Citrus Sinensis ID: 001444


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------
MGEPLGSALAGVDSPVKEDMCMEVDPPLRENVATADDWRKALNKVVPAVVVLRTTACRAFDTEAAGASYATGFVVDKRRGIILTNRHVVKPGPVVAEAMFVNREEIPVYPIYRDPVHDFGFFRYDPSAIQFLNYDEIPLAPEAACVGLEIRVVGNDSGEKVSILAGTLARLDRDAPHYKKDGYNDFNTFYMQAASGTKGGSSGSPVIDWQGRAVALNAGSKSSSASAFFLPLERVVRALRFLQERRDCNIHNWEAVSIPRGTLQVTFVHKGFDETRRLGLQSATEQMVRHASPPGETGLLVVDSVVPGGPAHLRLEPGDVLVRVNGEVITQFLKLETLLDDGVDKNIELLIERGGISMTVNLVVQDLHSITPDYFLEVSGAVIHPLSYQQARNFRFPCGLVYVAEPGYMLFRAGVPRHAIIKKFAGEEISRLEDLISVLSKLSRGARVPIEYSSYTDRHRRKSVLVTIDRHEWYAPPQIYTRNDSSGLWSANPAILSEVLMPSSGINGGVQGVASQTVSICESISRGESDNGRKKRRVEENISADGVVADCSPHESGDARLEDSSTMENAGSRDYFGAPAATTNASFAESVIEPTLVMFEVHVPPSCMIDGVHSQHFFGTGVIIYHSQSMGLVVVDKNTVAISASDVMLSFAAFPIEIPGEVVFLHPVHNFALIAYDPSSLGVAGASVVRAAELLPEPALRRGDSVYLVGLSRSLQATSRKSIVTNPCAALNISSADCPRYRAMNMEVIELDTDFGSTFSGVLTDEHGRVQAIWGSFSTQVKFGCSSSEDHQFVRGIPIYTISRVLDKIISGASGPSLLINGVKRPMPLVRILEVELYPTLLSKARSFGLSDDWVQALVKKDPVRRQVLRVKGCLAGSKAENMLEQGDMMLAINKQPVTCFHDIENACQALDKDGEDNGKLDITIFRQGREIELQVGTDVRDGNGTTRVINWCGCIVQDPHPAVRALGFLPEEGHGVYVARWCHGSPVHRYGLYALQWIVEINGKRTPDLEAFVNVTKEIEHGEFVRVRTVHLNGKPRVLTLKQDLHYWPTWELIFDPDTALWRRKSVKALNSSCA
cccccccccccccccccccccccccccccccccccHHHHHHHHHHcccEEEEEEEEEccccccccccccCEEEEEEccccEEEccccccccccEEEEEEcccccEEEEEEEEccccccEEEEEEcccccccEEcccccccccccccccEEEEEcccccccccEEEEEEEcccccccccccccccccccccEEEEccccccccccccccccccEEEEEccccccccccccccHHHHHHHHHHHHHccccccccccccccccCEEEEEEEEccHHHHHHccccHHHHHHHHHccccccccEEEEEEEccccccccccccccEEEEEccEEccccccHHHHHccccccEEEEEEEEccEEEEEEEEEEcccccccccccccccEEEccccHHHHHHccccccEEEEEccccHHHHcccccccEEEcccccccccHHHHHHHHHHcccccEEEEEEEEEccccCEEEEEEEEccccccccccEEEEccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccccccccccccCEEEEEEEEccccccEEEEccccccccccEEEEEECcccCECcCEEEEEcccccEEEEEEccccccccccccccccccccccccccccEEEEEEcccccccccccCEECccEEEccccccccccccccccccEEEEcccccccccEEEcccccEEEEEccccccCEECccccccEEEEECccHHHHHHHHHHHHccccccccCCcccccccccEEEEEEEEEEccHHHHHHccccHHHHHHHHHccccccCEEEEEEEcccccHccccccccEEEEEccCEccccccHHHHHHccccccccccEEEEEEEEccEEEEEEEEEECccccccccEEEccccccccccHHHHHccccccccccEEEEEEccccHHHHcccccccEEEEEccCCcccHHHHHHHHHHcccccEEEEEEEEEccCEEEEEEcccccccccEEEEEccccccEEEEEEcccccccc
******************************NVATADDWRKALNKVVPAVVVLRTTACRAFDTEAAGASYATGFVVDKRRGIILTNRHVVKPGPVVAEAMFVNREEIPVYPIYRDPVHDFGFFRYDPSAIQFLNYDEIPLAPEAACVGLEIRVVGNDSGEKVSILAGTLARLDRDAPHYKKDGYNDFNTFYMQAASGTKGGSSGSPVIDWQGRAVALNAGSKSSSASAFFLPLERVVRALRFLQERRDCNIHNWEAVSIPRGTLQVTFVHKGFDETRRLGLQSATEQMVRHASPPGETGLLVVDSVVPGGPAHLRLEPGDVLVRVNGEVITQFLKLETLLDDGVDKNIELLIERGGISMTVNLVVQDLHSITPDYFLEVSGAVIHPLSYQQARNFRFPCGLVYVAEPGYMLFRAGVPRHAIIKKFAGEEISRLEDLISVLSKLSRGARVPIEYSSYTDRHRRKSVLVTIDRHEWYAPPQIYTRNDSSGLWSANPAILSEVLMPSSGINGGVQGVASQTVSIC***************************ADCSPHESGDARLEDSSTMENAGSRDYFGAPAATTNASFAESVIEPTLVMFEVHVPPSCMIDGVHSQHFFGTGVIIYHSQSMGLVVVDKNTVAISASDVMLSFAAFPIEIPGEVVFLHPVHNFALIAYDPSSLGVAGASVVRAAELLPEPALRRGDSVYLVGLSRSLQATSRKSIVTNPCAALNISSADCPRYRAMNMEVIELDTDFGSTFSGVLTDEHGRVQAIWGSFSTQVKFGCSSSEDHQFVRGIPIYTISRVLDKIISGASGPSLLINGVKRPMPLVRILEVELYPTLLSKARSFGLSDDWVQALVKKDPVRRQVLRVKGCLAGSKAENMLEQGDMMLAINKQPVTCFHDIENACQALDKDGEDNGKLDITIFRQGREIELQVGTDVRDGNGTTRVINWCGCIVQDPHPAVRALGFLPEEGHGVYVARWCHGSPVHRYGLYALQWIVEINGKRTPDLEAFVNVTKEIEHGEFVRVRTVHLNGKPRVLTLKQDLHYWPTWELIFDPDTALWRRK**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGEPLGSALAGVDSPVKEDMCMEVDPPLRENVATADDWRKALNKVVPAVVVLRTTACRAFDTEAAGASYATGFVVDKRRGIILTNRHVVKPGPVVAEAMFVNREEIPVYPIYRDPVHDFGFFRYDPSAIQFLNYDEIPLAPEAACVGLEIRVVGNDSGEKVSILAGTLARLDRDAPHYKKDGYNDFNTFYMQAASGTKGGSSGSPVIDWQGRAVALNAGSKSSSASAFFLPLERVVRALRFLQERRDCNIHNWEAVSIPRGTLQVTFVHKGFDETRRLGLQSATEQMVRHASPPGETGLLVVDSVVPGGPAHLRLEPGDVLVRVNGEVITQFLKLETLLDDGVDKNIELLIERGGISMTVNLVVQDLHSITPDYFLEVSGAVIHPLSYQQARNFRFPCGLVYVAEPGYMLFRAGVPRHAIIKKFAGEEISRLEDLISVLSKLSRGARVPIEYSSYTDRHRRKSVLVTIDRHEWYAPPQIYTRNDSSGLWSANPAILSEVLMPSSGINGGVQGVASQTVSICESISRGESDNGRKKRRVEENISADGVVADCSPHESGDARLEDSSTMENAGSRDYFGAPAATTNASFAESVIEPTLVMFEVHVPPSCMIDGVHSQHFFGTGVIIYHSQSMGLVVVDKNTVAISASDVMLSFAAFPIEIPGEVVFLHPVHNFALIAYDPSSLGVAGASVVRAAELLPEPALRRGDSVYLVGLSRSLQATSRKSIVTNPCAALNISSADCPRYRAMNMEVIELDTDFGSTFSGVLTDEHGRVQAIWGSFSTQVKFGCSSSEDHQFVRGIPIYTISRVLDKIISGASGPSLLINGVKRPMPLVRILEVELYPTLLSKARSFGLSDDWVQALVKKDPVRRQVLRVKGCLAGSKAENMLEQGDMMLAINKQPVTCFHDIENACQALDKDGEDNGKLDITIFRQGREIELQVGTDVRDGNGTTRVINWCGCIVQDPHPAVRALGFLPEEGHGVYVARWCHGSPVHRYGLYALQWIVEINGKRTPDLEAFVNVTKEIEHGEFVRVRTVHLNGKPRVLTLKQDLHYWPTWELIFDPDTALWRRKSVKALNSSCA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protease Do-like 7 Probable serine protease.confidentQ8RY22

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1LCY, chain A
Confidence level:probable
Coverage over the Query: 27-174,187-240,260-367
View the alignment between query and template
View the model in PyMOL
Template: 3K6Y, chain A
Confidence level:probable
Coverage over the Query: 11-240
View the alignment between query and template
View the model in PyMOL
Template: 3PV2, chain A
Confidence level:probable
Coverage over the Query: 72-169,185-240,254-285,298-451
View the alignment between query and template
View the model in PyMOL
Template: 4A8C, chain A
Confidence level:probable
Coverage over the Query: 72-240,254-266,280-451
View the alignment between query and template
View the model in PyMOL
Template: 1LCY, chain A
Confidence level:probable
Coverage over the Query: 27-174,187-240,260-367
View the alignment between query and template
View the model in PyMOL