BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 001727
         (1020 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1GO4|E Chain E, Crystal Structure Of Mad1-Mad2 Reveals A Conserved Mad2
           Binding Motif In Mad1 And Cdc20.
 pdb|1GO4|F Chain F, Crystal Structure Of Mad1-Mad2 Reveals A Conserved Mad2
           Binding Motif In Mad1 And Cdc20.
 pdb|1GO4|G Chain G, Crystal Structure Of Mad1-Mad2 Reveals A Conserved Mad2
           Binding Motif In Mad1 And Cdc20.
 pdb|1GO4|H Chain H, Crystal Structure Of Mad1-Mad2 Reveals A Conserved Mad2
           Binding Motif In Mad1 And Cdc20
          Length = 100

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 44/82 (53%), Gaps = 11/82 (13%)

Query: 202 EFSTLMTRLDVTEKENAFLKYEFRILEKELEIRNEEMEYTRRSVEATH---------KQH 252
           E  TL  +++  E E + L+ E R+LE +LE R  + +Y +   +  H         +Q 
Sbjct: 13  EADTLRLKVEELEGERSRLEEEKRMLEAQLERRALQGDYDQSRTKVLHMSLNPTSVARQR 72

Query: 253 LESVKKVAKLEAECERLRLLVR 274
           L   +  ++L+AECERLR L+R
Sbjct: 73  LR--EDHSQLQAECERLRGLLR 92


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.310    0.125    0.337 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 24,748,874
Number of Sequences: 62578
Number of extensions: 922764
Number of successful extensions: 2571
Number of sequences better than 100.0: 67
Number of HSP's better than 100.0 without gapping: 21
Number of HSP's successfully gapped in prelim test: 46
Number of HSP's that attempted gapping in prelim test: 2412
Number of HSP's gapped (non-prelim): 163
length of query: 1020
length of database: 14,973,337
effective HSP length: 109
effective length of query: 911
effective length of database: 8,152,335
effective search space: 7426777185
effective search space used: 7426777185
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 56 (26.2 bits)