Citrus Sinensis ID: 001564


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050--
MSSSRPAQSSSNTGKSRHSARVIAQTTIDAKLHADFETSGTSFDYSNSVRVSSTAGGDQQPRSDRVTTAYLHHIQKGKLIQPFGCLLALDEKTFKVIAYSENAPELLTMVNHAVPSVGDHPVLGIGSDIKTIFTAPSASALQKALGFGEVSLLNPILVHCKTSGKPFYAIVHRVTGSLIIDFEPVKPYEVPMTAAGALQSYKLAAKAITRLQSLPSGSMERLCDTMIQEVFELTGYDRVMAYKFHEDDHGEVVSEITKSGLEPYLGLHYPATDIPQAARFLFMKNKVRMIVDCRARHVKVLQDEKLPFDLTLCGSTLRAPHSCHLQYMENMNSIASLVMAVVVNDEEEEGDNTLPQKRKRLWGLVVCHNTTPRFVPFPLRYACEFLAQVFAIHVNKELELEYQILEKNILRTQTLLCDMLMRDAPLGIVTQSPNIMDLVKCDGAALLYKNKIWRLGVTPNDFQLHDIVSWLSEYHMDSTGLSADSLYDAGYLGALALGDVVCGMAAVRISPKDMIFWFRSQTASEVRWGGAKHEPDEKDDGRKMHPRSSFKAFLEVVKTRSLPWKDYEMDAIHSLQLILRNAFKDVGTLDLDTKSIHSKLCDLKIEGMKELEAVTSEMVRLIETATVPILAVDVDGLVNGWNTKIAELTGLSVDKAIGKHFLTLVEDSSIDTVKRMLYLALQGQEEQNIQFEIKTHGSKINDDPITLIVNACASRDLHDNVVGVCFVAQDITPQKTVMDKFTRIEGDYKAIVQNPNPLIPPIFGSDEFGWCCEWNPAMVKLTGWKREEVIDKLLLAEVFGTNMACCRLKNQEAFVNLGIVLNKAMSGQDPEKVPFGFFARNGKYAECLLCVNKKLDREGAVTGVFCFLQLASHELQQALHVQRLSEQTALKRLKALAYTKRQIRNPLSGIIFSRKMMEGTELGAEQKRLLHTSAQCQRQLHKILDDSDLDSIIDGYLDLEMVEFTLNEVLVASISQVMMKSNAKGIRIVNETAEQIMSETLYGDSIRLQQVLADFLSISINFVPNGGQLMVSSSLTKDQLGQSVHLAYLELR
ccccccccccccccccccccEEEEEccccHHHHHHHHccccccccccccccccccccccccccccHHHHHHcccccccccccccEEEEEEccccEEEEEcccHHHHHcccccccccccccccccccccHHHHcccHHHHHHHHHHccccccccccEEEEEcccccCEEEEEEEEccEEEEEEECccccccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccEEEEEEEccccccEEEEEccccccccccccccccccccHHHHHHHHcccEEEEccccccccccccccccccccccccccccccccHHHHHHHHccccEEEEEEEEEEccccccccccccccccEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHcccEEEEEEccCEEEccccccHHHHHHHHHHHHHHcccccCEECcccccccccccccccccccEEEEEEcccccEEEEEccccccEECcccccccccccccccccccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHcccHHHHHHHHHHHHHHcccHHHHHcccccccccccHHHHHHHHHHHHHcccccccEEEEEEcccccccccccEEEEEccccccccccEEEEEEEEEcccccEEEEcccccccccEEEEECcccccccccccccccccccccHHHHHHHccccHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHcccccccccccccCEEECcccEEEEEEEEcccccccccEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEEEcHHHHHHHHHHHHHHHHcccccEEEEEcccccccccEEccHHHHHHHHHHHHHHHHcccccccEEEEEEECccccccccEEEEEEEEc
*************************TTIDAKLHADFE**************************DRVTTAYLHHIQKGKLIQPFGCLLALDEKTFKVIAYSENAPELLTMVNHAVPSVGDHPVLGIGSDIKTIFTAPSASALQKALGFGEVSLLNPILVHCKTSGKPFYAIVHRVTGSLIIDFEPVKPYEVPMTAAGALQSYKLAAKAITRLQSLPSGSMERLCDTMIQEVFELTGYDRVMAYKFHEDDHGEVVSEITKSGLEPYLGLHYPATDIPQAARFLFMKNKVRMIVDCRARHVKVLQDEKLPFDLTLCGSTLRAPHSCHLQYMENMNSIASLVMAVVVN***************RLWGLVVCHNTTPRFVPFPLRYACEFLAQVFAIHVNKELELEYQILEKNILRTQTLLCDMLMRDAPLGIVTQSPNIMDLVKCDGAALLYKNKIWRLGVTPNDFQLHDIVSWLSEYHMDSTGLSADSLYDAGYLGALALGDVVCGMAAVRISPKDMIFWFRSQTASEVRWGGA****************SSFKAFLEVVKTRSLPWKDYEMDAIHSLQLILRNAFKDVGTLDLDTKSIHSKLCDLKIEGMKELEAVTSEMVRLIETATVPILAVDVDGLVNGWNTKIAELTGLSVDKAIGKHFLTLVEDSSIDTVKRMLYLALQGQEEQNIQFEIKTHGSKINDDPITLIVNACASRDLHDNVVGVCFVAQDITPQKTVMDKFTRIEGDYKAIVQNPNPLIPPIFGSDEFGWCCEWNPAMVKLTGWKREEVIDKLLLAEVFGTNMACCRLKNQEAFVNLGIVLNKAMSGQDPEKVPFGFFARNGKYAECLLCVNKKLDREGAVTGVFCFLQLASHELQQALHVQRLSEQTALKRLKALAYTKRQIRNPLSGIIFSRKMMEGTELGAEQKRLLHTSAQCQRQLHKILDDSDLDSIIDGYLDLEMVEFTLNEVLVASISQVMMKSNAKGIRIVNETAEQIMSETLYGDSIRLQQVLADFLSISINFVPNGGQLMVSSSLTKDQLGQSVHLAYLELR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSSRPAQSSSNTGKSRHSARVIAQTTIDAKLHADFETSGTSFDYSNSVRVSSTAGGDQQPRSDRVTTAYLHHIQKGKLIQPFGCLLALDEKTFKVIAYSENAPELLTMVNHAVPSVGDHPVLGIGSDIKTIFTAPSASALQKALGFGEVSLLNPILVHCKTSGKPFYAIVHRVTGSLIIDFEPVKPYEVPMTAAGALQSYKLAAKAITRLQSLPSGSMERLCDTMIQEVFELTGYDRVMAYKFHEDDHGEVVSEITKSGLEPYLGLHYPATDIPQAARFLFMKNKVRMIVDCRARHVKVLQDEKLPFDLTLCGSTLRAPHSCHLQYMENMNSIASLVMAVVVNDEEEEGDNTLPQKRKRLWGLVVCHNTTPRFVPFPLRYACEFLAQVFAIHVxxxxxxxxxxxxxxxxxxxxxLCDMLMRDAPLGIVTQSPNIMDLVKCDGAALLYKNKIWRLGVTPNDFQLHDIVSWLSEYHMDSTGLSADSLYDAGYLGALALGDVVCGMAAVRISPKDMIFWFRSQTASEVRWGGAKHEPDEKDDGRKMHPRSSFKAFLEVVKTRSLPWKDYEMDAIHSLQLILRNAFKDVGTLDLDTKSIHSKLCDLKIEGMKELEAVTSEMVRLIETATVPILAVDVDGLVNGWNTKIAELTGLSVDKAIGKHFLTLVEDSSIDTVKRMLYLALQGQEEQNIQFEIKTHGSKINDDPITLIVNACASRDLHDNVVGVCFVAQDITPQKTVMDKFTRIEGDYKAIVQNPNPLIPPIFGSDEFGWCCEWNPAMVKLTGWKREEVIDKLLLAEVFGTNMACCRLKNQEAFVNLGIVLNKAMSGQDPEKVPFGFFARNGKYAECLLCVNKKLDREGAVTGVFCFLQLASHELQQALHVQRLSEQTALKRLKALAYTKRQIRNPLSGIIFSRKMMEGTELGAEQKRLLHTSAQCQRQLHKILDDSDLDSIIDGYLDLEMVEFTLNEVLVASISQVMMKSNAKGIRIVNETAEQIMSETLYGDSIRLQQVLADFLSISINFVPNGGQLMVSSSLTKDQLGQSVHLAYLELR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phytochrome A Regulatory photoreceptor which exists in two forms that are reversibly interconvertible by light: the Pr form that absorbs maximally in the red region of the spectrum and the Pfr form that absorbs maximally in the far-red region. Photoconversion of Pr to Pfr induces an array of morphogenetic responses, whereas reconversion of Pfr to Pr cancels the induction of those responses. Pfr controls the expression of a number of nuclear genes including those encoding the small subunit of ribulose-bisphosphate carboxylase, chlorophyll A/B binding protein, protochlorophyllide reductase, rRNA, etc. It also controls the expression of its own gene(s) in a negative feedback fashion. Involved in the flowering time regulation.confidentP14712
Phytochrome A Regulatory photoreceptor which exists in two forms that are reversibly interconvertible by light: the Pr form that absorbs maximally in the red region of the spectrum and the Pfr form that absorbs maximally in the far-red region. Photoconversion of Pr to Pfr induces an array of morphogenic responses, whereas reconversion of Pfr to Pr cancels the induction of those responses. Pfr controls the expression of a number of nuclear genes including those encoding the small subunit of ribulose-bisphosphate carboxylase, chlorophyll A/B binding protein, protochlorophyllide reductase, rRNA, etc. It also controls the expression of its own gene(s) in a negative feedback fashion.probableP30733
Phytochrome A Regulatory photoreceptor which exists in two forms that are reversibly interconvertible by light: the Pr form that absorbs maximally in the red region of the spectrum and the Pfr form that absorbs maximally in the far-red region. Photoconversion of Pr to Pfr induces an array of morphogenic responses, whereas reconversion of Pfr to Pr cancels the induction of those responses. Pfr controls the expression of a number of nuclear genes including those encoding the small subunit of ribulose-bisphosphate carboxylase, chlorophyll A/B binding protein, protochlorophyllide reductase, rRNA, etc. It also controls the expression of its own gene(s) in a negative feedback fashion.probableP55141

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ZQ5, chain A
Confidence level:very confident
Coverage over the Query: 74-107,118-345,360-585
View the alignment between query and template
View the model in PyMOL
Template: 4GW9, chain A
Confidence level:confident
Coverage over the Query: 80-140,155-344,359-736
View the alignment between query and template
View the model in PyMOL
Template: 4EW8, chain A
Confidence level:probable
Coverage over the Query: 896-1045
View the alignment between query and template
View the model in PyMOL
Template: 3A0R, chain A
Confidence level:probable
Coverage over the Query: 774-802,816-932,943-1040
View the alignment between query and template
View the model in PyMOL
Template: 3EWK, chain A
Confidence level:probable
Coverage over the Query: 629-792
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
4eho, chain Aconfident Alignment | Template Structure