Citrus Sinensis ID: 001329


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------110
MPSLQSLPLTEHGRGILSSRRKTILLASGILVAGGTAAYLKSRFSSKKPDAFGHYNGLGDSERKPDKAVANRSNIKKANQKKGGLKSLQVLAAILLSEMGKMGARDLLALVGIVVLRTALSNRLAKVQGFLFRAAFLRRVPLFFQLISENILLCFLLSTMHSTSKYITGTLSLQFRKIVTKLIHTRYFENMAYYKISHVDGRITHPEQRLASDVPRFCSELSELVQDDLTAVTDGLLYTWRLCSYASPKYVFWILAYVLGAGTMMRNFSPAFGKLMSKEQQLEGEYRQLHSRLRTHAESIAFYGGENKEESHIQQKFKALTRHMRVVLHDHWWFGMIQDFLLKYLGATVAVILIIEPFFAGNLKPDTSTLGRAKMLSNLRYHTSVIISLFQSLGTLSISSRRLNRLSGYADRIHELMVISRELSIEDKSPQRNGSRNYFSEANYIEFSGVKVVTPTGNVLVENLTLKVEPGSNLLITGPNGSGKSSLFRVLGGLWPLVSGHIAKPGVGSDLNKEIFYVPQRPYTAVGTLRDQLIYPLTSDQEVEPLTHGGMVELLKNVDLEYLLDRYPPEKEINWGDELSLGEQQRLGMARLFYHKPKFAILDECTSAVTTDMEERFCAKVRAMGTSCITISHRPALVAFHDVVLSLDGEGEWRVHDKRDGSSVVTKSGINMIKSSETDRQSDAMAVEQAFVTAKKDSAFSNPKAQSYVSEVIAASPIADHNVPLPVFPQLKSAPRILPLRVADMFKVLVPTVFDKQGAQLLAVAFLVVSRTWISDRIASLNGTTVKYVLEQDKASFVRLIGVSVLQSAASSFIAPSIRHLTARLALGWRIRMTQHLLKSYLRKNSFYKVFNMSSKSIDADQRITHDLEKLTTDLSGLVTGMVKPSVDILWFTWRMKALTGQRGVAILYAYMLLGLGFLRSVTPEFGDLTSREQQLEGTFRFMHERLRAHAESVAFFGGGAREKAMIESRFRELLEHSLLLLKKKWLFGILDDFVTKQLPHNVTWGLSLLYAMEHKGDRALVSTQGELAHALRFLASVVSQSFLAFGDILELHRKFVELSGGINRIFELEELLDAAQPGTPSLFFFLVTWQGCRSVFIV
cccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHcccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEECcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccHHHHcHHHHHHHcHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEccEEEcccccEEECcccEEECcccEEEEEccccccHHHHHHHHHccccccccEEEcccccccccccEEECccccccccccHHHHHccccccccccccccHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHccccEEEECcccccccHHHHHHHHHHHHHcccCEEEEcccccHHHHHHHEEEEcccccCEEEEccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccHHHcccccccccccccccccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEccCEEEEc
****************LSSRRKTILLASGILVAGGTAAYLK******************************************GLKSLQVLAAILLSEMGKMGARDLLALVGIVVLRTALSNRLAKVQGFLFRAAFLRRVPLFFQLISENILLCFLLSTMHSTSKYITGTLSLQFRKIVTKLIHTRYFENMAYYKISHVDGRITHPEQRLASDVPRFCSELSELVQDDLTAVTDGLLYTWRLCSYASPKYVFWILAYVLGAGTMMRNFSPAFGKLMSKEQQLEGEYRQLHSRLRTHAESIAFYGGENKEESHIQQKFKALTRHMRVVLHDHWWFGMIQDFLLKYLGATVAVILIIEPFFAGNLKPDTSTLGRAKMLSNLRYHTSVIISLFQSLGTLSISSRRLNRLSGYADRIHELMVISRE**************NYFSEANYIEFSGVKVVTPTGNVLVENLTLKVEPGSNLLITGPNGSGKSSLFRVLGGLWPLVSGHIAKPGVGSDLNKEIFYVPQRPYTAVGTLRDQLIYPLTSDQEVEPLTHGGMVELLKNVDLEYLLDRYPPEKEINWGDELSLGEQQRLGMARLFYHKPKFAILDECTSAVTTDMEERFCAKVRAMGTSCITISHRPALVAFHDVVLSLDGEGEWRVHDKR***************************************************************************PRILPLRVADMFKVLVPTVFDKQGAQLLAVAFLVVSRTWISDRIASLNGTTVKYVLEQDKASFVRLIGVSVLQSAASSFIAPSIRHLTARLALGWRIRMTQHLLKSYLRKNSFYKVFNMSSKSIDADQRITHDLEKLTTDLSGLVTGMVKPSVDILWFTWRMKALTGQRGVAILYAYMLLGLGFLRSVTPEFGDLTSREQQLEGTFRFMHERLRAHAESVAFFGGGAREKAMIESRFRELLEHSLLLLKKKWLFGILDDFVTKQLPHNVTWGLSLLYAMEHKGDRALVSTQGELAHALRFLASVVSQSFLAFGDILELHRKFVELSGGINRIFELEELLDAAQPGTPSLFFFLVTWQGCRSVFIV
xxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPSLQSLPLTEHGRGILSSRRKTILLASGILVAGGTAAYLKSRFSSKKPDAFGHYNGLGDSERKPDKAVANRSNIKKANQKKGGLKSLQVLAAILLSEMGKMGARDLLALVGIVVLRTALSNRLAKVQGFLFRAAFLRRVPLFFQLISENILLCFLLSTMHSTSKYITGTLSLQFRKIVTKLIHTRYFENMAYYKISHVDGRITHPEQRLASDVPRFCSELSELVQDDLTAVTDGLLYTWRLCSYASPKYVFWILAYVLGAGTMMRNFSPAFGKLMSKEQQLEGEYRQLHSRLRTHAESIAFYGGENKEESHIQQKFKALTRHMRVVLHDHWWFGMIQDFLLKYLGATVAVILIIEPFFAGNLKPDTSTLGRAKMLSNLRYHTSVIISLFQSLGTLSISSRRLNRLSGYADRIHELMVISRELSIEDKSPQRNGSRNYFSEANYIEFSGVKVVTPTGNVLVENLTLKVEPGSNLLITGPNGSGKSSLFRVLGGLWPLVSGHIAKPGVGSDLNKEIFYVPQRPYTAVGTLRDQLIYPLTSDQEVEPLTHGGMVELLKNVDLEYLLDRYPPEKEINWGDELSLGEQQRLGMARLFYHKPKFAILDECTSAVTTDMEERFCAKVRAMGTSCITISHRPALVAFHDVVLSLDGEGEWRVHDKRDGSSVVTKSGINMIKSSETDRQSDAMAVEQAFVTAKKDSAFSNPKAQSYVSEVIAASPIADHNVPLPVFPQLKSAPRILPLRVADMFKVLVPTVFDKQGAQLLAVAFLVVSRTWISDRIASLNGTTVKYVLEQDKASFVRLIGVSVLQSAASSFIAPSIRHLTARLALGWRIRMTQHLLKSYLRKNSFYKVFNMSSKSIDADQRITHDLEKLTTDLSGLVTGMVKPSVDILWFTWRMKALTGQRGVAILYAYMLLGLGFLRSVTPEFGDLTSREQQLEGTFRFMHERLRAHAESVAFFGGGAREKAMIESRFRELLEHSLLLLKKKWLFGILDDFVTKQLPHNVTWGLSLLYAMEHKGDRALVSTQGELAHALRFLASVVSQSFLAFGDILELHRKFVELSGGINRIFELEELLDAAQPGTPSLFFFLVTWQGCRSVFIV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ABC transporter D family member 1 Contributes to the transport of fatty acids and their derivatives (acyl CoAs) across the peroxisomal membrane. Provides acetate to the glyoxylate cycle in developing seedlings. Involved in pollen tube elongation, ovule fertilization, and seeds germination after imbibition (controls the switch between the opposing developmental programs of dormancy and germination), probably by promoting beta-oxidation of storage lipids during gluconeogenesis. Required for biosynthesis of jasmonic acid and conversion of indole butyric acid to indole acetic acid. Confers sensitivity to monofluoroacetic acid (FAc), a toxic acetate analog, and to 2,4-dichlorophenoxybutyric acid (2,4-DB) and indole-3-butyric acid (IBA), two precursors of auxin after beta-oxidation.confidentQ94FB9

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.6.-.-Acting on acid anhydrides.probable
3.6.3.-3'-nucleotidase.probable
3.6.3.47Fatty-acyl-CoA-transporting ATPase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1YQT, chain A
Confidence level:very confident
Coverage over the Query: 443-650
View the alignment between query and template
View the model in PyMOL
Template: 3G5U, chain A
Confidence level:very confident
Coverage over the Query: 86-650
View the alignment between query and template
View the model in PyMOL
Template: 3TUI, chain C
Confidence level:very confident
Coverage over the Query: 443-650,689-718
View the alignment between query and template
View the model in PyMOL
Template: 3QF4, chain B
Confidence level:confident
Coverage over the Query: 764-1072
View the alignment between query and template
View the model in PyMOL