BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 001649
         (1038 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4FRY|A Chain A, The Structure Of A Putative Signal-Transduction Protein
           With Cbs Domains From Burkholderia Ambifaria Mc40-6
 pdb|4FRY|B Chain B, The Structure Of A Putative Signal-Transduction Protein
           With Cbs Domains From Burkholderia Ambifaria Mc40-6
          Length = 157

 Score = 32.0 bits (71), Expect = 1.6,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 29/57 (50%)

Query: 494 GIVDALEVARKVALEYREPSCSSSDKILGGGIRPPESPDSVNEKLDLADEVPVKELP 550
           GIV   + ARKV L+ R    +  ++I+   +R  E   S +E + L  E  ++ LP
Sbjct: 57  GIVTERDYARKVVLQERSSKATRVEEIMTAKVRYVEPSQSTDECMALMTEHRMRHLP 113


>pdb|2LLK|A Chain A, Solution Nmr Structure Of The N-Terminal Myb-Like 1 Domain
           Of The Human Cyclin-D-Binding Transcription Factor 1
           (Hdmp1), Northeast Structural Genomics Consortium (Nesg)
           Target Id Hr8011a
          Length = 73

 Score = 31.6 bits (70), Expect = 2.3,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 4/46 (8%)

Query: 105 LEKLHIDYELSVSSG-IWITVKSLLGHSSSQVQDRARALFDSWNQG 149
           +EKL    EL +  G  W T+ + LG S+S V+DR R + D+ N G
Sbjct: 31  IEKLK---ELRIKHGNDWATIGAALGRSASSVKDRCRLMKDTCNTG 73


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.311    0.130    0.378 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 29,566,552
Number of Sequences: 62578
Number of extensions: 1196813
Number of successful extensions: 1692
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1690
Number of HSP's gapped (non-prelim): 4
length of query: 1038
length of database: 14,973,337
effective HSP length: 109
effective length of query: 929
effective length of database: 8,152,335
effective search space: 7573519215
effective search space used: 7573519215
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 56 (26.2 bits)