BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 001649
(1038 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4FRY|A Chain A, The Structure Of A Putative Signal-Transduction Protein
With Cbs Domains From Burkholderia Ambifaria Mc40-6
pdb|4FRY|B Chain B, The Structure Of A Putative Signal-Transduction Protein
With Cbs Domains From Burkholderia Ambifaria Mc40-6
Length = 157
Score = 32.0 bits (71), Expect = 1.6, Method: Composition-based stats.
Identities = 18/57 (31%), Positives = 29/57 (50%)
Query: 494 GIVDALEVARKVALEYREPSCSSSDKILGGGIRPPESPDSVNEKLDLADEVPVKELP 550
GIV + ARKV L+ R + ++I+ +R E S +E + L E ++ LP
Sbjct: 57 GIVTERDYARKVVLQERSSKATRVEEIMTAKVRYVEPSQSTDECMALMTEHRMRHLP 113
>pdb|2LLK|A Chain A, Solution Nmr Structure Of The N-Terminal Myb-Like 1 Domain
Of The Human Cyclin-D-Binding Transcription Factor 1
(Hdmp1), Northeast Structural Genomics Consortium (Nesg)
Target Id Hr8011a
Length = 73
Score = 31.6 bits (70), Expect = 2.3, Method: Composition-based stats.
Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 4/46 (8%)
Query: 105 LEKLHIDYELSVSSG-IWITVKSLLGHSSSQVQDRARALFDSWNQG 149
+EKL EL + G W T+ + LG S+S V+DR R + D+ N G
Sbjct: 31 IEKLK---ELRIKHGNDWATIGAALGRSASSVKDRCRLMKDTCNTG 73
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.311 0.130 0.378
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 29,566,552
Number of Sequences: 62578
Number of extensions: 1196813
Number of successful extensions: 1692
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1690
Number of HSP's gapped (non-prelim): 4
length of query: 1038
length of database: 14,973,337
effective HSP length: 109
effective length of query: 929
effective length of database: 8,152,335
effective search space: 7573519215
effective search space used: 7573519215
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 56 (26.2 bits)