Citrus Sinensis ID: 001459

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070----
MLYAKVHPLDPQEDVTNDTTVGTKACRKIPEIQEYGKDIKNLDEVPRLQLRTAGLRKKSSTKCLYDMLQESESDRSTTVGSCSTEIEEESDSEANMGIVKSLIANEGTSAVDRRPENFDQKLQAYCSSSGSESAKISFLRAPKRPMYKESNGTNSNRNFSRRFLSSSGHFNLSILELRDKISNGSCHVEGKISKQHKVQPSDCVLSSSPQQSCRFTEMDYRGSSERKKNSSGRKKFNEECLNGEKDAKSELLEIIEKAISSLFFSGDLRKCNKDYVVEVTTLYKMLNSKTGVKYDMLQDVILEQLLTAISASKEETVIRASVSILTTIILANESVIEDIKKKGLRLSDLATALKRNVPEAAILIYLIKPSPTEIKTLELLPTLVEVICTSKLYKGKLESVRLTPPAASLMIIEVLVTAFDYATNNMHLAAINSPRVLCGLLDVARHQNLEELISLATILVKCIQFDGQCRKYLSEFTAVAPLACLLQSGEKRAIMIALEFFHEILRIPRSSAIDLLQRIHKEGNINILHILKLSLQQLQSDYQLLAANLLLQLDTLENTTGKSVFTEEAMQVILKAVASEESSTMQLLSSFILSNIGGTFSWTGEPYTVAWLVKKAGLNSSWLQNMIRNFDWLDQSLQDRGVDSWSSKIAKSIIEIGKPIYYALEKGLKSKTKSVCRDSLTTIAWLSFEVSKSPNSVRHSACQILLDGVEQFLHPGLELEERLLACLCIYNYASGKGMQKLIRSSEGVRESLRRLSNVTWMAEELHKAADYYLPNISRISCVHTQILEASHKCSGAVTALIYYKGLLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQMVQRKLELIEVIATKEPIRKLDTYGKTIFASTQGHRMKVIDSSRTLKDIYRSKGIKSMSVVQGKIYIGCMDSSIQELAVSNNVEREIKAPFKSWRLQSKPINSLVVYKDWLYSASSSVEGSNIKEWRRHRKPQISIAPEKGTTIQAMAVVEDFIYLNYNSSASSLQIWLRGTQQKVGRISAGSKITSLLTANDIVLCGTETGLIKGWIPL
ccccccccccccccccccccccccccccccHHHHcccccccccccHHHHHHHccccccccHHHHHHHHHcccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccccEEcccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccccEEHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEHHccccccccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccccHHHHHEEHHHHccccccHHHHHccccHHHHccccEEEEccccccccccccccccccEEEccccEEEEEccccccEEEEEEEcccEEEEEEccccEEEEccccccEEEEEEcccccccEEEEEEcccccEEEEEcccccEEEEEccccEEEEEEEccccccEEEEEEcccEEEEEEccccEEEEEcccccEEEEccccEEEEEEEccEEEEEEEcccccEEEcccccccEEccccEEEEcccccEEEEEEEcccEEEEEEEccccEEEEEEccccccccccccccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEccccccEEEEEEcccEEEEEEccccEEEEccc
ccccccccccccccccccccccccHccHHHHHHHHHHHHHcHHHcHHHHHHcccccccccHHHHHHHHHHHcccccccccccccccccccccHccccccccccHHHcccHHccccHHHHHHHcccccccccccHHHHccccccccccccccHccccccccccccccccccccHHHHccccccccccccccccccccccccHcccccccccccccccHccccccHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHccccHHHcHHHHHHHHHHHHHHHccccccHHHHccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHHccccccHHHHHHHHHHcHHHHHHHHHHccccHHHHHHHcHHHHHHHHHHccccccccccEEcccHHHHHHHHHHHHHHcccccccHHHHHHHccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHcHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccEEccccccccHHHHEccccccccHHHHcccccEEcccccccccccEEEEEEcccccEEEEEEEEcccEEEEEccccEEEEEEcccccEEEEEEEEcccccEEEEEEcccccEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEEEcccEEEEEccccEEEEEEcccccEEEEEEccEEEEEEcccEEEEEccccEEEEEEcccccEEEEEcccccEEEEcccEEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEccccccEEEEEEEccccEEEEcccccEEEEEEcccccEEEEEEcccEEEEEEEcccEEEEEccccEEEEEEcc
mlyakvhpldpqedvtndttvgtkacrkiPEIQeygkdiknldevprlqlrtaglrkkssTKCLYDMLQesesdrsttvgscsteieeesdseaNMGIVKSLIanegtsavdrrpenfdQKLQAYCSssgsesakisflrapkrpmykesngtnsnrnFSRRFLsssghfnlSILELRDkisngschvegkiskqhkvqpsdcvlssspqqscrftemdyrgsserkknssgrkkfNEECLNGEKDAKSELLEIIEKAISSLffsgdlrkcnKDYVVEVTTLYKMLnsktgvkydMLQDVILEQLLTAISASKEETVIRASVSILTTIILANESVIEDIKKKGLRLSDLATALKRNVPEAAILIYLikpspteiktlelLPTLVEVICTSklykgklesvrltppaaSLMIIEVLVTAFDYATNNMHLAAINSPRVLCGLLDVARHQNLEELISLATILVKCIQFDGQCRKYLSEFTAVAPLACLLQSGEKRAIMIALEFFHEILRIPRSSAIDLLQRIHKEGNINILHILKLSLQQLQSDYQLLAANLLLQLDtlenttgksvfTEEAMQVILKAVASEESSTMQLLSSFILsniggtfswtgepYTVAWLVKKAGLNSSWLQNMIRNFDWLDQslqdrgvdswSSKIAKSIIEIGKPIYYALEKGLKSKTKSVCRDSLTTIAWLSFevskspnsvrhSACQILLDGVEQFLHPGLELEERLLACLCIYNYASGKGMQKLIRSSEGVRESLRRLSNVTWMAEELHKAAdyylpnisrisCVHTQILEASHKCSGAVTALIYYKGLlcsgfsdgsikmWDIKKQSAMLVWDVKEHrkavtsfslfepgesllsgsadkTIGVWQMVQRKLELIEVIATkepirkldtygktifastqghrmkvidssrTLKDIYRSKGIKSMSVVQGKIYIGCMDSSIQELAVSNnvereikapfkswrlqskpinslvVYKDWLYSasssvegsnikewrrhrkpqisiapekgttIQAMAVVEDFIYLNYNSSASSLQIWLRGTqqkvgrisagsKITSLLTANDIVLCgtetglikgwipl
mlyakvhpldpqedvtndttvgtkacrkipeiqeygkdiknldevprlqlrtaglrkksstkCLYDMlqesesdrsttvgSCSTEieeesdseanMGIVKSLIANEGTSAVDRRPENFDQKLQAYcsssgsesakisflrapkrpmykesngtnsnrnFSRRFLSSSGHFNLSILELRDKISNGSCHVEGKIskqhkvqpsdcvlssspqqscrftemdyrgsserkknssgrkkfneeclngEKDAKSELLEIIEKAISslffsgdlrkcNKDYVVEVTTLYKMLNSKTGVKYDMLQDVILEQLLTAISASKEETVIRASVSILTTIILANESVIEDIKKKGLRLSDLATALKRNVPEAAILIYLIKPSPTEIKTLELLPTLVEVICTSKlykgklesvrltpPAASLMIIEVLVTAFDYATNNMHLAAINSPRVLCGLLDVARHQNLEELISLATILVKCIQFDGQCRKYLSEFTAVAPLACLLQSGEKRAIMIALEFFHEILRIPRSSAIDLLQRIHKEGNINILHILKLSLQQLQSDYQLLAANLLLQLDTLENTTGKSVFTEEAMQVILKAVASEESSTMQLLSSFILSNIGGTFSWTGEPYTVAWLVKKAGLNSSWLQNMIRNFDWLDQSLQDRGVDSWSSKIAKSIIEIGKPIYYALEKGLKSKTKSVCRDSLTTIAWLSFEVSKSPNSVRHSACQILLDGVEQFLHPGLELEERLLACLCIYNYASGKGMQKLIRSSEGVRESLRRLSNVTWMAEELHKAADYYLPNISRISCVHTQILEASHKCSGAVTALIYYKGLLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTsfslfepgesllsgsadkTIGVWQMVQRKLELIEViatkepirkldtygktifastqghrmkvidssrtlkdiyrskgiksmsvVQGKIYIGCMDSSIQELAVSNNVEREIKapfkswrlqskpiNSLVVYKDWLYSASSsvegsnikewrrhrkpqisiapekgttIQAMAVVEDFIYLNYNSSASSLQIWLRGTQQKVGRISAGSKITSLLTANDIVLCgtetglikgwipl
MLYAKVHPLDPQEDVTNDTTVGTKACRKIPEIQEYGKDIKNLDEVPRLQLRTAGLRKKSSTKCLYDMLQESESDRSTTVGSCSTEIEEESDSEANMGIVKSLIANEGTSAVDRRPENFDQKLQAYCSSSGSESAKISFLRAPKRPMYKEsngtnsnrnfsrrflsssgHFNLSILELRDKISNGSCHVEGKISKQHKVQPSDCVLSSSPQQSCRFTEMDYRGSSERKKNSSGRKKFNEECLNGEKDAKSELLEIIEKAISSLFFSGDLRKCNKDYVVEVTTLYKMLNSKTGVKYDMLQDVILEQLLTAISASKEETVIRASVSILTTIILANESVIEDIKKKGLRLSDLATALKRNVPEAAILIYLIKPSPTEIKTLELLPTLVEVICTSKLYKGKLESVRLTPPAASLMIIEVLVTAFDYATNNMHLAAINSPRVLCGLLDVARHQNLEELISLATILVKCIQFDGQCRKYLSEFTAVAPLACLLQSGEKRAIMIALEFFHEILRIPRSSAIDLLQRIHKEGNINIlhilklslqqlqsdyqllaanlllqldtlentTGKSVFTEEAMQVILKAVASEESSTMQLLSSFILSNIGGTFSWTGEPYTVAWLVKKAGLNSSWLQNMIRNFDWLDQSLQDRGVDSWSSKIAKSIIEIGKPIYYALEKGLKSKTKSVCRDSLTTIAWLSFEVSKSPNSVRHSACQILLDGVEQFLHPGleleerllACLCIYNYASGKGMQKLIRSSEGVRESLRRLSNVTWMAEELHKAADYYLPNISRISCVHTQILEASHKCSGAVTALIYYKGLLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQMVQRKLELIEVIATKEPIRKLDTYGKTIFASTQGHRMKVIDSSRTLKDIYRSKGIKSMSVVQGKIYIGCMDSSIQELAVSNNVEREIKAPFKSWRLQSKPINSLVVYKDWLYSASSSVEGSNIKEWRRHRKPQISIAPEKGTTIQAMAVVEDFIYLNYNSSASSLQIWLRGTQQKVGRISAGSKITSLLTANDIVLCGTETGLIKGWIPL
