Citrus Sinensis ID: 001579

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050
MERARRLASRAFLKRLVNESKQLSRNHRESKSSAAAAATYTPSRYLSSLSCAPFVCSNNSRSDLLQSRNMSHHNVNGYGLGSQTRGISVEALKPSDTFARRHNSATPEDQAKMSELVGLDNLDSLIDATVPKSIRIDSMKFSKFDEGLTESQMIEHMQKLASMNKVYKSFIGMGYYNTHVPPVILRNIMENPAWYTQYTPYQAEIAQGRLESLLNFQTMIADLTGLPMSNASLLDEGTAAAEAMAMCNNIQKGKKKTFIIASNCHPQTIDICITRADGFDIKVVVSDLKDIDYKSGDVCGVLVQYPGTEGEVLDYGDFIKNAHANGVKVVMATDLLALTILKPPGELGADIVVGSAQRFGVPMGYGGPHAAFLATSQEYKRMMPGRIVGVSIDSSGKPALRVAMQTREQHIRRDKATSNICTAQALLANMAAMYAVYHGPEGLKTIAQRVHGLAGTFALGLKKLGTVEVQGLPFFDTVKVKCADAHAIASAAYKIEMNLRVVDSNTVTASFDETTTLEDVDKLFIVFAGGKSVPFTAASLAEEVETAIPSGLTRESPYLTHPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAQVGLTSPGYIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVSTGGIPAPEKSQPLGTIAAAPWGSALILPISYTYIAMMGSKGLTEASKIAILNANYMAKRLEKHYPILFRGVNGTVAHEFIVDLRGLKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLMIEPTESESKEELDRYCDALISIREEIAQIENGKADIHNNVLKGAPHPPSLLMGDTWTKPYSREYAAYPASWLRFAKFWPATGMRVHHTPYVPSTLNFIARICNS
cHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHcccccEEEEccccccHHHHHHHHcccccccEEEEEcccccccccccEEEEEEEcccccCEEccHHHHHHHHHHcccEEEEEHHHHHHHcccccccccccEEEEcccccccccccccccHHHHccccccccccccCEEEEEEccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEcccHHHHHHHHHHccccEEEEcccEEEEEccccccHHHHHHHHHHHHccccccccccccHHHHHccccccccccccccccccHcccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHcccccccEEEEccccccccHHHHHHcccEEEEEEccccccccHHHHHHHHHHHccccEEEEEEcccccccccccHHHHHHHHHHcccEEEEcccccHHHHccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEccccccccccccccHHHHHHHcccccccccccccccccEEccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccc
**************************************************CAPF***************************************PSDTFARRHNSATPEDQAKMSELVGLDNLDSLIDATVPKSIRIDSMKFSKF***LTESQMIEHMQKLASMNKVYKSFIGMGYYNTHVPPVILRNIMENPAWYTQYTPYQAEIAQGRLESLLNFQTMIADLTGLPMSNASLLDEGTAAAEAMAMCNNIQKGKKKTFIIASNCHPQTIDICITRADGFDIKVVVSDLKDIDYKSGDVCGVLVQYPGTEGEVLDYGDFIKNAHANGVKVVMATDLLALTILKPPGELGADIVVGSAQRFGVPMGYGGPHAAFLATSQEYKRMMPGRIVGVSIDSSGKPALRVAMQ********DKATSNICTAQALLANMAAMYAVYHGPEGLKTIAQRVHGLAGTFALGLKKLGTVEVQGLPFFDTVKVKCADAHAIASAAYKIEMNLRVVDSNTVTASFDETTTLEDVDKLFIVFAGGKSVPFTAASLAEEVETAIPSGLTRESPYLTHPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAQVGLTSPGYIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVSTGG*********LGTIAAAPWGSALILPISYTYIAMMGSKGLTEASKIAILNANYMAKRLEKHYPILFRGVNGTVAHEFIVDLRGLKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLMIEPTESESKEELDRYCDALISIREEIAQIENGKADIHNNVLKGAPHPPSLLMGDTWTKPYSREYAAYPASWLRFAKFWPATGMRVHHTPYVPSTLNFIARICN*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MERARRLASRAFLKRLVNESKQLSRNHRESKSSAAAAATYTPSRYLSSLSCAPFVCSNNSRSDLLQSRNMSHHNVNGYGLGSQTRGISVEALKPSDTFARRHNSATPEDQAKMSELVGLDNLDSLIDATVPKSIRIDSMKFSKFDEGLTESQMIEHMQKLASMNKVYKSFIGMGYYNTHVPPVILRNIMENPAWYTQYTPYQAEIAQGRLESLLNFQTMIADLTGLPMSNASLLDEGTAAAEAMAMCNNIQKGKKKTFIIASNCHPQTIDICITRADGFDIKVVVSDLKDIDYKSGDVCGVLVQYPGTEGEVLDYGDFIKNAHANGVKVVMATDLLALTILKPPGELGADIVVGSAQRFGVPMGYGGPHAAFLATSQEYKRMMPGRIVGVSIDSSGKPALRVAMQTREQHIRRDKATSNICTAQALLANMAAMYAVYHGPEGLKTIAQRVHGLAGTFALGLKKLGTVEVQGLPFFDTVKVKCADAHAIASAAYKIEMNLRVVDSNTVTASFDETTTLEDVDKLFIVFAGGKSVPFTAASLAEEVETAIPSGLTRESPYLTHPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAQVGLTSPGYIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVSTGGIPAPEKSQPLGTIAAAPWGSALILPISYTYIAMMGSKGLTEASKIAILNANYMAKRLEKHYPILFRGVNGTVAHEFIVDLRGLKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLMIEPTESESKEELDRYCDALISIREEIAQIENGKADIHNNVLKGAPHPPSLLMGDTWTKPYSREYAAYPASWLRFAKFWPATGMRVHHTPYVPSTLNFIARICNS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glycine dehydrogenase [decarboxylating] 2, mitochondrial The glycine cleavage system catalyzes the degradation of glycine. The P protein binds the alpha-amino group of glycine through its pyridoxal phosphate cofactor; CO(2) is released and the remaining methylamine moiety is then transferred to the lipoamide cofactor of the H protein.confidentQ94B78
Glycine dehydrogenase [decarboxylating] The glycine cleavage system catalyzes the degradation of glycine. The P protein binds the alpha-amino group of glycine through its pyridoxal phosphate cofactor; CO(2) is released and the remaining methylamine moiety is then transferred to the lipoamide cofactor of the H protein.probableQ8DII3
Glycine dehydrogenase [decarboxylating] The glycine cleavage system catalyzes the degradation of glycine. The P protein binds the alpha-amino group of glycine through its pyridoxal phosphate cofactor; CO(2) is released and the remaining methylamine moiety is then transferred to the lipoamide cofactor of the H protein.probableQ055P8

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.4.-.-Acting on the CH-NH(2) group of donors.probable
1.4.4.-With a disulfide as acceptor.probable
1.4.4.2Glycine dehydrogenase (decarboxylating).probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WYU, chain B
Confidence level:confident
Coverage over the Query: 535-972,984-1003
View the alignment between query and template
View the model in PyMOL
Template: 1WYU, chain A
Confidence level:confident
Coverage over the Query: 101-509
View the alignment between query and template
View the model in PyMOL
Template: 3MAD, chain A
Confidence level:probable
Coverage over the Query: 549-974
View the alignment between query and template
View the model in PyMOL