Citrus Sinensis ID: 001754

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------102

MAQTRRYVPNQQLDLEQILQEAQYRWLRPTEICEILRNYQKFHLTPDPPVRPPAGSLFLFDRKALRYFRKDGHRWRKKKDGKTVKEAHEKLKAGSIDVLHCYYAHGEDNENFQRRSYWMLDGQLEHIVLVHYREVKEGYKSGRSAADPGSQIESSQTSSARSLAQANSSAPAAQTSHASIPNKIDWNGQAVSSEFEDVDSGHGSGTPSVAQSIYGSMSQNASLVAASIAGLPELSRHPQWFAGSKINHGSGSSMWPQIDNSSRNATSVLDQHGHQNFYVGQPSGADFITHKLTDARLASDSTIANIGTCGERLITDIDVHAVTTSSQGASQVLLEHNFNLINNQCQNCPVPEVTVASVSQAGIKPKEELGELKKLDSFGRWMDQEIGGDCDDSLMASDSGNYWNTLDAENDDKEVSSLSHHMQLEMDSLGPSLSQEQLFSIRDFSPDWAYSGAETKVLIIGMFLGTKKLSSDTKWGCMFGEIEVPAEVLTDNVIRCQAPSHAAGRVPFYITGSNRLACSEVREFEYREKPSKAGYPVASKIAPEDEVRLQTRLAKFLYLDPERKWFDCTIEDCNKCKLKNTIYSMRGDSEKDWGRVDESPMAIEGDCPNSRDKLIQNLLRNRLCEWLVWKIHEGGKGPNVIDDGGQGVVHLAAALGYEWAMRPIIATGVSPNFRDARGRTALHWASYFGREETVIMLVKLGAAPGAVEDPTPAFPGGQTAADLASSRGHKGIAGYLAEADLSSHLSSLTVNENGMDNVAAALAAEKANETAAQIGVQSDGPAAEQLSLRGSLAAVRKSAHAAALIQQAFRVRSFRHRQSIQSSDDVSEVSVDLVALGSLNKVSKMIHFEDYLHFAAIKIQQKYRGWKGRKDFLKIRNHIVKLQAHVRGHQVRKQYKKVVWSVSIVEKAILRWRRRGSGLRGFRVGNSTANVASENEKTDEYEFLRIGRKQKFAGVEKALERVKSMVRNPEARDQYMRMVAKFENFKMCDDGSGLLSQGEDSLNGPTKDNLHAYVADQ

ccccccccccccccHHHHHHHHHHHcccHHHHHHHHHcccccccccccccccccccEEEEEHHHHHHHccccccCEEccccccHHHHHHHcccccEEEEEEEEEcccccccccccEEEEcccccccEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccEEEEEEEcccccccccccccEEEEEccccccHHHHcccccccccccccccccEEEEEEcccccccccccEEEccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccCECcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHcc

*********NQQLDLEQILQEAQYRWLRPTEICEILRNYQKFHLTPDPPVRPPAGSLFLFDRKALRYFRKDGHRWRKKKD****KEAHEKLKAGSIDVLHCYYAHGEDNENFQRRSYWMLDGQLEHIVLVHYREVK***********************************************************************************************************************************************************LT********************I*D**V*****************************************************KKLDSFGRWMDQEIG**************************************************LFSIRDFSPDWAYSGAETKVLIIGMFLGTKKLSSDTKWGCMFGEIEVPAEVLTDNVIRCQAPSHAAGRVPFYITGSNRLACSEVREFEYRE********V***IAPEDEVRLQTRLAKFLYLDPERKWFDC*********************EKDWGRVDESPMAIEGDCPNSRDKLIQNLLRNRLCEWLVWKIHEGGKGPNVIDDGGQGVVHLAAALGYEWAMRPIIATGVSPNFRDARGRTALHWASYFGREETVIMLVKLGAAPGAVEDPTPAFPGGQTAADLASSRGHKGIAGYLAEADLSSHLSSLTVNENGMDNVAAALAAEKANETAAQIGVQSDGPAAEQLSLRGSLAAVRKSAHAAALIQQAFRVRSFR**************SVDLVALGSLNKVSKMIHFEDYLHFAAIKIQQKYRGWKGRKDFLKIRNHIVKLQAHVRGHQVRKQYKKVVWSVSIVEKAILRWRRRGSGL**F******************YEFLRIGRKQKFAGVEKALERVKSMVRN*EARDQYMRMVAKFENFKMC********************NLHAYVA**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Calmodulin-binding transcription activator 3	Regulates transcriptional activity in response to calcium signals. Binds to the consensus sequence 5'-[ACG]CGCG[GTC]-3'.	probable	Q8GSA7

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DFS, chain A
Confidence level:confident
Coverage over the Query: 849-978
View the alignment between query and template
View the model in PyMOL

Template: 1S70, chain B
Confidence level:confident
Coverage over the Query: 625-741
View the alignment between query and template
View the model in PyMOL

Template: 2CXK, chain A
Confidence level:confident
Coverage over the Query: 437-529
View the alignment between query and template
View the model in PyMOL

Template: 3LJN, chain A
Confidence level:probable
Coverage over the Query: 641-775
View the alignment between query and template
View the model in PyMOL

Template: 1IKN, chain D
Confidence level:probable
Coverage over the Query: 639-752
View the alignment between query and template
View the model in PyMOL

Template: 2AJA, chain A
Confidence level:probable
Coverage over the Query: 665-764
View the alignment between query and template
View the model in PyMOL

Template: 3MUJ, chain A
Confidence level:probable
Coverage over the Query: 440-560
View the alignment between query and template
View the model in PyMOL