***********************KACRKIPEIQEYGKDIKNLDEV**L************************************************************************************************************************HFNLSILELRDKI*********************************************************************LLEIIEKAISSLFFSGDLRKCNKDYVVEVTTLYKMLNSKTGVKYDMLQDVILEQLLTAISASKEETVIRASVSILTTIILANESVIEDIKKKGLRLSDLATALKRNVPEAAILIYLIKPSPTEIKTLELLPTLVEVICTSKLYKGKLESVRLTPPAASLMIIEVLVTAFDYATNNMHLAAINSPRVLCGLLDVARHQNLEELISLATILVKCIQFDGQCRKYLSEFTAVAPLACLLQSGEKRAIMIALEFFHEILRIPRSSAIDLLQRIHKEGNINILHILKLSLQQLQSDYQLLAANLLLQLDTLENTTGKSVFTEEAMQVILKAVASEESSTMQLLSSFILSNIGGTFSWTGEPYTVAWLVKKAGLNSSWLQNMIRNFDWLDQSLQDRGVDSWSSKIAKSIIEIGKPIYYALEKGLKSKTKSVCRDSLTTIAWLSFEVSKSPNSVRHSACQILLDGVEQFLHPGLELEERLLACLCIYNYASGKGMQKLIRS**GVRESLRRLSNVTWMAEELHKAADYYLPNISRISCVHTQILEASHKCSGAVTALIYYKGLLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQMVQRKLELIEVIATKEPIRKLDTYGKTIFASTQGHRMKVIDSSRTLKDIYRSKGIKSMSVVQGKIYIGCMDSSIQELAVSNNVEREIKAPFKSWRLQSKPINSLVVYKDWLYSAS**********W*******ISIAPEKGTTIQAMAVVEDFIYLNYNSSASSLQIWLRGTQQKVGRISAGSKITSLLTANDIVLCGTETGLIKGWI**
******H**************************************************************************************************************FDQKLQ***********************************************N*SILELRDK***********************************************************************LEIIEKAISSLFFSGDLRKCNKDYVVEVTTLYKMLNSKTGVKYDMLQDVILEQLLTAISASKEETVIRASVSILTTIILANESVIEDIKKKGLRLSDLATALKRNVPEAAILIYLIKPSPTEIKTLELLPTLVEVICTSKLYKGKLESVRLTPPAASLMIIEVLVTAFDYATNNMHLAAINSPRVLCGLLDVARHQNLEELISLATILVKCIQFDGQCRKYLSEFTAVAPLACLLQSGEKRAIMIALEFFHEILRIPRSSAIDLLQRIHKEGNINILHILKLSLQQLQSDYQLLAANLLLQLDTLENTTGKSVFTEEAMQVILKAVASEESSTMQLLSSFILSNIGGTFSWTGEPYTVAWLVKKAG*******************LQ*RGVDSWSSKIAKSIIEIGKPIY************SVCRDSLTTIAWLSFEVSKSPNSVRHSACQILLDGVEQFLHPGLELEERLLACLCIYNYASGKGMQKLIRSSEGVRESLRRLSNVTWMAEELHKAADYYLPNISRISCVHTQILEASHKCSGAVTALIYYKGLLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQMVQRKLELIEVIATKEPIRKLDTYGKTIFASTQGHRMKVIDSSRTLKDIYRSKGIKSMSVVQGKIYIGCMDSSIQELAVSNNVEREIKAPFKSWRLQSKPINSLVVYKDWLYSASSSVEGSNIKEWRRHRKPQISIAPEKGTTIQAMAVVEDFIYLNYNSSASSLQIWLRGTQQKVGRISAGSKITSLLTANDIVLCGTETGLIKGWIPL
MLYAKVHPLDPQEDVTNDTTVGTKACRKIPEIQEYGKDIKNLDEVPRLQLRTAGLRKKSSTKCLYDMLQ************************ANMGIVKSLIANEGTSAVDRRPENFDQKLQAY**********ISFLRAPKRPMYKESNGTNSNRNFSRRFLSSSGHFNLSILELRDKISNGSCHVEGK*********************CRFT*********************EECLNGEKDAKSELLEIIEKAISSLFFSGDLRKCNKDYVVEVTTLYKMLNSKTGVKYDMLQDVILEQLLTAISASKEETVIRASVSILTTIILANESVIEDIKKKGLRLSDLATALKRNVPEAAILIYLIKPSPTEIKTLELLPTLVEVICTSKLYKGKLESVRLTPPAASLMIIEVLVTAFDYATNNMHLAAINSPRVLCGLLDVARHQNLEELISLATILVKCIQFDGQCRKYLSEFTAVAPLACLLQSGEKRAIMIALEFFHEILRIPRSSAIDLLQRIHKEGNINILHILKLSLQQLQSDYQLLAANLLLQLDTLENTTGKSVFTEEAMQVILKAVASEESSTMQLLSSFILSNIGGTFSWTGEPYTVAWLVKKAGLNSSWLQNMIRNFDWLDQSLQDRGVDSWSSKIAKSIIEIGKPIYYALEKGLKSKTKSVCRDSLTTIAWLSFEVSKSPNSVRHSACQILLDGVEQFLHPGLELEERLLACLCIYNYASGKGMQKLIRSSEGVRESLRRLSNVTWMAEELHKAADYYLPNISRISCVHTQILEASHKCSGAVTALIYYKGLLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQMVQRKLELIEVIATKEPIRKLDTYGKTIFASTQGHRMKVIDSSRTLKDIYRSKGIKSMSVVQGKIYIGCMDSSIQELAVSNNVEREIKAPFKSWRLQSKPINSLVVYKDWLYSASSSVEGSNIKEWRRHRKPQISIAPEKGTTIQAMAVVEDFIYLNYNSSASSLQIWLRGTQQKVGRISAGSKITSLLTANDIVLCGTETGLIKGWIPL
*****************DT*VGTKACRKIPEIQEYGKDIKNLDEVPRLQLRTAGLRKKSSTKCLYDMLQESES*RS**V*****************************S*VDRRPENFDQKLQAYCSSSGSESAKISFLRAPKRPMYKESNGTN**RNF***FLSSSGHFNLSILELRDKISN*************KVQPSDCVLSSSPQQSCRFT*MDY******************ECLNGEKDAKSELLEIIEKAISSLFFSGDLRKCNKDYVVEVTTLYKMLNSKTGVKYDMLQDVILEQLLTAISASKEETVIRASVSILTTIILANESVIEDIKKKGLRLSDLATALKRNVPEAAILIYLIKPSPTEIKTLELLPTLVEVICTSKLYKGKLESVRLTPPAASLMIIEVLVTAFDYATNNMHLAAINSPRVLCGLLDVARHQNLEELISLATILVKCIQFDGQCRKYLSEFTAVAPLACLLQSGEKRAIMIALEFFHEILRIPRSSAIDLLQRIHKEGNINILHILKLSLQQLQSDYQLLAANLLLQLDTLENTTGKSVFTEEAMQVILKAVASEESSTMQLLSSFILSNIGGTFSWTGEPYTVAWLVKKAGLNSSWLQNMIRNFDWLDQSLQDRGVDSWSSKIAKSIIEIGKPIYYALEKGLKSKTKSVCRDSLTTIAWLSFEVSKSPNSVRHSACQILLDGVEQFLHPGLELEERLLACLCIYNYASGKGMQKLIRSSEGVRESLRRLSNVTWMAEELHKAADYYLPNISRISCVHTQILEASHKCSGAVTALIYYKGLLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQMVQRKLELIEVIATKEPIRKLDTYGKTIFASTQGHRMKVIDSSRTLKDIYRSKGIKSMSVVQGKIYIGCMDSSIQELAVSNNVEREIKAPFKSWRLQSKPINSLVVYKDWLYSASSSVEGSNIKEWRRHRKPQISIAPEKGTTIQAMAVVEDFIYLNYNSSASSLQIWLRGTQQKVGRISAGSKITSLLTANDIVLCGTETGLIKGWIPL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLYAKVHPLDPQEDVTNDTTVGTKACRKIPEIQEYGKDIKNLDEVPRLQLRTAGLRKKSSTKCLYDMLQESESDRSTTVGSCSTEIEEESDSEANMGIVKSLIANEGTSAVDRRPENFDQKLQAYCSSSGSESAKISFLRAPKRPMYKESNGTNSNRNFSRRFLSSSGHFNLSILELRDKISNGSCHVEGKISKQHKVQPSDCVLSSSPQQSCRFTEMDYRGSSERKKNSSGRKKFNEECLNGEKDAKSELLEIIEKAISSLFFSGDLRKCNKDYVVEVTTLYKMLNSKTGVKYDMLQDVILEQLLTAISASKEETVIRASVSILTTIILANESVIEDIKKKGLRLSDLATALKRNVPEAAILIYLIKPSPTEIKTLELLPTLVEVICTSKLYKGKLESVRLTPPAASLMIIEVLVTAFDYATNNMHLAAINSPRVLCGLLDVARHQNLEELISLATILVKCIQFDGQCRKYLSEFTAVAPLACLLQSGEKRAIMIALEFFHEILRIPRSSAIDLLQRIHKEGNINILHILKLSLQQLQSDYQLLAANLLLQLDTLENTTGKSVFTEEAMQVILKAVASEESSTMQLLSSFILSNIGGTFSWTGEPYTVAWLVKKAGLNSSWLQNMIRNFDWLDQSLQDRGVDSWSSKIAKSIIEIGKPIYYALEKGLKSKTKSVCRDSLTTIAWLSFEVSKSPNSVRHSACQILLDGVEQFLHPGLELEERLLACLCIYNYASGKGMQKLIRSSEGVRESLRRLSNVTWMAEELHKAADYYLPNISRISCVHTQILEASHKCSGAVTALIYYKGLLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQMVQRKLELIEVIATKEPIRKLDTYGKTIFASTQGHRMKVIDSSRTLKDIYRSKGIKSMSVVQGKIYIGCMDSSIQELAVSNNVEREIKAPFKSWRLQSKPINSLVVYKDWLYSASSSVEGSNIKEWRRHRKPQISIAPEKGTTIQAMAVVEDFIYLNYNSSASSLQIWLRGTQQKVGRISAGSKITSLLTANDIVLCGTETGLIKGWIPL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1074 2.2.26 [Sep-21-2011]
C6L7U11485 Putative E3 ubiquitin-pro N/A no 0.741 0.536 0.284 6e-75
D1FP571485 Putative E3 ubiquitin-pro N/A no 0.741 0.536 0.284 4e-72
D1FP531488 Putative E3 ubiquitin-pro N/A no 0.803 0.579 0.262 9e-66
P90648732 Myosin heavy chain kinase yes no 0.206 0.303 0.271 1e-08
Q6FT96711 Mitochondrial division pr yes no 0.090 0.136 0.291 8e-06
Q6DRF9387 WD repeat-containing prot yes no 0.126 0.351 0.235 5e-05
A7TNS8669 CCR4-associated factor 4 N/A no 0.101 0.162 0.260 8e-05
P87177 922 Uncharacterized WD repeat yes no 0.081 0.095 0.333 0.0001
P36130643 CCR4-associated factor 4 yes no 0.098 0.164 0.267 0.0001
A6ZZZ8645 CCR4-associated factor 4 N/A no 0.098 0.164 0.267 0.0002
>sp|C6L7U1|LIN1_LOTJA Putative E3 ubiquitin-protein ligase LIN-1 OS=Lotus japonicus GN=CERBERUS PE=2 SV=2 Back     alignment and function desciption
 Score =  283 bits (723), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 238/836 (28%), Positives = 434/836 (51%), Gaps = 40/836 (4%)

