Citrus Sinensis ID: 001717


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020-
MGTENPGRSSFPARPSASPFASAPPTVTPFSSAGPVVGSEASSFRPAPPASPQTAAPFMSAAAGVGSDSSGFRPSTPQTRFNDPSVSSSPITYVPPTSGPFQRFPTPQFPPVAQAPPVRGPPVGLPPVSHPIGQVPNPPVPLRAQPPPVPMGSPVQRANFAPSGVNVPQPLSDSSFSASRPNSPPDSSYPFARPTPQQPLPGYVTTQPNAVSQGPTMPSSFPSHPRSYVPPPPTSASSFPAHQGGYVPPGVQSQHSGPPVGVIQGLAEDFSSLSFGSIPGSIEPGIDLKSLPRPLDGDVEPSSLAETYPLNCHSRYLRLTTSAIPNSQSLVSRWHLPLGAVVCPLAEPPEGNLFICRTYVNPYVTFTDAGRKWRCNICALLNDVPGDYFAHLDATGRRIDIDQRPELTKGSVEFVAPTEYMVRPPMPPLYFFLIDVSISAIRSGMLEVVAQTIKSCLDELPGFPRTQIGFITFDSTIHFYNMKSSLTQPQMMVISDLDDIFVPLPDDLLVNLSESRSVVDTLLDSLPSMFQDNMNVESAFGPALKAAFMVMSRLGGKLLIFQNSLPSLGVGCLKLRGDDLRVYGTDKEHSLRIPEDPFYKQMAADLTKFQIAVNVYAFSDKYTDIASLGTLAKYTGGQVYYYPSFQSTTHGERLRHELSRDLTRETAWEAVMRIRCGKGVRFTNYHGNFMLRSTDLLALPAVDCDKAYAMQLSLEETLLTTQTVYFQVALLYTASCGERRIRVHTLAAPVVSNLSDMYQQADTGAIVSVFSRLAIEKTLSHKLEDARNAVQLRLVKALKEYRNLYAVQHRLGSRMIYPESLKFLPLYCLAICKSTPIRGGYADVTLDERCAAGYTMMALPVKKLLKLLYPCLIRVDEHLLKPSAQLDEYKNIMKRLPLVAESLDSRGLYIFDDGFRFVLWFGRMLSPDIAMNLLGSEFAAELSKVMLREQDNEMSRKLLGILKKLREQDPSYYQLCQLVRQGEQPREGFLLLANLVEDQIGGSNGYADWIMQIHRQVLQNP
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccHHHHHHcccccEEEECcccccccccccccEEEEccccEEEccccEEEEccccccccccHHHHcccccccccccccccccccccEEEEEcccccccccccccEEEEEEEccHHHHHHcHHHHHHHHHHHHHHccccccccEEEEEEEccEEEEEEcccccccccEEEEcccccccccccccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHcccEEEEEECcccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccEEEEEEEccccccHHHHHHHcccccCEEEECcccccccHHHHHHHHHHHHHHHHHcccEEEEEECcccEEEEEEECccEEcccccCECcccccccEEEEEEEEEccccccccEEEEEEEEEEEccccEEEEEEEEcccccccHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccccCCcccccccHHHHHHHHHcccccccccccccccHHHHHHHHHccccHHHHHHHHcccCECccccccccccccccccccccccccHHHccccccEEEEEcccEEEEEEcccccHHHHHHHcccccHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHccccccccccccHHHHHHHHHHHHHccc
*********************************************************************************************************************************************************************************************************************************************************************************************************DVEPSSLAETYPLNCHSRYLRLTTSAIPNSQSLVSRWHLPLGAVVCPLAEPPEGNLFICRTYVNPYVTFTDAGRKWRCNICALLNDVPGDYFAHLDATGRRIDIDQRPELTKGSVEFVAPTEYMVRPPMPPLYFFLIDVSISAIRSGMLEVVAQTIKSCLDELPGFPRTQIGFITFDSTIHFYNMKSSLTQPQMMVISDLDDIFVPLPDDLLVNLSESRSVVDTLLDSLPSMFQDNMNVESAFGPALKAAFMVMSRLGGKLLIFQNSLPSLGVGCLK*********GTDKEHSLRIPEDPFYKQMAADLTKFQIAVNVYAFSDKYTDIASLGTLAKYTGGQVYYYPSFQSTTHGERLRHELSRDLTRETAWEAVMRIRCGKGVRFTNYHGNFMLRSTDLLALPAVDCDKAYAMQLSLEETLLTTQTVYFQVALLYTASCGERRIRVHTLAAPVVSNLSDMYQQADTGAIVSVFSRLAIEKTLSHKLEDARNAVQLRLVKALKEYRNLYAVQHRLGSRMIYPESLKFLPLYCLAICKSTPIRGGYADVTLDERCAAGYTMMALPVKKLLKLLYPCLIRVDEHLLKPSAQLDEYKNIMKRLPLVAESLDSRGLYIFDDGFRFVLWFGRMLSPDIAMNLLGSEFAAELSKVMLREQDNEMSRKLLGILKKLREQDPSYYQLCQLVRQGEQPREGFLLLANLVEDQIGGSNGYADWIMQIHRQVL***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGTENPGRSSFPARPSASPFASAPPTVTPFSSAGPVVGSEASSFRPAPPASPQTAAPFMSAAAGVGSDSSGFRPSTPQTRFNDPSVSSSPITYVPPTSGPFQRFPTPQFPPVAQAPPVRGPPVGLPPVSHPIGQVPNPPVPLRAQPPPVPMGSPVQRANFAPSGVNVPQPLSDSSFSASRPNSPPDSSYPFARPTPQQPLPGYVTTQPNAVSQGPTMPSSFPSHPRSYVPPPPTSASSFPAHQGGYVPPGVQSQHSGPPVGVIQGLAEDFSSLSFGSIPGSIEPGIDLKSLPRPLDGDVEPSSLAETYPLNCHSRYLRLTTSAIPNSQSLVSRWHLPLGAVVCPLAEPPEGNLFICRTYVNPYVTFTDAGRKWRCNICALLNDVPGDYFAHLDATGRRIDIDQRPELTKGSVEFVAPTEYMVRPPMPPLYFFLIDVSISAIRSGMLEVVAQTIKSCLDELPGFPRTQIGFITFDSTIHFYNMKSSLTQPQMMVISDLDDIFVPLPDDLLVNLSESRSVVDTLLDSLPSMFQDNMNVESAFGPALKAAFMVMSRLGGKLLIFQNSLPSLGVGCLKLRGDDLRVYGTDKEHSLRIPEDPFYKQMAADLTKFQIAVNVYAFSDKYTDIASLGTLAKYTGGQVYYYPSFQSTTHGERLRHELSRDLTRETAWEAVMRIRCGKGVRFTNYHGNFMLRSTDLLALPAVDCDKAYAMQLSLEETLLTTQTVYFQVALLYTASCGERRIRVHTLAAPVVSNLSDMYQQADTGAIVSVFSRLAIEKTLSHKLEDARNAVQLRLVKALKEYRNLYAVQHRLGSRMIYPESLKFLPLYCLAICKSTPIRGGYADVTLDERCAAGYTMMALPVKKLLKLLYPCLIRVDEHLLKPSAQLDEYKNIMKRLPLVAESLDSRGLYIFDDGFRFVLWFGRMLSPDIAMNLLGSEFAAELSKVMLREQDNEMSRKLLGILKKLREQDPSYYQLCQLVRQGEQPREGFLLLANLVEDQIGGSNGYADWIMQIHRQVLQNP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein transport protein Sec24-like At3g07100 Component of the COPII coat, that covers ER-derived vesicles involved in transport from the endoplasmic reticulum to the Golgi apparatus. COPII is composed of at least five proteins: the SEC23/24 complex, the SEC13/31 complex, and the protein SAR1. Acts in the cytoplasm to promote the transport of secretory, plasma membrane, and vacuolar proteins from the endoplasmic reticulum to the Golgi complex.probableQ9SFU0
Protein transport protein SEC24 Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). The coat has two main functions, the physical deformation of the endoplasmic reticulum membrane into vesicles and the selection of cargo molecules.probableQ0PVD8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1M2V, chain B
Confidence level:very confident
Coverage over the Query: 265-931,954-1017
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 265-931,954-1017
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 265-931,954-1017
View the alignment between query and template
View the model in PyMOL