Citrus Sinensis ID: 001479

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070-

MGLFLKLVRIAPPGIDSCYIHVADPKVLIYLATCSFRDYLLGSGFQRVGHEFVGEDMLEPREADVPVLFLVLVVLPLVAYVLLGKWSEAAKKRERISLLAQLAAEEALRVEAVPSVSVSPLVPTSINEFHVSTSKNEFNVPTLKNEFPASTSKNGFQLCARCFAPATTRCSRCKSVRYCSGKCQIIHWRQVHKQECQQLEKTSSSSPSLAGSVDDSVNESLNLQLSGYNNKQGGMGEAPPDGVIHPSMSRCASSSMDCSTLENSQTSMMERTVDKRVYRKSKKDLLRRDVATMFDSHDEILRSCTSDPISSNNFSSKEAPIRHKSRTGASAVSSEESQRNLNLNSSDGCAYGQGTTGSTTYDSNGYRSRHWNISEPRNSCESSSSSNSAKYGTYTRENELDFTSNGKKFLNESIELNGYCEMKAMNPMGTKNCKSAKSCTKVVGDQSCLEKERKGPIADESKAARVRDTIPAQGSNVVSKMGIMKMMGLRKSTKLRQDSSELWHDQHRKLKMLFPYEEFLKLFQYEVIDLLSPRGLLNCGNSCYANAVLQCLTCTKPLVIYLLRRSHSSACCGKDWCLMCELEQHVMMLRESAGPLSPGRILSHMRSISCQIGDGSQEDAHEFLRLLVASMQSICLERHGGESKVDPRLQETTFIQHTFGGRLWSKVKCLRCSHESERYENIMDLTLEIYGWVESLEDALTQFTSPEDLDGENMYKCARCATYVRARKQLSIHEAPNILTIVLKRFQEGRYGKINKCITFPEMLDMMPFMTGTGDTPPLYMLYSVVVHLDTQNASFSGHYVSYIKDMQGTWFRIDDTQVHPVPMSQVMSEGAYMLFYMRSCPRPRRTLSRKAMQQQVPASARHSMPKSQKHSRQGQSNPSSHFVGPESFSDLRPENNGFTDHTSNGILRWGANKNMSPVMESYAESPSMEFSDVTSSDWSLFTSSDEASFTTESARDSFSTIDYADGSNGDPFCSIYGPESASPRTVCCRTFSSSKPQTRFVSEKGYVLDSYLSTQSLNRAWQGENLRQVIDSSTELSSDSNCGSFVNYGSNQMYTLDRTSGHCNLRSWDS

cccccEEEEEcccccccEEEEEccccEEEEEEcccccHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccHHHHHccccccccccHHHccccccccccccccccccccHHccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccHHHHHHHHHHcccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEEEEEEEEEEEcccccccccccccEEEEccccccccHHHHHHHHccccccccccccccccccccccccEEEEEEcccccEEEEEEcccccccccccccECcccccccccccccccccccccEEEEEEEEEEccccccccccEEEEEEcccccEEEEccccEEEcccccccccccEEEEEEECcccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

*GLFLKLVRIAPPGIDSCYIHVADPKVLIYLATCSFRDYLLGSGFQRVGHEFVGEDMLEPREADVPVLFLVLVVLPLVAYVLLGKWSEAAKKRERISLLAQLAAEEALRVEAVPSVSVSPLVPTSINEFHV**********************NGFQLCARCFAPATTRCSRCKSVRYCSGKCQIIHWRQVHK***********************************************************************************************************************************************************************************************************************************************************************************************************************DQHRKLKMLFPYEEFLKLFQYEVIDLLSPRGLLNCGNSCYANAVLQCLTCTKPLVIYLLRRSHSSACCGKDWCLMCELEQHVMMLRESAGPLSPGRILSHMRSISCQIGDGSQEDAHEFLRLLVASMQSICLERHGGE*KVDPRLQETTFIQHTFGGRLWSKVKCLRCSHESERYENIMDLTLEIYGWVESLEDALTQFTSPEDLDGENMYKCARCATYVRARKQLSIHEAPNILTIVLKRFQEGRYGKINKCITFPEMLDMMPFMTGTGDTPPLYMLYSVVVHLDTQNASFSGHYVSYIKDMQGTWFRIDDTQVHPVPMSQVMSEGAYMLFYMRSC*************************************************************************************************************************************************VCCRTF*******RFVSEKGYVLDSYLSTQSLNRAWQGENLRQV************CGSFVNYGSNQMYTLD*************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Ubiquitin carboxyl-terminal hydrolase 15	Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin. Involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins.	probable	Q9FPS9

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
3.-.-.-	Hydrolases.	probable
3.4.-.-	Acting on peptide bonds (peptide hydrolases).	probable
3.4.19.-	Omega peptidases.	probable
3.4.19.12	Ubiquitinyl hydrolase 1.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2F1Z, chain A
Confidence level:very confident
Coverage over the Query: 481-635,647-845
View the alignment between query and template
View the model in PyMOL

Template: 2Y6E, chain A
Confidence level:very confident
Coverage over the Query: 534-842
View the alignment between query and template
View the model in PyMOL

Template: 2OD1, chain A
Confidence level:probable
Coverage over the Query: 159-202
View the alignment between query and template
View the model in PyMOL