BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 001390
(1088 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2CO6|B Chain B, Salmonella Enterica Safa Pilin In Complex With The Safb
Chaperone (type I)
pdb|2CO7|B Chain B, Salmonella Enterica Safa Pilin In Complex With The Safb
Chaperone (Type Ii)
Length = 221
Score = 30.0 bits (66), Expect = 7.3, Method: Composition-based stats.
Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 10/62 (16%)
Query: 821 KIVSNSQNELDILKKSKEVIEDQVKLQKMI-------NEDLDTQLKVARVDLN---EACQ 870
++ +N Q++L I++ ++ D+ LQ + NE DTQ K A +DLN AC
Sbjct: 67 RLEANQQSQLRIVRTGGDMPTDRETLQWVCIKAVPPENEPSDTQAKGATLDLNLSINACD 126
Query: 871 KL 872
KL
Sbjct: 127 KL 128
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.311 0.127 0.346
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 26,843,330
Number of Sequences: 62578
Number of extensions: 999561
Number of successful extensions: 2506
Number of sequences better than 100.0: 31
Number of HSP's better than 100.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 23
Number of HSP's that attempted gapping in prelim test: 2447
Number of HSP's gapped (non-prelim): 68
length of query: 1088
length of database: 14,973,337
effective HSP length: 109
effective length of query: 979
effective length of database: 8,152,335
effective search space: 7981135965
effective search space used: 7981135965
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 57 (26.6 bits)