Query: 259  ISSLFFSGDLRKCNKDYVVEVTTLYKMLNSKTGVKYDMLQDVILEQLLTAISASKEETVI 318
            ISSL  S +L +C ++ V+++  L K   +   +   + +  I+  L+  +SAS+   V+
Sbjct: 664  ISSLCTSENLPEC-EEAVLKIARLLKDSKTNPQIHSYLSKPTIINGLVEILSASRNREVL 722

Query: 319  RASVSILTTIILANESVIEDIKKKGLRLSDLATALKRNVPEAAILIYLIKPSPTEIKTLE 378
            R S+ IL+ +I  ++SV E +         LAT LK  + EAA+LIY ++P   ++   E
Sbjct: 723  RTSIYILSELIFTDDSVAETLNSVDSDFDCLATLLKNGLAEAALLIYQLRPVFAQLSAHE 782

Query: 379  LLPTLVEVICTSKLYKGKLESVRLTPPAASLMIIEVLVTAFDYATNNMHLAAINSPRVLC 438
            L+P+LV+VI          + V + P  A++ I+E  +   D  + +++ +++ S   + 
Sbjct: 783  LIPSLVDVIQNKNEELDDFQLV-IDPKDAAIAILEQTLMGGDEYSRSLNASSVISANGIP 841

Query: 439  GLLDVARHQNLEELISLATILVKCIQFDGQCRKYLSEFTAVAPLACLLQSGEKRAIMIAL 498
             L  V   + +E   S+ ++L+ C+Q +  C+  ++    ++P+  L  SG        +
Sbjct: 842  TL--VKYLERMEGRRSVVSVLLCCMQAEKSCKNLIANRIELSPVLELFHSGNDSVRGTCV 899

Query: 499  EFFHEILRIPRSSAID-LLQRIHKEGNINILHILKLSLQQLQSDYQLLAANLLLQLDTLE 557
            EF  E++++ R ++ + +L  I  EG  + +H   + LQ    ++QL  A+LLLQLD L 
Sbjct: 900  EFLSELVQLNRRTSCNQILHTIKDEGAFSTMHTFLVYLQMAPMEHQLAVASLLLQLDLLA 959

Query: 558  NTTGKSVFTEEAMQVILKAVASEESSTMQLLSSFILSNIGGTFSWTGEPYTVAWLVKKAG 617
                 S++ EEA++ +++A+  ++ S  Q+ +   L  + G  S +G+ YT AWL+K AG
Sbjct: 960  EPRKMSIYREEAVETLIEALWQKDFSNTQMKALDALLFLIGHISSSGKSYTEAWLLKIAG 1019

Query: 618  LNSSW-----LQNMIRNFDWLDQSLQD--RGVDSWSSKIAKSII--EIGKPIYYALEKGL 668
             +  +     ++ + ++ + L ++++D    ++SW  +IA  +   E G  I+ ALE+ L
Sbjct: 1020 FDQPYNALMKVEQLGQHDNDLIETMEDEKNALNSWQKRIASVLCNHENGS-IFKALEECL 1078

Query: 669  KSKTKSVCRDSLTTIAWLSFEVSKSPNS-VRHSACQILLDGVEQFLHPGLELEERLLACL 727
            KS +  + +  L    WL+  +   P++ VR  A + LL+ V   L     LEE++LA L
Sbjct: 1079 KSNSLKMAKSCLVLATWLTHMLYTLPDTGVRDVARKSLLEEVINVLQSSKNLEEKILATL 1138

Query: 728  CIYNYASGKGMQKLIR-SSEGVRESLRRLSNVTWMAEELHKAADYYLPNISRISCVH--- 783
             +  + S     + +R  ++ +  +LRRL   + +A ++ K     + N+  +       
Sbjct: 1139 ALKTFISDPSTHEALRVYAKSIYRTLRRLKKYSVVAVDIMKV----ILNLKSVDVTELWS 1194

Query: 784  -TQILEASHKCSGAVTALIYYKGLLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSF 842
              +++E     +G V +++Y  G + SG +DG+IK+WD +K+   ++ +  EH KAVT  
Sbjct: 1195 CKEVVELDLSSNGEVLSMVYLNGQVLSGHTDGTIKVWDARKRIPRVIQETHEHTKAVT-- 1252

Query: 843  SLFEPGESLLSGSADKTIGVWQMVQRKLELIEVIATKEPIRKLDTYGKTIFASTQGHRMK 902
            SL   G+ L SGS DKTI VW +    ++ I+V   KE + +L    K     +QG  +K
Sbjct: 1253 SLCSSGDRLYSGSLDKTIRVWTIKSDGIKCIDVYDIKEAVHELAANDKLACYVSQGTGVK 1312

Query: 903  VIDSSRTLKDIYRSKGIKSMSVVQGKIYIGCMDSSIQELAVSNNVEREIKAPFKSWR--L 960
            V + S   K I  SK +KS++V   K+Y GC   SIQE+ +S          F   R  L
Sbjct: 1313 VFNWSEAPKLINFSKYVKSLAVAGDKLYCGCSGYSIQEVDLSTYTSNSF---FTGTRKLL 1369

Query: 961  QSKPINSLVVYKDWLYSASSSVEGSNIKEWRRHRKPQISIAPEKGTTIQAMAVVEDFIYL 1020
              + I+SL ++ D+L++  SSV+ +  K +   +K  +  +   G  I  +A+  DFI+ 
Sbjct: 1370 GKQTIHSLQIHDDYLFACGSSVDATAGKIFSLSQKMVVG-SLSTGLDIHRIAINSDFIFA 1428

Query: 1021 NYNSSASSLQIWLRGTQQKVGRIS-AG--SKITSLLTAND--IVLCGTETGLIKGW 1071
               +   ++++WL+    +V  I  AG  +KITSL++  D  ++  G+  G I+ W
Sbjct: 1429 --GTKFGTIEVWLKDKFTRVASIKMAGGHTKITSLVSDVDGMMLFVGSSDGKIQVW 1482
Putative E3 ubiquitin-protein ligase involved in the rhizobial infection process. Plays an important role in the early steps of infection thread formation and in growth and differentiation of nodules.
Lotus japonicus (taxid: 34305)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|D1FP57|LIN2_LOTJA Putative E3 ubiquitin-protein ligase LIN-2 OS=Lotus japonicus GN=LIN PE=1 SV=1 Back     alignment and function description
>sp|D1FP53|LIN_MEDTR Putative E3 ubiquitin-protein ligase LIN OS=Medicago truncatula GN=LIN PE=2 SV=1 Back     alignment and function description
>sp|P90648|MHCKB_DICDI Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 Back     alignment and function description
>sp|Q6FT96|MDV1_CANGA Mitochondrial division protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MDV1 PE=3 SV=1 Back     alignment and function description
>sp|Q6DRF9|WDR55_DANRE WD repeat-containing protein 55 OS=Danio rerio GN=wdr55 PE=2 SV=2 Back     alignment and function description
>sp|A7TNS8|CAF4_VANPO CCR4-associated factor 4 homolog OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=CAF4 PE=3 SV=1 Back     alignment and function description
>sp|P87177|YB1C_SCHPO Uncharacterized WD repeat-containing protein C3D6.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3D6.12 PE=1 SV=1 Back     alignment and function description
>sp|P36130|CAF4_YEAST CCR4-associated factor 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAF4 PE=1 SV=3 Back     alignment and function description
>sp|A6ZZZ8|CAF4_YEAS7 CCR4-associated factor 4 OS=Saccharomyces cerevisiae (strain YJM789) GN=CAF4 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1074
359477261 1339 PREDICTED: putative E3 ubiquitin-protein 0.981 0.787 0.618 0.0
147796407 1378 hypothetical protein VITISV_010257 [Viti 0.976 0.761 0.615 0.0
255551783 1357 nucleotide binding protein, putative [Ri 0.993 0.786 0.616 0.0
296083364 1274 unnamed protein product [Vitis vinifera] 0.954 0.804 0.622 0.0
224130530 1305 predicted protein [Populus trichocarpa] 0.951 0.783 0.596 0.0
449432864 1339 PREDICTED: putative E3 ubiquitin-protein 0.976 0.783 0.569 0.0
356558169 1302 PREDICTED: uncharacterized protein LOC10 0.981 0.809 0.550 0.0
449515345 1313 PREDICTED: putative E3 ubiquitin-protein 0.954 0.780 0.565 0.0
356532569 1362 PREDICTED: uncharacterized protein LOC10 0.899 0.709 0.581 0.0
334185156 1264 transducin/WD-40 repeat-containing prote 0.934 0.794 0.524 0.0
>gi|359477261|ref|XP_002269707.2| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1283 bits (3321), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 668/1080 (61%), Positives = 828/1080 (76%), Gaps = 26/1080 (2%)

