BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 001247
         (1115 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2R55|A Chain A, Human Star-Related Lipid Transfer Protein 5
 pdb|2R55|B Chain B, Human Star-Related Lipid Transfer Protein 5
          Length = 231

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query: 352 LDFDENVRK-QVVAVICDVACHALNSIPVETVKLVAERLRDKSVLVKRY 399
           + +DENV   +++  I D  C +  S P   +KL++ R     VLVKRY
Sbjct: 95  VKWDENVTGFEIIQSITDTLCVSRTSTPSAAMKLISPRDFVDLVLVKRY 143


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.136    0.391 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 29,472,866
Number of Sequences: 62578
Number of extensions: 1140483
Number of successful extensions: 2637
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 2637
Number of HSP's gapped (non-prelim): 4
length of query: 1115
length of database: 14,973,337
effective HSP length: 109
effective length of query: 1006
effective length of database: 8,152,335
effective search space: 8201249010
effective search space used: 8201249010
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 57 (26.6 bits)