEVLDIPLPELQGLKNLKVAFHHATKDEVVIHNIRLPKQSTVGDVINELKTKVELSHPNAELRLLEVFYHKIYKIFAPNEKIENINDQYWTLRAEEIPEEEKNLGPNDRLIHVYHFTKESAQNQMQVQNFGEPFFLVIHEGETLAEVKERIQRKLQVLDEEFSKWKFAFLSLGRPEYLVDTDTVFNRFQRRDVYGAWEQYLGLEHSDNAPK**********TYEKPVKIYN
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTMMTPPPLDQEEEEMLVPHSDIVEGPQPMEVVSQVEPASTVENQQVEDPPTMKFTWTIENFSRLNTKKHYSDVFVVGGYKWRILIFPKGNNVDHLSMYLDVADSGTLPYGWSRYAQFSLAVVNQIHSKYSIRKDTQHQFNARESDWGFTSFMPLGDLYDPSRGYLVNDSVVVEAEVAVRKVLDYWSYDSKKETGYVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTENDLPSGSIPLALQSLFYKLQYNDTSVATKELTKSFGWDTYDSFMQHDVQELNRVLCEKLEDKMKGTVVEGTIQQLFEGHHMNYIECINVDYKSTRKESFYDLQLDVKGCRDVYASFDKYVEVERLEGDNKYHAEEHGLQDAKKGVLFIDFPPVLQLQLKRFEYDFMRDAMVKINDRYEFPLQLDLDRENGKYLSPDADRSVRNLYTLHSVLVHSGGVHGGHYYAFIRPTLSDQWYKFDDERVTKEDVKRALEEQYGGEEELPPTNPGFNNTPFKFTKYSNAYMLVYIRESDKDKIICNVDEKDIxxxxxxxxxxxxxxxxxxxxxKAQAHLYTIIKVARDEDLAEQIGRDIYFDLVDHDKVRSFRVQKQTSFMAFKEEIAKEFGIPIQLQRFWIWAKRQNHTYRPNRPLLPQEEAQTVGQLREVSNKTHTAELRLFLEVEFGPDLHPIAPPDKSKDDILLFFKLYDPEKGELRYVGRLFLKSSSKPIEILRKLNQMAGFDPDEEIELYEEIKFEPCVMCEHLDKRTSFRLSQIEDGDIICFQKSPPLESEQECRYPDVPSFLEYVHNRQIVRFRALDRPKEDAFCLELSKQHSYDEVVERVARKIGLDDPSKIRLTPHNCYSQQPKPQPIKYRGVEHLSDMLVHYNQTSDILYYEVLDIPLPELQGLKNLKVAFHHATKDEVVIHNIRLPKQSTVGDVINELKTKVELSHPNAELRLLEVFYHKIYKIFAPNEKIENINDQYWTLRAEEIPEEEKNLGPNDRLIHVYHFTKESAQNQMQVQNFGEPFFLVIHEGETLAEVKERIQRKLQVLDEEFSKWKFAFLSLGRPEYLVDTDTVFNRFQRRDVYGAWEQYLGLEHSDNAPKRAYSVNQNRHTYEKPVKIYN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin carboxyl-terminal hydrolase 12 Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin. Involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins.confidentQ9FPT1
Ubiquitin carboxyl-terminal hydrolase 7 Hydrolase that deubiquitinates target proteins such as FOXO4, p53/TP53, MDM2, ERCC6, PTEN and DAXX. Together with DAXX, prevents MDM2 self-ubiquitination and enhances the E3 ligase activity of MDM2 towards p53/TP53, thereby promoting p53/TP53 ubiquitination and proteasomal degradation. Deubiquitinates p53/TP53 and MDM2 and strongly stabilizes p53/TP53 even in the presence of excess MDM2, and also induces p53/TP53-dependent cell growth repression and apoptosis. Deubiquitination of FOXO4 in presence of hydrogen peroxide is not dependent on p53/TP53 and inhibits FOXO4-induced transcriptional activity. In association with DAXX, is involved in the deubiquitination and translocation of PTEN from the nucleus to the cytoplasm, both processes that are counteracted by PML. Involved in cell proliferation during early embryonic development. Involved in transcription-coupled nucleotide excision repair (TC-NER) in response to UV damage: recruited to DNA damage sites following interaction with KIAA1530/UVSSA and promotes deubiquitination of ERCC6, preventing UV-induced degradation of ERCC6. Contributes to the overall stabilization and trans-activation capability of the herpesvirus 1 trans-acting transcriptional protein ICP0/VMW110 during HSV-1 infection.probableQ93009
Ubiquitin carboxyl-terminal hydrolase 7 Hydrolase that deubiquitinates target proteins such as FOXO4, p53/TP53, MDM2, ERCC6, PTEN and DAXX. Together with DAXX, prevents MDM2 self-ubiquitination and enhances the E3 ligase activity of MDM2 towards p53/TP53, thereby promoting p53/TP53 ubiquitination and proteasomal degradation. Deubiquitinates p53/TP53 and MDM2 and strongly stabilizes p53/TP53 even in the presence of excess MDM2, and also induces p53/TP53-dependent cell growth repression and apoptosis. Deubiquitination of FOXO4 in presence of hydrogen peroxide is not dependent on p53/TP53 and inhibits FOXO4-induced transcriptional activity. In association with DAXX, is involved in the deubiquitination and translocation of PTEN from the nucleus to the cytoplasm, both processes that are counteracted by PML. Involved in cell proliferation during early embryonic development. Involved in transcription-coupled nucleotide excision repair (TC-NER) in response to UV damage: recruited to DNA damage sites following interaction with KIAA1530/UVSSA and promotes deubiquitination of ERCC6, preventing UV-induced degradation of ERCC6.probableQ4VSI4

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.19.-Omega peptidases.probable
3.4.19.12Ubiquitinyl hydrolase 1.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2F1Z, chain A
Confidence level:very confident
Coverage over the Query: 48-489,509-551
View the alignment between query and template
View the model in PyMOL
Template: 2YLM, chain A
Confidence level:very confident
Coverage over the Query: 558-1092
View the alignment between query and template
View the model in PyMOL