Citrus Sinensis ID: 001395

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------

MRSKSKKQSKAPSRLSNSDLSASPRTPSLTSAAWDSEEDFRTSLEDASTRYPTLIGKSAFIGQITDIETDSRGCKIWLSESSMLASSLAPGSLVSVSLPVSGKRFSNGFPLSSLADECVQQFGNESLDQTANQVGSYFALATVFPSCKVLKNEVRLSSSLSYTMGCPLSGRTVFVYTIQSQFLTGLVNGSNKPYNGEANHFSVCTCQELHLELVPLRSRLKMNGAAFSKMKVSAERSRDQLGNGIDSSPKTPMYQPRLSSQSVNQLASPVSEDSVSKSLNWNSLNVDAFDIKEVLEDESAIKLLQTCAASWLYSRSLLCGNLVAVPMLSEISIFLVIGANKLPADLTNERSQPQVTESMDHESNAFVINHETKVYLYPPLNAVSKSLREGTLPNAQIEFQNVQATVEQDISKLGGLSKEYAILKDIIISSSVKSTLSSLGLRPTKGVLLHGPPGTGKTSLARLCAHDSGVNLFTVNGPEVVSQNYGESEQALHEVFDSASQSAPAVVFIDELDAIAPARKDGGEELSQRMVATLLNLMDGVCRTDGVLVIAATNRPDSIEPALRRPGRLDREIEIDMSFLFSLLKNSPAAVPSPAQRLEILHALLSGMEHSLLDSEVEYLSMATHGFVGADLAALCNEAALVCLRRYSKIQTSSDVLHSTGTLFEFEGHSDTMLQDSDCSRNITESSRDCLDSASPCTSDLPTSLLSSSLPLRGTVSEIADNFHNGVSDSSGGMFMSEKGCALKLELVDFEKARMKVRPSAMREVILEVPKVKWEDVGGQREVKTQLMEAVEWPQKHQEAFKRIGTRPPTGILMFGPPGCSKTLMARAVASEAGLNFLAVKGPELFSKWVGESEKAVRSLFAKARANAPSIIFFDEIDGLAAIRGKESDGVSVSDRVMSQLLVELDGLHQRVNVTVIAATNRPDKIDPALLRPGRFDRLLYVGPPNETDREEIFRIHLRKIPCSSDVNIRELACLSEGCTGADISLICREAAISAIEENLDASRITMQHLKTAIRHVQPSEIHSYKELSAKFQRLVHSNAEADESGYQLRPSKSIGSNMWTLIKSISLFLCRFPAGLSQSESGSSG

ccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccEEEEEccccccccccEEEEcccHHcccccccccEEEEEECccccccccccccccHHHHHHHHHcccccccccccccccEEEEEEcccccccccccEEcccccccccccccccEEEEEEEccccccccccccccccccccccccHHcHHHHHHccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccHHHHHHHHHHHHHHHcccccccccEEEEEccccEEEEEEEccccccccccccccccccccccccccccCECcccccEECccccccccccccccccccccEEcccccccccccccccccHHHHHHHHHHHHHccccHHHHHHcccccccccEEEcccccHHHHHHHHHHHHcccCEEEEccccccccccccHHHHHHHHHHHHHHccccEEEEEcccccccccccccccHHHHHHHHHHHHHccccccccEEEEEEccccccccccccccccccEEEEEccccHHHcccccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccHHHHHHHHHHccccccccEEEEcccccccccccHHHHHHHHHHHHHHHHHcHHHHHHcccccccEEEEEccccccHHHHHHHHHHcccccEEEEccccccccccHHHHHHHHHHHHHHHHccccEEEEEccccccccccccccccccHHHHHHHHHHHHccccccccEEEEEEcccccccccccccccccccEEEEccccHHHHHHHHHHHHccccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccHHHHHHccccccccccccccccccHHHHcccccccccccccccc

*******************************************LEDASTRYPTLIGKSAFIGQITDIETDSRGCKIWLSESSMLASSLAPGSLVSVSLPVSGKRFSNGFPLSSLADECVQQFGNESLDQTANQVGSYFALATVFPSCKVLKNEVRLSSSLSYTMGCPLSGRTVFVYTIQSQFLTGLVNG*NKPYNGEANHFSVCTCQELHLELVPLRSRLK************************************************************NSLNVDAFDIKEVLEDESAIKLLQTCAASWLYSRSLLCGNLVAVPMLSEISIFLVIGANKL**********************AFVINHETKVYLYPPLNAVSKSLREGTLPNAQIEFQNVQATVEQDISKLGGLSKEYAILKDIIISSSVKSTLSSLGLRPTKGVLLHGPPGTGKTSLARLCAHDSGVNLFTVNGPEVVSQNYGESEQALHEVFDSASQSAPAVVFIDELDAIAP*********SQRMVATLLNLMDGVCRTDGVLVIAATNRPDSIEPALRRPGRLDREIEIDMSFLFSLLKNSPAAVPSPAQRLEILHALLSGMEHSLLDSEVEYLSMATHGFVGADLAALCNEAALVCLRRYSKIQTSSDVLHSTGTLFEFEG*****************S*RDCLDSASPCTSDLPTSLLSSSLPLRGTVSEIADNFHNGVSDSSGGMFMSEKGCALKLELVDFEKARMKVRPSAMREVILEVPKVKWEDVGGQREVKTQLMEAVEWPQKHQEAFKRIGTRPPTGILMFGPPGCSKTLMARAVASEAGLNFLAVKGPELFSKWVGESEKAVRSLFAKARANAPSIIFFDEIDGLAAIR*****GVSVSDRVMSQLLVELDGLHQRVNVTVIAATNRPDKIDPALLRPGRFDRLLYVGPPNETDREEIFRIHLRKIPCSSDVNIRELACLSEGCTGADISLICREAAISAIEENLDASRITMQHLKTAIRHVQPSEIHSYK*LSAKFQRLVHS******S***LRPSKSIGSNMWTLIKSISLFLCRFPA***********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Calmodulin-interacting protein 111		probable	Q9LET7

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HU3, chain A
Confidence level:very confident
Coverage over the Query: 770-1020
View the alignment between query and template
View the model in PyMOL

Template: 3HU3, chain A
Confidence level:very confident
Coverage over the Query: 308-342,364-382,394-575,590-652,674-676,733-767
View the alignment between query and template
View the model in PyMOL

Template: 1HQC, chain A
Confidence level:very confident
Coverage over the Query: 770-880,894-1069
View the alignment between query and template
View the model in PyMOL

Template: 1QVR, chain A
Confidence level:very confident
Coverage over the Query: 408-429,442-512,535-575,590-678,692-848,859-880,894-999
View the alignment between query and template
View the model in PyMOL

Template: 1CZ4, chain A
Confidence level:probable
Coverage over the Query: 63-97,135-180,204-224,240-247,258-259,296-342,364-378
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID	Alignment Graph	Confidence Level	View Alignment and Template
Query
4akg, chain A		confident	Alignment \| Template Structure