Query: 3    YAKVHPLDPQEDVTNDTTVGTKACRKIPEIQEYGKDIKNLDEVPRLQLRTAGLRKKSSTK 62
            + KVHPLDPQE + + T    KA R   EIQ+Y K + N D+V R       +++ S+ K
Sbjct: 278  FQKVHPLDPQESIIDSTGDKAKASRDNTEIQDYRKALNNSDQVSR-----QDIKRSSNIK 332

Query: 63   CLYDMLQESESDRSTTVGSCSTEIEEESDSEANMGIVKSLIANEGTSAVDRRPENFDQKL 122
            CL D+L ES+SD  T+  S       + DSEA     +S +      A   R E  DQ+ 
Sbjct: 333  CLQDILMESQSDTPTSDDSFDDNDSADGDSEAYADETQSSMEAARIKADQGRMEISDQRF 392

Query: 123  QAYCSSSGSESAKISFLRAPKRPMYKESNGTNSNRNFSRRFLSSSGHFNLSILELRDKIS 182
            Q  C  S S             P+++E N  N  + FS RF  S    NLSILEL  + S
Sbjct: 393  QNSCCISTSFP-----------PLHEEINEANIKKLFSGRFSRSLNDLNLSILELGVEKS 441

Query: 183  NG--SCHVEGKISKQHKVQPSDC----VLSSSPQQSCRFTEMDY-RGSSERKK-NSSGRK 234
            +   SCH + + + + +++P D      L+++  Q+  F +M++ +G+  RKK NSS RK
Sbjct: 442  HTLWSCHAQEETTWR-RLEPDDFQILDCLAATSLQNYMFAQMEHNQGNGARKKHNSSRRK 500

Query: 235  KFNEECLNGEKDAKSELLEIIEKAISSLFFSGDLRKCNKDYVVEVTTLYKMLNSKTGVKY 294
              +E CL+ EKD+  ELL  ++KAIS L+FS    K ++D  VEVTT+Y+ML +KTGVKY
Sbjct: 501  NLHEVCLHPEKDSHGELLRALDKAISKLWFSEGQGKYDEDSSVEVTTIYEMLTNKTGVKY 560

Query: 295  DMLQDVILEQLLTAISASKEETVIRASVSILTTIILANESVIEDIKKKGLRLSDLATALK 354
             +L+D IL+QLL++IS SK+E ++RASVSIL TII  N+SVI+DIKKKGL+L  LA ALK
Sbjct: 561  TLLKDAILDQLLSSISTSKKEGIVRASVSILLTIIAGNKSVIDDIKKKGLQLGHLANALK 620

Query: 355  RNVPEAAILIYLIKPSPTEIKTLELLPTLVEVICTSKLYKGKLESVRLTPPAASLMIIEV 414
            RNV EAA LIYLI PSPTEIKTLELLPTL+ V+CTS  Y G   S+  TPPAASLMIIE 
Sbjct: 621  RNVYEAATLIYLINPSPTEIKTLELLPTLMNVVCTSNNYAGGPASLP-TPPAASLMIIEA 679

Query: 415  LVTAFDYATNNMHLAAINSPRVLCGLLDVARHQNLEELISLATILVKCIQFDGQCRKYLS 474
            L+ AFDYATN+MHLA I+SP+VL GLLDVAR+ NLEELI LATILVKC+QFDGQCR Y+S
Sbjct: 680  LIAAFDYATNSMHLAEISSPQVLSGLLDVARNNNLEELIPLATILVKCMQFDGQCRNYIS 739

Query: 475  EFTAVAPLACLLQSGEKRAIMIALEFFHEILRIPRSSAIDLLQRIHKEGNINILHILKLS 534
            +FT +AP   LL+S ++R  +IALEFFHEILR+PRSSAI +LQ++ KEG+INI+HIL   
Sbjct: 740  QFTPMAPFIYLLRSNKRRVKLIALEFFHEILRMPRSSAISVLQQMKKEGSINIMHILLPC 799

Query: 535  LQQLQSDYQLLAANLLLQLDTLENTTGKSVFTEEAMQVILKAVASEESSTMQLLSSFILS 594
            LQQ Q+++QLLAANLLLQLD LE+++G+S+F EEAM+V+L+++  EE+S  Q+LS+FILS
Sbjct: 800  LQQSQAEHQLLAANLLLQLDQLEDSSGRSMFREEAMEVLLESMVCEENSATQILSAFILS 859

Query: 595  NIGGTFSWTGEPYTVAWLVKKAGLNSSWLQNMIRNFDWLDQSLQDRGVDSWSSKIAKSII 654
            N+GGT+SWTGEPYTVAWLVKKAGL S + +NMIRNFDWLDQSLQD G D+W SKI +SII
Sbjct: 860  NLGGTYSWTGEPYTVAWLVKKAGLTSLYHRNMIRNFDWLDQSLQDTGTDTWCSKIGRSII 919

Query: 655  EIGKPIYYALEKGLKSKTKSVCRDSLTTIAWLSFEVSKSPNSVRHSACQILLDGVEQFLH 714
            + G P+++ALEKGLKSK + V RD LT IAWL +E++ +PN +R+SAC+ILL G+EQFLH
Sbjct: 920  KGGIPLFHALEKGLKSKVRRVSRDCLTAIAWLGYEIATTPNELRYSACEILLSGIEQFLH 979

Query: 715  PGLELEERLLACLCIYNYASGKGMQKLIRSSEGVRESLRRLSNVTWMAEELHKAADYYLP 774
            PGL+LEERLLACLCIYNY SGKGMQKLI  SEGVRESL RLSN+TWMAEEL K ADY+LP
Sbjct: 980  PGLDLEERLLACLCIYNYTSGKGMQKLIHFSEGVRESLGRLSNITWMAEELLKIADYFLP 1039

Query: 775  NISRISCVHTQILEASHKCSGAVTALIYYKGLLCSGFSDGSIKMWDIKKQSAMLVWDVKE 834
              S ISCVHTQILE   KCSGAVTALIYY+G LCSG+SDGSIK+WDIK QSA LV D+KE
Sbjct: 1040 YKSHISCVHTQILEMGRKCSGAVTALIYYRGQLCSGYSDGSIKVWDIKGQSATLVLDIKE 1099

Query: 835  HRKAVTSFSLFEPGESLLSGSADKTIGVWQMVQRKLELIEVIATKEPIRKLDTYGKTIFA 894
            HRKAVT FS FEPG+SLLSGSADKTI VWQMV+RK+E  EVI+TKEP++ LDT+G+ IF 
Sbjct: 1100 HRKAVTCFSHFEPGDSLLSGSADKTIRVWQMVKRKMECTEVISTKEPVQNLDTHGQLIFT 1159

Query: 895  STQGHRMKVIDSSRTLKDIYRSKGIKSMSVVQGKIYIGCMDSSIQELAVSNNVEREIKAP 954
             T GH +KV D+SR +KDI +SK +K + VVQG++YIGCMDSSIQE+ ++   E+EI+AP
Sbjct: 1160 VTHGHGVKVFDASRKVKDICKSKHVKCVRVVQGRLYIGCMDSSIQEVVITRAREQEIRAP 1219

Query: 955  FKSWRLQSKPINSLVVYKDWLYSASSSVEGSNIKEWRRHRKPQISIAPEKGTTIQAMAVV 1014
             KSWR+Q++PINS+VVYKDWLYSAS  VEGSN KEW+RH KPQ+S+ P+KG ++ AM +V
Sbjct: 1220 AKSWRMQNRPINSIVVYKDWLYSASDIVEGSNFKEWKRHSKPQMSMVPDKGASVLAMGIV 1279

Query: 1015 EDFIYLNYNSSASSLQIWLRGTQQKVGRISAGSKITSLLTANDIVLCGTETGLIKGWIPL 1074
            EDFIYLN +SS S LQIWLRGTQQK GR+SAGS+ITSLLTANDIVLCGTE GLIKGWIPL
Sbjct: 1280 EDFIYLNCSSSTSILQIWLRGTQQKAGRLSAGSRITSLLTANDIVLCGTEMGLIKGWIPL 1339

