BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 001558
(1053 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2IUJ|A Chain A, Crystal Structure Of Soybean Lipoxygenase-B
Length = 853
Score = 32.7 bits (73), Expect = 1.1, Method: Compositional matrix adjust.
Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 9/61 (14%)
Query: 26 CTDPNNPQSILL---DFISSCQNLRIWSLNTSTRE------YLNNEQLQKGKQIDEWWRQ 76
DP+ P + L D+ + L IW S E Y ++E+LQK ++ WW++
Sbjct: 606 VKDPSAPHGVRLLIEDYPYASDGLEIWDAIKSWVEEYVSFYYKSDEELQKDPELQAWWKE 665
Query: 77 V 77
+
Sbjct: 666 L 666
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.321 0.135 0.401
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 29,262,478
Number of Sequences: 62578
Number of extensions: 1137226
Number of successful extensions: 2579
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 2577
Number of HSP's gapped (non-prelim): 3
length of query: 1053
length of database: 14,973,337
effective HSP length: 109
effective length of query: 944
effective length of database: 8,152,335
effective search space: 7695804240
effective search space used: 7695804240
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 57 (26.6 bits)