BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 001712
         (1021 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4ADB|A Chain A, Structural And Functional Study Of Succinyl-ornithine
           Transaminase From E. Coli
 pdb|4ADB|B Chain B, Structural And Functional Study Of Succinyl-ornithine
           Transaminase From E. Coli
 pdb|4ADB|C Chain C, Structural And Functional Study Of Succinyl-ornithine
           Transaminase From E. Coli
 pdb|4ADB|D Chain D, Structural And Functional Study Of Succinyl-ornithine
           Transaminase From E. Coli
 pdb|4ADC|A Chain A, Structural And Functional Study Of Succinyl-ornithine
           Transaminase From E. Coli
 pdb|4ADC|B Chain B, Structural And Functional Study Of Succinyl-ornithine
           Transaminase From E. Coli
 pdb|4ADC|C Chain C, Structural And Functional Study Of Succinyl-ornithine
           Transaminase From E. Coli
 pdb|4ADC|D Chain D, Structural And Functional Study Of Succinyl-ornithine
           Transaminase From E. Coli
 pdb|4ADD|A Chain A, Structural And Functional Study Of Succinyl-ornithine
           Transaminase From E. Coli
 pdb|4ADD|B Chain B, Structural And Functional Study Of Succinyl-ornithine
           Transaminase From E. Coli
 pdb|4ADD|C Chain C, Structural And Functional Study Of Succinyl-ornithine
           Transaminase From E. Coli
 pdb|4ADD|D Chain D, Structural And Functional Study Of Succinyl-ornithine
           Transaminase From E. Coli
 pdb|4ADE|A Chain A, Structural And Functional Study Of Succinyl-ornithine
           Transaminase From E. Coli
 pdb|4ADE|B Chain B, Structural And Functional Study Of Succinyl-ornithine
           Transaminase From E. Coli
          Length = 406

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 27/67 (40%), Gaps = 7/67 (10%)

Query: 456 IGAWITVLKTLPLASQETSAAMEFYHNQLKVRLLNEKDSGVYQRTDWLVDKLGTKVHSYF 515
           +G   T     PLAS      +E  +         E  +GV QR DW V++L T  H Y 
Sbjct: 275 VGTHGTTYGGNPLASAVAGKVLELINTP-------EMLNGVKQRHDWFVERLNTINHRYG 327

Query: 516 WLDEYTG 522
              E  G
Sbjct: 328 LFSEVRG 334


>pdb|2IFY|A Chain A, Structure Of Bacillus Anthracis Cofactor-Independent
           Phosphoglucerate Mutase
          Length = 508

 Score = 29.6 bits (65), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 19/87 (21%), Positives = 41/87 (47%), Gaps = 1/87 (1%)

Query: 610 VKPSISLFQYNKALMDMLHCTPHDSLIRDHAISLAVSIQKQLNASVD-FESSQISVASVE 668
           +KP +S+++   AL++ +    HD +I + A    V     +  ++   E++   +  V 
Sbjct: 368 LKPEMSIYEVTDALVNEIENDKHDVIILNFANCDMVGHSGMMEPTIKAVEATDECLGKVV 427

Query: 669 KQIVETNEQQTVGTFHADQDRELVNEG 695
           + I+  +    +   H + D EL +EG
Sbjct: 428 EAILAKDGVALITADHGNADEELTSEG 454


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.133    0.404 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 31,160,541
Number of Sequences: 62578
Number of extensions: 1315380
Number of successful extensions: 2611
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 2610
Number of HSP's gapped (non-prelim): 4
length of query: 1021
length of database: 14,973,337
effective HSP length: 109
effective length of query: 912
effective length of database: 8,152,335
effective search space: 7434929520
effective search space used: 7434929520
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 56 (26.2 bits)