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147796407|emb|CAN65866.1| hypothetical protein VITISV_010257 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255551783|ref|XP_002516937.1| nucleotide binding protein, putative [Ricinus communis] gi|223544025|gb|EEF45551.1| nucleotide binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|296083364|emb|CBI23000.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224130530|ref|XP_002328632.1| predicted protein [Populus trichocarpa] gi|222838614|gb|EEE76979.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449432864|ref|XP_004134218.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356558169|ref|XP_003547380.1| PREDICTED: uncharacterized protein LOC100782870 [Glycine max] Back     alignment and taxonomy information
>gi|449515345|ref|XP_004164710.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|356532569|ref|XP_003534844.1| PREDICTED: uncharacterized protein LOC100789287 [Glycine max] Back     alignment and taxonomy information
>gi|334185156|ref|NP_001189833.1| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana] gi|332640951|gb|AEE74472.1| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1074
DICTYBASE|DDB_G0289115732 mhkB "myosin heavy chain kinas 0.250 0.367 0.268 1.7e-08
TAIR|locus:2148965 876 TOZ "AT5G16750" [Arabidopsis t 0.251 0.308 0.243 2.5e-06
ZFIN|ZDB-GENE-030131-8414368 pak1ip1 "PAK1 interacting prot 0.175 0.513 0.243 4.6e-05
TAIR|locus:2089855 955 AT3G21540 "AT3G21540" [Arabido 0.074 0.083 0.367 7.2e-05
TAIR|locus:2032452415 AT1G24130 "AT1G24130" [Arabido 0.263 0.681 0.231 0.00012
UNIPROTKB|Q9NWT1392 PAK1IP1 "p21-activated protein 0.177 0.487 0.243 0.00014
SGD|S000001744643 CAF4 "WD40 repeat-containing p 0.098 0.164 0.276 0.00015
RGD|1565353382 Pak1ip1 "PAK1 interacting prot 0.075 0.212 0.380 0.00018
UNIPROTKB|F1NWB8367 PAK1IP1 "p21-activated protein 0.133 0.389 0.265 0.00045
UNIPROTKB|Q5ZKU8369 PAK1IP1 "p21-activated protein 0.133 0.387 0.265 0.00045
DICTYBASE|DDB_G0289115 mhkB "myosin heavy chain kinase B" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
 Score = 177 (67.4 bits), Expect = 1.7e-08, Sum P(2) = 1.7e-08
 Identities = 81/302 (26%), Positives = 139/302 (46%)

Query:   740 KLIRSSEG--VRESLRRLSNV--TWMAEELHKAADYYLPNISRISCVHTQILEASHKCSG 795
             KLI + +G  V   L    N+  T  ++   +  DY   N+    CV T  L+  H+  G
Sbjct:   452 KLIETIKGYHVTSHLCICDNLLFTGCSDNSIRVYDYKSQNME---CVQT--LKG-HE--G 503

Query:   796 AVTALIYYKGLLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFSLFEPGESLLSGS 855
              V ++ Y    L SG SD SIK+WD+KK     ++ ++ H K V +  L +  + L SGS
Sbjct:   504 PVESICYNDQYLFSGSSDHSIKVWDLKKLRC--IFTLEGHDKPVHTVLLND--KYLFSGS 559

Query:   856 ADKTIGVWQMVQRKLELIEVIATK-EPIRKLDTYGKTIFASTQGHRMKVIDSSRTLKDIY 914
             +DKTI VW +  + LE    + +    ++ L   G+ +F+ +    +KV D  +T +  Y
Sbjct:   560 SDKTIKVWDL--KTLECKYTLESHARAVKTLCISGQYLFSGSNDKTIKVWDL-KTFRCNY 616

Query:   915 RSKG----IKSMSVVQGKIYIGCMDSSIQELAVSNNVEREIKAPFKSWRLQSKPINSLVV 970
               KG    + ++ ++   +Y G  D +I+   V N    E  A  +      + +  +V+
Sbjct:   617 TLKGHTKWVTTICILGTNLYSGSYDKTIR---VWNLKSLECSATLRG---HDRWVEHMVI 670

Query:   971 YKDWLYSASSSVEGSNIKEWRRHRKPQISIAPEKGTTIQAMAVVEDFIYLNYNSSASSLQ 1030
                 L++AS   + + IK W        +       T+Q +AV ED   +   S   S++
Sbjct:   671 CDKLLFTAS---DDNTIKIWDLETLRCNTTLEGHNATVQCLAVWEDKKCVISCSHDQSIR 727

Query:  1031 IW 1032
             +W
Sbjct:   728 VW 729
GO:0018107 "peptidyl-threonine phosphorylation" evidence=IDA
GO:0031037 "myosin II filament disassembly" evidence=IMP
GO:0005826 "actomyosin contractile ring" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0000910 "cytokinesis" evidence=IMP
GO:0046777 "protein autophosphorylation" evidence=IDA
GO:0045159 "myosin II binding" evidence=IPI
GO:0005524 "ATP binding" evidence=IEA;IC
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;IDA
GO:0016905 "myosin heavy chain kinase activity" evidence=IEA;IDA
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016740 "transferase activity" evidence=IEA
GO:0016310 "phosphorylation" evidence=IEA
GO:0016301 "kinase activity" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
TAIR|locus:2148965 TOZ "AT5G16750" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-8414 pak1ip1 "PAK1 interacting protein 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2089855 AT3G21540 "AT3G21540" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032452 AT1G24130 "AT1G24130" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NWT1 PAK1IP1 "p21-activated protein kinase-interacting protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
SGD|S000001744 CAF4 "WD40 repeat-containing protein associated with the CCR4-NOT complex" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
RGD|1565353 Pak1ip1 "PAK1 interacting protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NWB8 PAK1IP1 "p21-activated protein kinase-interacting protein 1-like" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZKU8 PAK1IP1 "p21-activated protein kinase-interacting protein 1-like" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pg.C_scaffold_77000121
hypothetical protein (1305 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1074
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 5e-09
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 4e-07
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 3e-06
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-04
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 3e-04
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information 
 Score = 58.5 bits (142), Expect = 5e-09
 Identities = 52/234 (22%), Positives = 86/234 (36%), Gaps = 41/234 (17%)

Query: 806  LLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQM 865
             L SG SD +I++WD++      V  +  H   V+S +    G  L S S DKTI VW +
Sbjct: 65   YLASGSSDKTIRLWDLETGE--CVRTLTGHTSYVSSVAFSPDGRILSSSSRDKTIKVWDV 122

Query: 866  VQRKLELIEVIATKEPIR--KLDTYGKTIFASTQGHRMKVIDSSRTLKDIYRSKG----I 919
               K  L  +    + +        G  + +S+Q   +K+ D  RT K +    G    +
Sbjct: 123  ETGKC-LTTLRGHTDWVNSVAFSPDGTFVASSSQDGTIKLWD-LRTGKCVATLTGHTGEV 180

Query: 920  KSMSVV--QGKIYIGCMDSSIQELAVSNNVEREIKAPFKSWRLQS-----------KPIN 966
             S++      K+     D +I                 K W L +             +N
Sbjct: 181  NSVAFSPDGEKLLSSSSDGTI-----------------KLWDLSTGKCLGTLRGHENGVN 223

Query: 967  SLVVYKDWLYSASSSVEGSNIKEWRRHRKPQISIAPEKGTTIQAMAVVEDFIYL 1020
            S+    D    AS S +G+ I+ W       +        ++ ++A   D   L
Sbjct: 224  SVAFSPDGYLLASGSEDGT-IRVWDLRTGECVQTLSGHTNSVTSLAWSPDGKRL 276

Length = 289
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1074
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0293519 consensus WD40 repeat-containing protein [Function 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.97
KOG0286343 consensus G-protein beta subunit [General function 99.96
KOG0315311 consensus G-protein beta subunit-like protein (con 99.96
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.96
KOG0295406 consensus WD40 repeat-containing protein [Function 99.96
KOG0315311 consensus G-protein beta subunit-like protein (con 99.96
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.96
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.96
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.96
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.96
KOG0263707 consensus Transcription initiation factor TFIID, s 99.96
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.95
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 99.95
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.95
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.95
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.95
KOG0286343 consensus G-protein beta subunit [General function 99.95
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.95
PLN00181793 protein SPA1-RELATED; Provisional 99.95
KOG0266456 consensus WD40 repeat-containing protein [General 99.95
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 99.94
KOG0645312 consensus WD40 repeat protein [General function pr 99.94
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 99.94
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 99.94
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.94
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.93
KOG0263707 consensus Transcription initiation factor TFIID, s 99.93
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.93
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.93
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.93
KOG0296399 consensus Angio-associated migratory cell protein 99.93
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.93
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.93
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 99.93
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.92
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.92
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.92
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 99.92
KOG0295406 consensus WD40 repeat-containing protein [Function 99.91
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.91
KOG0284 464 consensus Polyadenylation factor I complex, subuni 99.91
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.9
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.9
KOG0643327 consensus Translation initiation factor 3, subunit 99.9
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.9
PLN00181793 protein SPA1-RELATED; Provisional 99.89
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.89
KOG0266456 consensus WD40 repeat-containing protein [General 99.89
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.89
KOG0645312 consensus WD40 repeat protein [General function pr 99.89
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.88
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 99.88
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 99.88
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.88
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.88
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.88
KOG0293519 consensus WD40 repeat-containing protein [Function 99.88
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.87
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.87
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.87
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.87
KOG0283712 consensus WD40 repeat-containing protein [Function 99.87
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.86
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.86
KOG0296399 consensus Angio-associated migratory cell protein 99.86
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.85
KOG0294362 consensus WD40 repeat-containing protein [Function 99.85
KOG0772 641 consensus Uncharacterized conserved protein, conta 99.85
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.85
PTZ00420 568 coronin; Provisional 99.85
KOG0310 487 consensus Conserved WD40 repeat-containing protein 99.85
KOG0283 712 consensus WD40 repeat-containing protein [Function 99.85
KOG0289506 consensus mRNA splicing factor [General function p 99.85
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 99.85
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.84
PTZ00421 493 coronin; Provisional 99.84
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.84
KOG0308 735 consensus Conserved WD40 repeat-containing protein 99.84
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.84
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.83
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.83
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.83
KOG0641350 consensus WD40 repeat protein [General function pr 99.81
KOG0310 487 consensus Conserved WD40 repeat-containing protein 99.81
PTZ00421 493 coronin; Provisional 99.81
KOG0300481 consensus WD40 repeat-containing protein [Function 99.81
KOG0308 735 consensus Conserved WD40 repeat-containing protein 99.81
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.81
PTZ00420 568 coronin; Provisional 99.81
KOG1539 910 consensus WD repeat protein [General function pred 99.81
KOG0639705 consensus Transducin-like enhancer of split protei 99.8
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.8
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.8
KOG0294362 consensus WD40 repeat-containing protein [Function 99.79
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.79
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.79
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.78
KOG2055514 consensus WD40 repeat protein [General function pr 99.78
KOG0643327 consensus Translation initiation factor 3, subunit 99.78
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.78
KOG0289506 consensus mRNA splicing factor [General function p 99.78
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.77
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.76
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.76
KOG2048 691 consensus WD40 repeat protein [General function pr 99.76
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.75
KOG0646 476 consensus WD40 repeat protein [General function pr 99.75
KOG2096420 consensus WD40 repeat protein [General function pr 99.75
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.75
KOG0300481 consensus WD40 repeat-containing protein [Function 99.75
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.75
KOG1274 933 consensus WD40 repeat protein [General function pr 99.74
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.74
KOG4283397 consensus Transcription-coupled repair protein CSA 99.74
KOG1273405 consensus WD40 repeat protein [General function pr 99.73
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.73
KOG4328498 consensus WD40 protein [Function unknown] 99.73
KOG0321 720 consensus WD40 repeat-containing protein L2DTL [Fu 99.73
KOG0772 641 consensus Uncharacterized conserved protein, conta 99.73
KOG1063 764 consensus RNA polymerase II elongator complex, sub 99.73
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.73
KOG1274 933 consensus WD40 repeat protein [General function pr 99.73
KOG0268 433 consensus Sof1-like rRNA processing protein (conta 99.72
KOG0641350 consensus WD40 repeat protein [General function pr 99.72
KOG0646 476 consensus WD40 repeat protein [General function pr 99.72
KOG2106 626 consensus Uncharacterized conserved protein, conta 99.7
KOG0302440 consensus Ribosome Assembly protein [General funct 99.7
KOG0267 825 consensus Microtubule severing protein katanin p80 99.69
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.69
KOG2096 420 consensus WD40 repeat protein [General function pr 99.68
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 99.68
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.67
KOG0321 720 consensus WD40 repeat-containing protein L2DTL [Fu 99.66
KOG2106 626 consensus Uncharacterized conserved protein, conta 99.65
KOG0270463 consensus WD40 repeat-containing protein [Function 99.65
KOG1539 910 consensus WD repeat protein [General function pred 99.65
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.64
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.64
KOG4283397 consensus Transcription-coupled repair protein CSA 99.63
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 99.63
KOG1063 764 consensus RNA polymerase II elongator complex, sub 99.62
COG2319466 FOG: WD40 repeat [General function prediction only 99.62
KOG0267 825 consensus Microtubule severing protein katanin p80 99.62
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.62
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 99.61
KOG2048 691 consensus WD40 repeat protein [General function pr 99.61
COG2319 466 FOG: WD40 repeat [General function prediction only 99.61
KOG0302440 consensus Ribosome Assembly protein [General funct 99.6
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.6
KOG0270463 consensus WD40 repeat-containing protein [Function 99.6
KOG0639705 consensus Transducin-like enhancer of split protei 99.59
KOG1188376 consensus WD40 repeat protein [General function pr 99.59
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.57
PRK11028330 6-phosphogluconolactonase; Provisional 99.56
KOG4227 609 consensus WD40 repeat protein [General function pr 99.55
KOG1445 1012 consensus Tumor-specific antigen (contains WD repe 99.54
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.54
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.54
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.53
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.53
KOG1334559 consensus WD40 repeat protein [General function pr 99.53
KOG2055514 consensus WD40 repeat protein [General function pr 99.53
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.53
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.52
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.52
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.52
KOG4328498 consensus WD40 protein [Function unknown] 99.52
KOG0649325 consensus WD40 repeat protein [General function pr 99.52
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.49
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.48
KOG2110 391 consensus Uncharacterized conserved protein, conta 99.46
KOG1963 792 consensus WD40 repeat protein [General function pr 99.45
KOG0303472 consensus Actin-binding protein Coronin, contains 99.44
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.44
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.43
KOG1188376 consensus WD40 repeat protein [General function pr 99.41
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.41
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.39
KOG1273405 consensus WD40 repeat protein [General function pr 99.39
PRK11028330 6-phosphogluconolactonase; Provisional 99.39
KOG0649325 consensus WD40 repeat protein [General function pr 99.38
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.37
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.37
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.37
KOG0303 472 consensus Actin-binding protein Coronin, contains 99.37
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.35
PRK01742429 tolB translocation protein TolB; Provisional 99.34
KOG2394 636 consensus WD40 protein DMR-N9 [General function pr 99.32
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.32
KOG0771398 consensus Prolactin regulatory element-binding pro 99.28
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.26
KOG1272 545 consensus WD40-repeat-containing subunit of the 18 99.25
KOG1963 792 consensus WD40 repeat protein [General function pr 99.24
KOG2110 391 consensus Uncharacterized conserved protein, conta 99.24
KOG2111346 consensus Uncharacterized conserved protein, conta 99.24
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.22
KOG1310 758 consensus WD40 repeat protein [General function pr 99.22
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.2
KOG1524 737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.2
KOG4227 609 consensus WD40 repeat protein [General function pr 99.2
KOG2111346 consensus Uncharacterized conserved protein, conta 99.2
PRK03629429 tolB translocation protein TolB; Provisional 99.19
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.18
KOG1524 737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.17
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.15
KOG1334 559 consensus WD40 repeat protein [General function pr 99.14
PRK01742429 tolB translocation protein TolB; Provisional 99.11
KOG2321 703 consensus WD40 repeat protein [General function pr 99.09
PRK04922433 tolB translocation protein TolB; Provisional 99.08
PRK05137435 tolB translocation protein TolB; Provisional 99.08
PRK02889427 tolB translocation protein TolB; Provisional 99.06
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.05
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.04
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.04
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 99.03
KOG0771398 consensus Prolactin regulatory element-binding pro 98.99
KOG0322323 consensus G-protein beta subunit-like protein GNB1 98.97
KOG2321 703 consensus WD40 repeat protein [General function pr 98.93
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 98.92
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.92
KOG3881412 consensus Uncharacterized conserved protein [Funct 98.92
KOG4547 541 consensus WD40 repeat-containing protein [General 98.91
KOG2041 1189 consensus WD40 repeat protein [General function pr 98.91
KOG1310 758 consensus WD40 repeat protein [General function pr 98.9
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.89
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.89
PRK04922433 tolB translocation protein TolB; Provisional 98.88
KOG2139445 consensus WD40 repeat protein [General function pr 98.87
KOG2139 445 consensus WD40 repeat protein [General function pr 98.85
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.84
PRK03629429 tolB translocation protein TolB; Provisional 98.83
PRK00178430 tolB translocation protein TolB; Provisional 98.81
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 98.81
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.78
KOG2394 636 consensus WD40 protein DMR-N9 [General function pr 98.76
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.76
KOG4547 541 consensus WD40 repeat-containing protein [General 98.76
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.76
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.74
KOG2315 566 consensus Predicted translation initiation factor 98.74
KOG1409404 consensus Uncharacterized conserved protein, conta 98.73
PRK04792448 tolB translocation protein TolB; Provisional 98.73
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.72
KOG4497447 consensus Uncharacterized conserved protein WDR8, 98.7
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.7
PRK05137435 tolB translocation protein TolB; Provisional 98.69
PRK02889427 tolB translocation protein TolB; Provisional 98.69
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.66
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.65
KOG1272 545 consensus WD40-repeat-containing subunit of the 18 98.65
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.62
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 98.61
PRK01029428 tolB translocation protein TolB; Provisional 98.6
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.6
KOG0280339 consensus Uncharacterized conserved protein [Amino 98.58
KOG1409 404 consensus Uncharacterized conserved protein, conta 98.55
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.53
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.49
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.43
PRK00178430 tolB translocation protein TolB; Provisional 98.42
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.41
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.4
KOG2315 566 consensus Predicted translation initiation factor 98.39
PRK04792448 tolB translocation protein TolB; Provisional 98.37
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.37
KOG0882 558 consensus Cyclophilin-related peptidyl-prolyl cis- 98.35
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.34
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 98.33
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.31
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.25
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.23
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.22
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.2
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.18
KOG2041 1189 consensus WD40 repeat protein [General function pr 98.18
COG4946 668 Uncharacterized protein related to the periplasmic 98.17
KOG3914 390 consensus WD repeat protein WDR4 [Function unknown 98.16
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 98.16
KOG2314 698 consensus Translation initiation factor 3, subunit 98.14
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 98.09
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.09
KOG2695425 consensus WD40 repeat protein [General function pr 98.08
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.08
PRK04043419 tolB translocation protein TolB; Provisional 98.07
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 98.03
KOG3914 390 consensus WD repeat protein WDR4 [Function unknown 98.02
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 98.01
PRK01029428 tolB translocation protein TolB; Provisional 97.97
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 97.96
KOG0280339 consensus Uncharacterized conserved protein [Amino 97.96
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.94
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 97.9
COG4946668 Uncharacterized protein related to the periplasmic 97.88
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 97.85
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 97.84
KOG1832 1516 consensus HIV-1 Vpr-binding protein [Cell cycle co 97.78
KOG4532344 consensus WD40-like repeat containing protein [Gen 97.75
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.73
KOG1912 1062 consensus WD40 repeat protein [General function pr 97.72
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 97.7
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.69
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.66
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.65
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 97.64
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 97.62
KOG2695425 consensus WD40 repeat protein [General function pr 97.56
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 97.56
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 97.55
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 97.54
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 97.49
KOG4714319 consensus Nucleoporin [Nuclear structure] 97.47
KOG1912 1062 consensus WD40 repeat protein [General function pr 97.43
KOG3621 726 consensus WD40 repeat-containing protein [General 97.42
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 97.41
PRK04043419 tolB translocation protein TolB; Provisional 97.4
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 97.39
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 97.35
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 97.35
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 97.2
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.17
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 97.16
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 97.13
KOG0882 558 consensus Cyclophilin-related peptidyl-prolyl cis- 97.07
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 97.06
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 97.04
KOG2314 698 consensus Translation initiation factor 3, subunit 97.03
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.0
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 96.98
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 96.97
KOG1832 1516 consensus HIV-1 Vpr-binding protein [Cell cycle co 96.97
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 96.89
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 96.89
PF04841 410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 96.87
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 96.84
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 96.76
PRK02888 635 nitrous-oxide reductase; Validated 96.58
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.57
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 96.47
KOG1008 783 consensus Uncharacterized conserved protein, conta 96.3
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.28
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.27
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 96.19
PHA02713557 hypothetical protein; Provisional 96.17
COG3386307 Gluconolactonase [Carbohydrate transport and metab 96.11
PRK02888 635 nitrous-oxide reductase; Validated 96.08
PHA02713557 hypothetical protein; Provisional 96.0
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 95.98
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 95.88
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 95.88
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 95.85
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 95.82
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 95.73
KOG4640 665 consensus Anaphase-promoting complex (APC), subuni 95.59
COG3490366 Uncharacterized protein conserved in bacteria [Fun 95.49
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 95.49
PRK13616591 lipoprotein LpqB; Provisional 95.36
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 95.33
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 95.31
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 95.27
KOG3621 726 consensus WD40 repeat-containing protein [General 95.24
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 95.14
COG3391381 Uncharacterized conserved protein [Function unknow 94.95
KOG2395644 consensus Protein involved in vacuole import and d 94.87
KOG4640 665 consensus Anaphase-promoting complex (APC), subuni 94.8
KOG2444238 consensus WD40 repeat protein [General function pr 94.74
COG0823425 TolB Periplasmic component of the Tol biopolymer t 94.73
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 94.66
PF05804708 KAP: Kinesin-associated protein (KAP) 94.43
PF08553 794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 94.09
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 94.07
COG3490366 Uncharacterized protein conserved in bacteria [Fun 94.01
PHA03098534 kelch-like protein; Provisional 94.0
COG0823425 TolB Periplasmic component of the Tol biopolymer t 93.97
KOG1008 783 consensus Uncharacterized conserved protein, conta 93.85
COG5276370 Uncharacterized conserved protein [Function unknow 93.64
KOG2444238 consensus WD40 repeat protein [General function pr 93.45
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 93.39
KOG2395644 consensus Protein involved in vacuole import and d 93.31
PHA03098534 kelch-like protein; Provisional 93.27
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 92.94
COG3391381 Uncharacterized conserved protein [Function unknow 92.94
KOG1897 1096 consensus Damage-specific DNA binding complex, sub 92.92
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 92.86
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 92.86
PF05804708 KAP: Kinesin-associated protein (KAP) 92.26
COG3386307 Gluconolactonase [Carbohydrate transport and metab 91.71
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 91.7
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 91.68
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 91.19
PHA02790480 Kelch-like protein; Provisional 90.75
PF01602526 Adaptin_N: Adaptin N terminal region; InterPro: IP 90.37
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 90.11
COG3292 671 Predicted periplasmic ligand-binding sensor domain 89.96
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 89.63
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 89.56
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 89.54
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 89.15
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 88.6
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 88.6
PHA02790480 Kelch-like protein; Provisional 88.52
KOG2280 829 consensus Vacuolar assembly/sorting protein VPS16 88.39
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 88.37
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 87.23
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 86.79
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 86.76
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 86.7
KOG1897 1096 consensus Damage-specific DNA binding complex, sub 85.51
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 85.36
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 84.14
COG3204316 Uncharacterized protein conserved in bacteria [Fun 83.8
COG3823262 Glutamine cyclotransferase [Posttranslational modi 83.42
PF14727418 PHTB1_N: PTHB1 N-terminus 82.38
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 80.49
PRK09687280 putative lyase; Provisional 80.41
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information 
Probab=100.00  E-value=1.8e-36  Score=329.23  Aligned_cols=273  Identities=16%  Similarity=0.264  Sum_probs=242.4

Q ss_pred             CCCCcEEEEEEe--CCEEEEEECCCcEEEEECCCCCeeEEEEeccCCCCEEEEEEcCCCCEEEEEeCCCeEEEEEccCCc
Q 001459          792 KCSGAVTALIYY--KGLLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQMVQRK  869 (1074)
Q Consensus       792 gH~~~VtsLafS--~~~LaSGs~DGtVrIWDl~t~~~~~i~tl~gH~~~VtsLafSpdg~~LaSGS~DGtIrIWDl~tg~  869 (1074)
                      ||.++|.|++|+  +..++||+.|.++|+||..+..  +.++.++|...|.|++|+|||+.|+||+.||+|++||..+|+
T Consensus       113 GH~e~Vl~~~fsp~g~~l~tGsGD~TvR~WD~~TeT--p~~t~KgH~~WVlcvawsPDgk~iASG~~dg~I~lwdpktg~  190 (480)
T KOG0271|consen  113 GHGEAVLSVQFSPTGSRLVTGSGDTTVRLWDLDTET--PLFTCKGHKNWVLCVAWSPDGKKIASGSKDGSIRLWDPKTGQ  190 (480)
T ss_pred             CCCCcEEEEEecCCCceEEecCCCceEEeeccCCCC--cceeecCCccEEEEEEECCCcchhhccccCCeEEEecCCCCC
Confidence            999999999999  5589999999999999999874  489999999999999999999999999999999999999999


Q ss_pred             eEEEEEeccCCCeEEEc-------cCCCeEEEEecCCeEEEEeCCC--ceeeeec-CCCeEEEEEe-CCEEEEEECCCcE
Q 001459          870 LELIEVIATKEPIRKLD-------TYGKTIFASTQGHRMKVIDSSR--TLKDIYR-SKGIKSMSVV-QGKIYIGCMDSSI  938 (1074)
Q Consensus       870 ~~~~~~~~h~~~V~s~s-------~dg~~L~sgS~DgtI~VWDl~~--~l~~l~~-~~~V~sLa~s-dgkLlaGs~DgsI  938 (1074)
                      ..-..+.+|+..|++++       +..+++++++.||.|+|||+..  +...+.+ ...|+|+.|- +|.+++|+.|++|
T Consensus       191 ~~g~~l~gH~K~It~Lawep~hl~p~~r~las~skDg~vrIWd~~~~~~~~~lsgHT~~VTCvrwGG~gliySgS~DrtI  270 (480)
T KOG0271|consen  191 QIGRALRGHKKWITALAWEPLHLVPPCRRLASSSKDGSVRIWDTKLGTCVRTLSGHTASVTCVRWGGEGLIYSGSQDRTI  270 (480)
T ss_pred             cccccccCcccceeEEeecccccCCCccceecccCCCCEEEEEccCceEEEEeccCccceEEEEEcCCceEEecCCCceE
Confidence            88888899999999864       4567999999999999999884  5555554 4579999998 8899999999999


Q ss_pred             EEEEccCCceeeeccccccccCCCCCeEEEEEcCC-----------ce-------------------------EEEEEec
Q 001459          939 QELAVSNNVEREIKAPFKSWRLQSKPINSLVVYKD-----------WL-------------------------YSASSSV  982 (1074)
Q Consensus       939 ~IwDl~tg~~~~i~~~~~~~~~h~~~I~sL~~spd-----------~i-------------------------~las~S~  982 (1074)
                      ++|+...|...      +.+.+|...|+.++.+.+           +.                         .+++++ 
T Consensus       271 kvw~a~dG~~~------r~lkGHahwvN~lalsTdy~LRtgaf~~t~~~~~~~se~~~~Al~rY~~~~~~~~erlVSgs-  343 (480)
T KOG0271|consen  271 KVWRALDGKLC------RELKGHAHWVNHLALSTDYVLRTGAFDHTGRKPKSFSEEQKKALERYEAVLKDSGERLVSGS-  343 (480)
T ss_pred             EEEEccchhHH------HhhcccchheeeeeccchhhhhccccccccccCCChHHHHHHHHHHHHHhhccCcceeEEec-
Confidence            99999987654      445788888988887722           22                         367666 


Q ss_pred             CCCeEEEEEC-CCCCeEEEccCCCCCeEEEEEecCCCEEEEEECCCcEEEEECCCCeEEEEEeCC-CCeEEEEEcC--CE
Q 001459          983 EGSNIKEWRR-HRKPQISIAPEKGTTIQAMAVVEDFIYLNYNSSASSLQIWLRGTQQKVGRISAG-SKITSLLTAN--DI 1058 (1074)
Q Consensus       983 dDgtI~IWDl-~t~~~i~~l~gH~~~VtsLafSPDG~~LaSGS~DGtIrIWDl~tg~~l~tL~~h-s~VtsLa~dg--~~ 1058 (1074)
                      +|.++.+|+. .+.+++..+.+|..-|+.+.||||++|||++|.|..|++|+.++|+.+.+|.+| ..|..++|+.  +.
T Consensus       344 Dd~tlflW~p~~~kkpi~rmtgHq~lVn~V~fSPd~r~IASaSFDkSVkLW~g~tGk~lasfRGHv~~VYqvawsaDsRL  423 (480)
T KOG0271|consen  344 DDFTLFLWNPFKSKKPITRMTGHQALVNHVSFSPDGRYIASASFDKSVKLWDGRTGKFLASFRGHVAAVYQVAWSADSRL  423 (480)
T ss_pred             CCceEEEecccccccchhhhhchhhheeeEEECCCccEEEEeecccceeeeeCCCcchhhhhhhccceeEEEEeccCccE
Confidence            9999999995 455678889999999999999999999999999999999999999999999999 6799999974  49


Q ss_pred             EEEEECCCcEEEEec
Q 001459         1059 VLCGTETGLIKGWIP 1073 (1074)
Q Consensus      1059 LaSGs~DG~IrIWdi 1073 (1074)
                      |++|+.|.++++|++
T Consensus       424 lVS~SkDsTLKvw~V  438 (480)
T KOG0271|consen  424 LVSGSKDSTLKVWDV  438 (480)
T ss_pred             EEEcCCCceEEEEEe
Confidence            999999999999986

>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>COG3292 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1074
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 4e-05
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure 
Iteration: 1

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 53/104 (50%), Gaps = 7/104 (6%)
Query: 806 LLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQM 865
            L +G  D  I++WDI+ +  +++  ++ H + + S   F  G+ L+SGS D+T+ +W +
Sbjct: 137 FLATGAEDRLIRIWDIENRKIVMI--LQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDL 194
Query: 866 VQRKLEL---IEVIATKEPIRKLDTYGKTIFASTQGHRMKVIDS 906
              +  L   IE   T   +   D  GK I A +    ++V DS
Sbjct: 195 RTGQCSLTLSIEDGVTTVAVSPGD--GKYIAAGSLDRAVRVWDS 236

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1074
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-08
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-05
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-04
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 3e-08
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 4e-08
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 0.001
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 7e-08
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 9e-08
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 9e-08
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 4e-06
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-05
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 0.004
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-07
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 7e-04
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 1e-06
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 0.004
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 0.004
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 2e-06
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 0.001
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 0.003
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 4e-06
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 0.001
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 2e-05
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 6e-05
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 0.003
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 3e-05
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 0.002
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 1e-04
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 1e-04
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 3e-04
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: beta1-subunit of the signal-transducing G protein heterotrimer
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 54.7 bits (130), Expect = 2e-08
 Identities = 21/140 (15%), Positives = 49/140 (35%), Gaps = 9/140 (6%)

Query: 726 CLCIYNYASGKGMQKLIRSSEGVRESLRRLSNVTWMAEELHKAADYYLPNISRISCVHTQ 785
              +++   G   Q        +  ++    N    A      +D     +  +      
Sbjct: 207 SAKLWDVREGMCRQTFTGHESDIN-AICFFPNGNAFA----TGSDDATCRLFDLRADQEL 261

Query: 786 ILEASHKCSGAVTALIYYKG--LLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFS 843
           +  +       +T++ + K   LL +G+ D +  +WD  K        +  H   V+   
Sbjct: 262 MTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKAD--RAGVLAGHDNRVSCLG 319

Query: 844 LFEPGESLLSGSADKTIGVW 863
           + + G ++ +GS D  + +W
Sbjct: 320 VTDDGMAVATGSWDSFLKIW 339
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1074
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.98
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.97
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.97
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.97
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.97
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.97
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.97
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.96
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.96
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.96
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.96
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.95
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.95
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.93
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.93
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.93
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.91
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.89
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.88
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.87
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.86
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.84
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.82
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.8
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.79
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.79
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.78
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.76
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.74
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.74
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.69
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.64
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.64
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.63
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.56
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.49
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.45
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.34
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.29
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.03
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.95
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.9
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.7
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.49
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 98.49
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 98.43
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.41
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.4
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 98.28
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.21
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.17
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.15
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 98.14
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.96
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.88
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.84
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 97.76
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.75
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 97.63
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.55
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 97.08
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 97.02
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.01
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 96.76
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 96.65
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 96.62
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 96.5
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 96.38
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 95.89
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 93.01
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 92.1
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 89.44
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 89.06
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 88.47
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 86.62
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 82.84
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Groucho/tle1, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=2.3e-33  Score=254.12  Aligned_cols=281  Identities=14%  Similarity=0.213  Sum_probs=230.0

Q ss_pred             CCCEEEEEEEEECCCCCCCEEEEEEE--CCEEEEEECCCCEEEEECCCCCEE---EEEEECCCCCCEEEEEECCCCCEEE
Q ss_conf             22113689974047788768999992--989999988992999977999703---7998414788779999947999899
Q 001459          778 RISCVHTQILEASHKCSGAVTALIYY--KGLLCSGFSDGSIKMWDIKKQSAM---LVWDVKEHRKAVTSFSLFEPGESLL  852 (1074)
Q Consensus       778 ~~~~vhtl~le~~~gH~~~VtsIafS--~~~LaSGs~DGtVrIWDi~s~~~~---~i~tl~gH~~~VtsIafSpdg~~La  852 (1074)
                      ....++++      +|.+.|++++|+  +.+|++|+ ||.|+|||+......   ......+|.+.|.+++|+|++++|+
T Consensus        41 ~~~~~~~~------~H~~~V~~v~fs~~g~~latg~-dg~V~iWd~~~~~~~~~~~~~~~~~h~~~I~~v~~s~dg~~l~  113 (337)
T d1gxra_          41 HARQINTL------NHGEVVCAVTISNPTRHVYTGG-KGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLI  113 (337)
T ss_dssp             EEEEEEEE------CCSSCCCEEEECSSSSEEEEEC-BSEEEEEETTSTTCCSCSEEEECSCTTSBEEEEEECTTSSEEE
T ss_pred             CCEEEEEC------CCCCCEEEEEECCCCCEEEEEE-CCEEEEEECCCCCCCCEEEEEEECCCCCCEEEEEECCCCCEEE
T ss_conf             75499987------9999289999989999999997-9988997736776331168764048899689999867998898


Q ss_pred             EEECCCEEEEEECCCCCEEE-EEEECCCCCEEE--ECCCCCEEEEEECCCEEEEEECCCCE--EEEE-CCCCEEEEEEE-
Q ss_conf             99589809999866891688-887336888699--71599959997349819999679851--4310-59984899973-
Q 001459          853 SGSADKTIGVWQMVQRKLEL-IEVIATKEPIRK--LDTYGKTIFASTQGHRMKVIDSSRTL--KDIY-RSKGIKSMSVV-  925 (1074)
Q Consensus       853 SGS~DGtIrIWDi~tg~~~~-~~~~~h~~~V~s--ls~dg~~Lvsgs~DgtI~IWDl~~~~--~~l~-~~~~V~sIafs-  925 (1074)
                      +|+.||+|++||+....... .....|...+..  +++++..+++++.++.+++|++....  .... +...+.+++|+ 
T Consensus       114 s~~~dg~i~iwd~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~s~~~d~~i~~~~~~~~~~~~~~~~~~~~v~~l~~s~  193 (337)
T d1gxra_         114 VGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISN  193 (337)
T ss_dssp             EEESSSEEEEEECCCC--EEEEEEECSSSCEEEEEECTTSSEEEEEETTSCEEEEETTTTEEEEEECCCSSCEEEEEECT
T ss_pred             EEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             86123321111111111111111111111111111111111111111111111111111111111111111111012344


Q ss_pred             CCE-EEEEECCCCEEEEECCCCCEEEECCCCCCCCCCCCCEEEEEECCCCEEEEEEECCCCEEEEEECCCCCEEEECCCC
Q ss_conf             998-9999779929999833782000015653334789883899981895199999549994999979999717870678
Q 001459          926 QGK-IYIGCMDSSIQELAVSNNVEREIKAPFKSWRLQSKPINSLVVYKDWLYSASSSVEGSNIKEWRRHRKPQISIAPEK 1004 (1074)
Q Consensus       926 dgk-LlsGs~DgsI~IwDl~tg~~~~i~~~~r~~~~h~~~I~sL~~spd~i~lvs~S~dDgtIkIWDl~s~~~i~~l~gH 1004 (1074)
                      ++. +++++.|+.+++||+.+++.....       .+...+.++.+++++.++++++ .|+.+++||...+.... ...|
T Consensus       194 ~~~~~~~~~~d~~v~i~d~~~~~~~~~~-------~~~~~i~~l~~~~~~~~l~~~~-~d~~i~i~d~~~~~~~~-~~~~  264 (337)
T d1gxra_         194 DGTKLWTGGLDNTVRSWDLREGRQLQQH-------DFTSQIFSLGYCPTGEWLAVGM-ESSNVEVLHVNKPDKYQ-LHLH  264 (337)
T ss_dssp             TSSEEEEEETTSEEEEEETTTTEEEEEE-------ECSSCEEEEEECTTSSEEEEEE-TTSCEEEEETTSSCEEE-ECCC
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCEEECCC-------CCCCCEEEEEECCCCCCCCEEC-CCCCCCCCCCCCCCCCC-CCCC
T ss_conf             4321122356655321111110000024-------6666157999715303000000-25642111111111000-0124


Q ss_pred             CCCEEEEEEECCCCEEEEEECCCCEEEEECCCCEEEEEEECCCCEEEEEEC--CCEEEEEECCCCEEEEECC
Q ss_conf             987579999259999999979992999988999079998079976999972--9999999799919998229
Q 001459         1005 GTTIQAMAVVEDFIYLNYNSSASSLQIWLRGTQQKVGRISAGSKITSLLTA--NDIVLCGTETGLIKGWIPL 1074 (1074)
Q Consensus      1005 ~~~VtsIafSPDG~~LaSGS~DGtIrIWDl~tg~~I~tL~~h~~Vtsla~d--g~~LaSGs~DG~IrIWdil 1074 (1074)
                      ...|++++|+|+++++++++.||.|++|+..+++.+..+..++.|++++|+  +++|++|+.||+|++|+++
T Consensus       265 ~~~i~~v~~s~~g~~l~s~s~Dg~i~iwd~~~~~~~~~~~~~~~v~~~~~s~d~~~l~t~s~D~~I~vWdl~  336 (337)
T d1gxra_         265 ESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVI  336 (337)
T ss_dssp             SSCEEEEEECTTSSEEEEEETTSEEEEEETTTCCEEEEEECSSCEEEEEECTTSCEEEEEETTSCEEEEEEE
T ss_pred             CCCCCEEEECCCCCEEEEEECCCEEEEEECCCCCEEEECCCCCCEEEEEEECCCCEEEEEECCCEEEEEEEE
T ss_conf             565416999899999999948996999989999799992699987999992799999999089969999778
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure