Citrus Sinensis ID: 001766


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------
MKLVVRVIEARNIPAMDQNGYSDPYVRLQLGRQRFKTKVVRKSLSPSWEEEFSFKVEDLKDELVISVLDEDKYFNDDFVGFLKIPVSRVFDADNKSLPTAWHSLQPKNKKSKNKDCGEILLTISFSHNTSSADFNINSDPLDQLKTTESPKRSFSGPSNAPSPVRVEDTTSSREEKSCAQKTLAGRIAQMFNKNSDTASDRGVDFLELPETTKSELFDDKCVDQSSSASFEEAMKTMEPRDLGSEVPSNLPGGVLVDQMYVIAPQDLNTLLFSPDSNFPRTWAEEQGNTELQIGPWRFENGCESLKRDVTYIKAANKLIKATKGFEEQTYLKADGKVFAILASVSTPEVMYGGSFKTELLFCITPGPELSSGEQSSHLVISWRMNFLQSTMMKGMIENGARSALRETYEQFATFLSQTITPVDSNDMGLNKEQILASLQPEPQSDWKLAVHYFANFTVVSSFFMGIYVLIHIWLATSTTIQGLEFVGLDLPDSIGEFIVCGVLVLQGERFLQLISRFMQARKQKGSDHGVKAQGDGWLLTVALIKGDNLAAVDSSGFCDPYVVFTCNGKSRTSSIKFQQCDPMWNEIFEYDAMDEPPSMLDVEVYDFDGPFNEATSLGHAEINFVKSDISDLADVWIPLQGKLAQACQSKLHLRIFLNNTKGSNVVKEYLTKMEKEVGKKINLRSPQTNSAFQKLFGLPPEEFLINDFTCHLKRKMLLQGRLFLSARIIGFHANLFGHKTNFFFLWEDIEDIQVLPPSLSSMGSPVIVMTLRQGRGMDARHGAKTQDEEGRLKFHFHSFVSYNVAHRTIMALWKARSLSPEQKVQIVEESEAKSLQSEEGGTFLGLEDVTMSEVYSSVLPVPMSFFMELFGGGELERAVMEKAGCVSYSCSSWESEKLDVYERQIYYRFDKCISRYRGEVTSTQQKSPLPNGNGWLVEEVMTLHGVPLGDYFNLHLRYQVEDSPSRPKGCLAQVYLGVAWLKSTRHQKRITKNIVSNLEDRLRVKLSVIEKEFAAR
cEEEEEEEEEccccccccccccccEEEEEEccEEEEEEEEEccccccEEEEEEEEEcccccEEEEEEEEccccccccEEEEEEEEcccccccccccccccEEEccccccccccccccEEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccEEEEccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccEEEccEEEcccccccccccccccccHHHHHHHHcccccEEccccccccccccEEEEEEEEccccccccccccEEEEEEEccccEEEEEEEEEccccccccEEEEEEEEEEcccccccccccEEEEEEEEEEEEEEEHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccccccccHHHHccccccccccccEEEEEEEEccEEEEHHHHHHHHHHHHHHcccccEEEEEEccccccccccEEEEEEEEEEEcEEHHHHHHHHHHHHHHcccccccccccccEEEEEEEEEEccccccccccccccEEEEEEccEEEEEEcccccccccEEEEEEEEcccccccEEEEEEEEcccccccccEEEEEEEEcccccccccccEEEEcccccccccccEEEEEEEEEcccccHHHHHHHHHccccccccccccccccccccccccccccccEEEcccccHHHHHccccccEEEEEEEEEEEccccccEEEEEEEEccccccEEcccccccccccEEEEEEEcccccccccccccccccccEEEEEEEEccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHcccccHHHHHHHHHcccccccccccccccccEEEEEEEEEccccccccccccEEEEEEEccccccEEEEEEEEcccccccccEEEEEEEEEEcccccccccEEEEEEcEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
ccEEEEEEEcccccccccccccccEEEEEEcccEEEEEEEEcccccccccEEEEEEcccccEEEEEEEEcccccccccEEEEEEcHHHHEccccccccccHEEccccccccccccccEEEEEEEEcccccccccccccccEEEEEEccccccccccccccccccccccccccccHHHHcccEEEEEEcccccccccccccccccHcEEcccccccccccccccccccccHHHHHHHHccccccccccccccccEEEEEEEEEcHHHHHHHcccccccccccHHHHccccccEEccEEEccccccEEEEEEEEcccHHHHHHHHHHHHcEEEEccccEEEEEEEEEccccccccEEEEEEEEEEcccccccccccccEEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEccHHcccccHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEccccccEEEEEEEEcccccccccccccccEEEEEEcccEEEEEEEEccccccccEEEEEEcccccccEEEEEEEEcccccccccccEEEEEEcccccccccccccEEccccccccccccEEEEEEcccccccHHHHHHHHHHHHHHcccccccccccccccEEEccccHHHHHHcccEEEEEcccccccEEEEcHHHHHHHHHHcccccEEEEEcccHHHHEEccccHHcccccEEEEEEEcccccccccccccccccccEEEEEEEEccHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccccccccEcccccccccEEEcccccccHHHHHHHHcccccHHHHHHHccccccccccccccccccEEEEEEEEEcccccccccEEEEEEEEccccccccEEEEEEEEcccccccccEEEEEEEEEEEccccccccEEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
MKLVVRVIEArnipamdqngysdpyvrlqlgrqrfKTKVVRkslspsweeeFSFKVEDLKDELVISVLdedkyfnddfvgflkipvsrvfdadnkslptawhslqpknkksknkdcgEILLTISFshntssadfninsdpldqlkttespkrsfsgpsnapspvrvedttssreeKSCAQKTLAGRIAQMFnknsdtasdrgvdflelpettkselfddkcvdqsssASFEEAMKTmeprdlgsevpsnlpggvlvdqmyviapqdlntllfspdsnfprtwaeeqgntelqigpwrfengceslKRDVTYIKAANKLIKATKGFEEQTYLKADGKVFAILASvstpevmyggsfktELLFcitpgpelssgeqsSHLVISWRMNFLQSTMMKGMIENGARSALRETYEQFATFLSqtitpvdsndmglnkEQILAslqpepqsdwKLAVHYFANFTVVSSFFMGIYVLIHIWLATSTtiqglefvgldlpdsigEFIVCGVLVLQGERFLQLISRFMQARKqkgsdhgvkaqgdGWLLTVALIKgdnlaavdssgfcdpyvvftcngksrtssikfqqcdpmwneifeydamdeppsmldvevydfdgpfneatslghaeinfvksdisdladvWIPLQGKLAQACQSKLHLRIFLnntkgsnvVKEYLTKMEKEVGKkinlrspqtnsafqklfglppeefliNDFTCHLKRKMLLQGRLFLSARIIGFHanlfghktnffflwediediqvlppslssmgspvIVMTLRqgrgmdarhgaktqdeegrlkFHFHSFVSYNVAHRTIMALWKarslspeqKVQIVEESEAKslqseeggtflgledvtMSEVYssvlpvpmsFFMELFGGGELERAVMEKAGCVsyscsswesekldVYERQIYYRFDKCIsryrgevtstqqksplpngngwLVEEVMTlhgvplgdyfnlhlryqvedspsrpkgclAQVYLGVAWLKSTRHQKRITKNIVSNLEDRLRVKLSVIEKEFAAR
MKLVVRVIearnipamdqngysdpYVRLQLgrqrfktkvvrkslspsweeefsfkvedlKDELVISVLDEDKYFNDDFVGFLKIPVSRVFDADNKSLptawhslqpknkksknkDCGEILLTISFSHNTSSADFNINSDPLDQLKTTespkrsfsgpsnapspvrvedttssreeksCAQKTLAGRIAQMfnknsdtasdrgVDFLELPettkselfddkcvdQSSSASFEEAMKTMEPRDLGSEVPSNLPGGVLVDQMYVIAPQDLNTLLFSPDSNFPRTWAEeqgntelqigpwRFENGCESLKRDVTYIKAANKLIKATKGFEEQTYLKADGKVFAILASVSTPEVMYGGSFKTELLFCITPGPELSSGEQSSHLVISWRMNFLQSTMMKGMIENGARSALRETYEQFATFLSQTITPVDSNDMGLNKEQILASLQPEPQSDWKLAVHYFANFTVVSSFFMGIYVLIHIWLATSTTIQGLEFVGLDLPDSIGEFIVCGVLVLQGERFLQLISRFMQARKQkgsdhgvkaqgDGWLLTVALIKGDNLAAVDSSGFCDPYVVFTCNGKsrtssikfqqcdPMWNEIFEYDAMDEPPSMLDVEVYDFDGPFNEATSLGHAEINFVKSDISDLADVWIPLQGKLAQACQSKLHLRiflnntkgsnvvKEYLTKMEKEVGKkinlrspqtnSAFQKLFGLPPEEFLINDFTCHLKRKMLLQGRLFLSARIIGFHANLFGHKTNFFFLWEDIEDIQVLppslssmgsPVIVMTLRQGRGMDARHGAKTQDEEGRLKFHFHSFVSYNVAHRTIMALWKARSLSPEQKVQIVEEseakslqseeggTFLGLEDVTMSEVYSSVLPVPMSFFMELFGGGELERAVMEKAGCVSyscsswesekldvYERQIYYRFDKCISRYRGEvtstqqksplpngnGWLVEEVMTLHGVPLGDYFNLHLRYQVEDSPSRPKGCLAQVYLGVAwlkstrhqkritknivsnledrlrvklsviekefaar
MKLVVRVIEARNIPAMDQNGYSDPYVRLQLGRQRFKTKVVRKSLSPSWEEEFSFKVEDLKDELVISVLDEDKYFNDDFVGFLKIPVSRVFDADNKSLPTAWHSLQPKNKKSKNKDCGEILLTISFSHNTSSADFNINSDPLDQLKTTESPKRSFSGPSNAPSPVRVEDTTSSREEKSCAQKTLAGRIAQMFNKNSDTASDRGVDFLELPETTKSELFDDKCVDQSSSASFEEAMKTMEPRDLGSEVPSNLPGGVLVDQMYVIAPQDLNTLLFSPDSNFPRTWAEEQGNTELQIGPWRFENGCESLKRDVTYIKAANKLIKATKGFEEQTYLKADGKVFAILASVSTPEVMYGGSFKTELLFCITPGPELSSGEQSSHLVISWRMNFLQSTMMKGMIENGARSALRETYEQFATFLSQTITPVDSNDMGLNKEQILASLQPEPQSDWKLAVHYFANFTVVSSFFMGIYVLIHIWLATSTTIQGLEFVGLDLPDSIGEFIVCGVLVLQGERFLQLISRFMQARKQKGSDHGVKAQGDGWLLTVALIKGDNLAAVDSSGFCDPYVVFTCNGKSRTSSIKFQQCDPMWNEIFEYDAMDEPPSMLDVEVYDFDGPFNEATSLGHAEINFVKSDISDLADVWIPLQGKLAQACQSKLHLRIFLNNTKGSNVVKEYLTKMEKEVGKKINLRSPQTNSAFQKLFGLPPEEFLINDFTCHLKRKMLLQGRLFLSARIIGFHANLFGHKTNFFFLWEDIEDIQVLPPSLSSMGSPVIVMTLRQGRGMDARHGAKTQDEEGRLKFHFHSFVSYNVAHRTIMALWKARSLSPEQKVQIVEESEAKSLQSEEGGTFLGLEDVTMSEVYSSVLPVPMSFFMELFGGGELERAVMEKAGCVSYSCSSWESEKLDVYERQIYYRFDKCISRYRGEVTSTQQKSPLPNGNGWLVEEVMTLHGVPLGDYFNLHLRYQVEDSPSRPKGCLAQVYLGVAWLKSTRHQKRITKNIVSNLEDRLRVKLSVIEKEFAAR
***VVRVIEARNIPAMDQNGYSDPYVRLQLGRQRFKTKVVRKSLSPSWEEEFSFKVEDLKDELVISVLDEDKYFNDDFVGFLKIPVSRVFDAD*************************ILLTIS*******************************************************************************************************************************GGVLVDQMYVIAPQDLNTLLFSPDSNFPRTWAEEQGNTELQIGPWRFENGCESLKRDVTYIKAANKLIKATKGFEEQTYLKADGKVFAILASVSTPEVMYGGSFKTELLFCITPG**********HLVISWRMNFLQSTMMKGMIENGARSALRETYEQFATFLSQTITPV*********************SDWKLAVHYFANFTVVSSFFMGIYVLIHIWLATSTTIQGLEFVGLDLPDSIGEFIVCGVLVLQGERFLQLISRFMQA********GVKAQGDGWLLTVALIKGDNLAAVDSSGFCDPYVVFTCNGKSRTSSIKFQQCDPMWNEIFEYDAMDEPPSMLDVEVYDFDGPFNEATSLGHAEINFVKSDISDLADVWIPLQGKLAQACQSKLHLRIFLNNTKGSNVVKEYLTKMEKEVG**I********SAFQKLFGLPPEEFLINDFTCHLKRKMLLQGRLFLSARIIGFHANLFGHKTNFFFLWEDIEDIQVLPPSL****SPVIVMTL*******************RLKFHFHSFVSYNVAHRTIMALWKAR*************************TFLGLEDVTMSEVYSSVLPVPMSFFMELFGGGELERAVMEKAGCVSYSCSSWESEKLDVYERQIYYRFDKCISRYRGEVT*********NGNGWLVEEVMTLHGVPLGDYFNLHLRYQVEDSPSRPKGCLAQVYLGVAWLKSTRHQKRITKNIVSNLEDRLRVKLSVI*******
MKLVVRVIEARNIPAMDQNGYSDPYVRLQLGRQRFKTKVVRKSLSPSWEEEFSFKVEDLKDELVISVLDEDKYFNDDFVGFLKIPVSRVFDADNKSLPTAW*****************ILLTISFSHNTSSA*************************************************************************************************************************VLVDQMYVIAPQDL**L******NFPR*WAEEQGNTELQ**********ESLKRDVTYIKAANKLIKATKGFEEQTYLKADGKVFAILASVSTPEVMYGGSFKTELLFCI***************VISWRMNFLQSTMMK*************TYEQFATFLSQTITPVDSNDMGLNKEQILASLQPEPQSDWKLAVHYFANFTVVSSFFMGIYVLIHIWLATSTTIQGLEFVGLDLPDSIGEFIVCGVLVLQGERFLQL**********************GWLLTVALIKGDNLAAVDSSGFCDPYVVFTCNGKSRTSSIKFQQCDPMWNEIFEYDAMDEPPSMLDVEVYDFDGPFNEATSLGHAEINFVKSDISDLADVWIP***********K*HLRIFLNNTKGSNV******************************FGLPPEEFLINDFTCHLKRKMLLQGRLFLSARIIGFHANLFGHKTNFFFLWEDIEDIQVLPPSLSSMGSPVIVMTLRQGR***************RLKFHFHSFVSYNVAHRTIMALWK**********************************VTMSEVYSSVLPVPMSFFMELFGGGELERAVMEKAGCVSYSCSSWESEKLDVYERQIYYRFDKCISRYRGEVTSTQQKSPLPNGNGWLVEEVMTLHGVPLGDYFNLHLRYQVED*******CLAQVYLGVAWLKSTRHQKRIT****SNLEDRLRVKLSVIEKEF***
MKLVVRVIEARNIPAMDQNGYSDPYVRLQLGRQRF*************EEEFSFKVEDLKDELVISVLDEDKYFNDDFVGFLKIPVSRVFDADNKSLPTAWHSLQ********KDCGEILLTISFSHNTSSADFNINSDPLDQLK**********************************QKTLAGRIAQMFNKNSDTASDRGVDFLELPETTKSELFDDKCVDQSSSASFEEAMKTMEPRDLGSEVPSNLPGGVLVDQMYVIAPQDLNTLLFSPDSNFPRTWAEEQGNTELQIGPWRFENGCESLKRDVTYIKAANKLIKATKGFEEQTYLKADGKVFAILASVSTPEVMYGGSFKTELLFCITPGPELSSGEQSSHLVISWRMNFLQSTMMKGMIENGARSALRETYEQFATFLSQTITPVDSNDMGLNKEQILASLQPEPQSDWKLAVHYFANFTVVSSFFMGIYVLIHIWLATSTTIQGLEFVGLDLPDSIGEFIVCGVLVLQGERFLQLISRFMQ************AQGDGWLLTVALIKGDNLAAVDSSGFCDPYVVFTCNGKSRTSSIKFQQCDPMWNEIFEYDAMDEPPSMLDVEVYDFDGPFNEATSLGHAEINFVKSDISDLADVWIPLQGKLAQACQSKLHLRIFLNNTKGSNVVKEYLTKMEKEVGKKINLRSPQTNSAFQKLFGLPPEEFLINDFTCHLKRKMLLQGRLFLSARIIGFHANLFGHKTNFFFLWEDIEDIQVLPPSLSSMGSPVIVMTLRQGRGMDARHGAKTQDEEGRLKFHFHSFVSYNVAHRTIMALWKARSLS*******************EGGTFLGLEDVTMSEVYSSVLPVPMSFFMELFGGGELERAVMEKAGCVSYSCSSWESEKLDVYERQIYYRFDKCISRYRGE*********LPNGNGWLVEEVMTLHGVPLGDYFNLHLRYQVEDSPSRPKGCLAQVYLGVAWLKSTRHQKRITKNIVSNLEDRLRVKLSVIEKEFAAR
*KLVVRVIEARNIPAMDQNGYSDPYVRLQLGRQRFKTKVVRKSLSPSWEEEFSFKVEDLKDELVISVLDEDKYFNDDFVGFLKIPVSRVFDADNKSLPTAWHSLQPKNKKSKNKDCGEILLTISFSHNTSSADFNINSDPLDQLKTTESP********NAPSPVRVEDTTSSREEKSCAQKTLAGRIAQMFNKNSDTASDRGVDFLELPET****************A**EEAMKTMEPRDLGSEVPSNLPGGVLVDQMYVIAPQDLNTLLFSPDSNFPRTWAEEQGNTELQIGPWRFENGCESLKRDVTYIKAANKLIKATKGFEEQTYLKADGKVFAILASVSTPEVMYGGSFKTELLFCITPGPELSSGEQSSHLVISWRMNFLQSTMMKGMIENGARSALRETYEQFATFLSQTITPVDSNDMGLNKEQILASLQPEPQSDWKLAVHYFANFTVVSSFFMGIYVLIHIWLATSTTIQGLEFVGLDLPDSIGEFIVCGVLVLQGERFLQLISRFMQARKQKGSDHGVKAQGDGWLLTVALIKGDNLAAVDSSGFCDPYVVFTCNGKSRTSSIKFQQCDPMWNEIFEYDAMDEPPSMLDVEVYDFDGPFNEATSLGHAEINFVKSDISDLADVWIPLQGKLAQACQSKLHLRIFLNNTKGSNVVKEYLTKMEKEVGKKINLRSPQTNSAFQKLFGLPPEEFLINDFTCHLKRKMLLQGRLFLSARIIGFHANLFGHKTNFFFLWEDIEDIQVLPPSLSSMGSPVIVMTLRQGRGMDARHGAKTQDEEGRLKFHFHSFVSYNVAHRTIMALWKARSLSPEQKVQIVEES*AKSL******TFLGLEDVTMSEVYSSVLPVPMSFFMELFGGGELERAVMEKAGCVSYSCSSWESEKLDVYERQIYYRFDKCISRYRGEVTSTQQKSPLPNGNGWLVEEVMTLHGVPLGDYFNLHLRYQVEDSPSRPKGCLAQVYLGVAWLKSTRHQKRITKNIVSNLEDRLRVKLSVIEKEFA**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLVVRVIEARNIPAMDQNGYSDPYVRLQLGRQRFKTKVVRKSLSPSWEEEFSFKVEDLKDELVISVLDEDKYFNDDFVGFLKIPVSRVFDADNKSLPTAWHSLQPKNKKSKNKDCGEILLTISFSHNTSSADFNINSDPLDQLKTTESPKRSFSGPSNAPSPVRVEDTTSSREEKSCAQKTLAGRIAQMFNKNSDTASDRGVDFLELPETTKSELFDDKCVDQSSSASFEEAMKTMEPRDLGSEVPSNLPGGVLVDQMYVIAPQDLNTLLFSPDSNFPRTWAEEQGNTELQIGPWRFENGCESLKRDVTYIKAANKLIKATKGFEEQTYLKADGKVFAILASVSTPEVMYGGSFKTELLFCITPGPELSSGEQSSHLVISWRMNFLQSTMMKGMIENGARSALRETYEQFATFLSQTITPVDSNDMGLNKEQILASLQPEPQSDWKLAVHYFANFTVVSSFFMGIYVLIHIWLATSTTIQGLEFVGLDLPDSIGEFIVCGVLVLQGERFLQLISRFMQARKQKGSDHGVKAQGDGWLLTVALIKGDNLAAVDSSGFCDPYVVFTCNGKSRTSSIKFQQCDPMWNEIFEYDAMDEPPSMLDVEVYDFDGPFNEATSLGHAEINFVKSDISDLADVWIPLQGKLAQACQSKLHLRIFLNNTKGSNVVKEYLTKMEKEVGKKINLRSPQTNSAFQKLFGLPPEEFLINDFTCHLKRKMLLQGRLFLSARIIGFHANLFGHKTNFFFLWEDIEDIQVLPPSLSSMGSPVIVMTLRQGRGMDARHGAKTQDEEGRLKFHFHSFVSYNVAHRTIMALWKARSLSPEQKVQIVEESEAKSLQSEEGGTFLGLEDVTMSEVYSSVLPVPMSFFMELFGGGELERAVMEKAGCVSYSCSSWESEKLDVYERQIYYRFDKCISRYRGEVTSTQQKSPLPNGNGWLVEEVMTLHGVPLGDYFNLHLRYQVEDSPSRPKGCLAQVYLGVAWLKSTRHQKRITKNIVSNLEDRLRVKLSVIEKEFAAR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1016 2.2.26 [Sep-21-2011]
Q9ZVT91020 C2 and GRAM domain-contai yes no 0.992 0.988 0.688 0.0
Q9FGS81027 C2 and GRAM domain-contai no no 0.981 0.970 0.455 0.0
Q5R4J5419 Synaptotagmin-1 OS=Pongo yes no 0.145 0.353 0.313 2e-13
Q6DN14999 Multiple C2 and transmemb yes no 0.123 0.125 0.311 3e-13
P48018422 Synaptotagmin-1 OS=Bos ta yes no 0.118 0.284 0.353 6e-13
P21707421 Synaptotagmin-1 OS=Rattus yes no 0.118 0.285 0.353 6e-13
Q60HC0419 Synaptotagmin-1 OS=Macaca N/A no 0.118 0.286 0.353 6e-13
P21579422 Synaptotagmin-1 OS=Homo s no no 0.118 0.284 0.353 6e-13
P46096421 Synaptotagmin-1 OS=Mus mu yes no 0.118 0.285 0.353 6e-13
Q54E35570 Rho GTPase-activating pro yes no 0.113 0.201 0.361 7e-13
>sp|Q9ZVT9|C2GR1_ARATH C2 and GRAM domain-containing protein At1g03370 OS=Arabidopsis thaliana GN=At1g03370 PE=2 SV=4 Back     alignment and function desciption
 Score = 1466 bits (3795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 703/1021 (68%), Positives = 838/1021 (82%), Gaps = 13/1021 (1%)

Query: 1    MKLVVRVIEARNIPAMDQNGYSDPYVRLQLGRQRFKTKVVRKSLSPSWEEEFSFKVEDLK 60
            MKL VRV+EARN+PAMD NG+SDPYVRLQLG+QR +TKVV+K+L+P W E+FSF V+DL 
Sbjct: 1    MKLQVRVVEARNLPAMDLNGFSDPYVRLQLGKQRSRTKVVKKNLNPKWTEDFSFGVDDLN 60

Query: 61   DELVISVLDEDKYFNDDFVGFLKIPVSRVFDADNKSLPTAWHSLQPKNKKSKNKDCGEIL 120
            DELV+SVLDEDKYFNDDFVG +++ VS VFDA+N+SL T W+ L PK K SK KDCGEIL
Sbjct: 61   DELVVSVLDEDKYFNDDFVGQVRVSVSLVFDAENQSLGTVWYPLNPKKKGSK-KDCGEIL 119

Query: 121  LTISFSHNTSSADFNINSDPLDQLKTTESPKRSFSGPSNAPSPVRVEDTTSSREEKSCAQ 180
            L I FS   S  D   + D     ++ +    S   PS   SP R +D +S        Q
Sbjct: 120  LKICFSQKNSVLDLTSSGDQTSASRSPDLRLESPIDPSTCASPSRSDDASS------IPQ 173

Query: 181  KTLAGRIAQMFNKNSDTA-----SDRGVDFLELPETTKSELFDDKCVDQSSSASFEEAMK 235
             T AGR  Q+F KN+ TA     S R +D  +L E +K     +   D+SSS SFEE +K
Sbjct: 174  TTFAGRFTQIFQKNAITATPTQSSSRSIDASDLSEISKPVFSLELSEDESSSTSFEELLK 233

Query: 236  TMEPRDLGSEVPSNLPGGVLVDQMYVIAPQDLNTLLFSPDSNFPRTWAEEQGNTELQIGP 295
             ME +D GSE PSNL GGV+VDQ+++I+P DLN +LF+ DS+F  +  E QG TE+QIGP
Sbjct: 234  AMESKDQGSEPPSNLSGGVVVDQLFMISPSDLNIVLFASDSSFYASLTELQGTTEVQIGP 293

Query: 296  WRFENGCESLKRDVTYIKAANKLIKATKGFEEQTYLKADGKVFAILASVSTPEVMYGGSF 355
            W+ EN  ES+KR V+Y+KAA KLIKA KG EEQTYLKADG+V+A+LASV+TP+V +GG+F
Sbjct: 294  WKAENDGESVKRVVSYLKAATKLIKAVKGTEEQTYLKADGEVYAVLASVATPDVPFGGTF 353

Query: 356  KTELLFCITPGPELSSGEQSSHLVISWRMNFLQSTMMKGMIENGARSALRETYEQFATFL 415
            K E+L+CI+PGPEL SGEQ S LV+SWR+NFLQSTMM+GMIENGAR  L++ +EQ+A  L
Sbjct: 354  KVEVLYCISPGPELPSGEQCSRLVVSWRLNFLQSTMMRGMIENGARQGLKDNFEQYANLL 413

Query: 416  SQTITPVDSNDMGLNKEQILASLQPEPQSDWKLAVHYFANFTVVSSFFMGIYVLIHIWLA 475
            +Q++ PVDS D+GLNKEQ L+SLQ EPQSDWKLAV YFANFTV+S+F +GIYV +HI  A
Sbjct: 414  AQSVKPVDSKDIGLNKEQALSSLQAEPQSDWKLAVQYFANFTVLSTFLIGIYVFVHIVFA 473

Query: 476  TSTTIQGLEFVGLDLPDSIGEFIVCGVLVLQGERFLQLISRFMQARKQKGSDHGVKAQGD 535
              + IQGLEF GLDLPDSIGEF+V GVLVLQ ER LQLISRFMQARKQKGSDHG+KA GD
Sbjct: 474  IPSAIQGLEFNGLDLPDSIGEFVVSGVLVLQCERVLQLISRFMQARKQKGSDHGIKAHGD 533

Query: 536  GWLLTVALIKGDNLAAVDSSGFCDPYVVFTCNGKSRTSSIKFQQCDPMWNEIFEYDAMDE 595
            GWLLTVALI+G +LAAVD SG CDPY+VFT NGK+RTSSIKFQ+ +P WNEIFE+DAM +
Sbjct: 534  GWLLTVALIEGVDLAAVDPSGHCDPYIVFTSNGKTRTSSIKFQKSNPQWNEIFEFDAMAD 593

Query: 596  PPSMLDVEVYDFDGPFNEATSLGHAEINFVKSDISDLADVWIPLQGKLAQACQSKLHLRI 655
            PPS+L+VEV+DFDGPF+EA SLGHAE+NFV+S+ISDLADVW+PLQGKLAQACQSKLHLRI
Sbjct: 594  PPSVLNVEVFDFDGPFDEAVSLGHAEVNFVRSNISDLADVWVPLQGKLAQACQSKLHLRI 653

Query: 656  FLNNTKGSNVVKEYLTKMEKEVGKKINLRSPQTNSAFQKLFGLPPEEFLINDFTCHLKRK 715
            FL++T G +VV++YL KMEKEVGKKIN+RSPQTNSAFQKLFGLP EEFLINDFTCHLKRK
Sbjct: 654  FLDHTGGGDVVRDYLNKMEKEVGKKINVRSPQTNSAFQKLFGLPQEEFLINDFTCHLKRK 713

Query: 716  MLLQGRLFLSARIIGFHANLFGHKTNFFFLWEDIEDIQVLPPSLSSMGSPVIVMTLRQGR 775
            M LQGRLFLSARI+GF+A++FG+KT FFFLWEDIE+IQVLPP+L+SMGSP++VMTLR  R
Sbjct: 714  MPLQGRLFLSARIVGFYASIFGNKTKFFFLWEDIEEIQVLPPTLASMGSPIVVMTLRPNR 773

Query: 776  GMDARHGAKTQDEEGRLKFHFHSFVSYNVAHRTIMALWKARSLSPEQKVQIVEESEAKSL 835
            G+DAR GAKT DEEGRLKFHFHSFVS+NVA +TIMALWKA+SL+PEQKVQ VEE   + L
Sbjct: 774  GLDARIGAKTHDEEGRLKFHFHSFVSFNVAQKTIMALWKAKSLTPEQKVQAVEEESEQKL 833

Query: 836  QSEEGGTFLGLEDVTMSEVYSSVLPVPMSFFMELFGGGELERAVMEKAGCVSYSCSSWES 895
            QSEE G FLG++DV  SEV+S  LPVP+SFFMELFGGGE++R  ME+AGC SYSCS WES
Sbjct: 834  QSEESGLFLGVDDVRFSEVFSLTLPVPVSFFMELFGGGEVDRKAMERAGCQSYSCSPWES 893

Query: 896  EKLDVYERQIYYRFDKCISRYRGEVTSTQQKSPLPNGNGWLVEEVMTLHGVPLGDYFNLH 955
            EK DVYERQ YYR DK ISRYRGEVTSTQQKS +P  NGWLVEEVMTLHGVPLGDYFNLH
Sbjct: 894  EKDDVYERQTYYR-DKRISRYRGEVTSTQQKSLVPEKNGWLVEEVMTLHGVPLGDYFNLH 952

Query: 956  LRYQVEDSPSRPKGCLAQVYLGVAWLKSTRHQKRITKNIVSNLEDRLRVKLSVIEKEFAA 1015
            LRYQ+E+S S+PK    +VY G+ WLKSTRHQKR+TKNI+ NL+DRL++    +EKE+++
Sbjct: 953  LRYQMEESTSKPKTTYVRVYFGIEWLKSTRHQKRVTKNILVNLQDRLKMTFGFLEKEYSS 1012

Query: 1016 R 1016
            R
Sbjct: 1013 R 1013





Arabidopsis thaliana (taxid: 3702)
>sp|Q9FGS8|C2GR2_ARATH C2 and GRAM domain-containing protein At5g50170 OS=Arabidopsis thaliana GN=At5g50170 PE=2 SV=1 Back     alignment and function description
>sp|Q5R4J5|SYT1_PONAB Synaptotagmin-1 OS=Pongo abelii GN=SYT1 PE=2 SV=1 Back     alignment and function description
>sp|Q6DN14|MCTP1_HUMAN Multiple C2 and transmembrane domain-containing protein 1 OS=Homo sapiens GN=MCTP1 PE=2 SV=2 Back     alignment and function description
>sp|P48018|SYT1_BOVIN Synaptotagmin-1 OS=Bos taurus GN=SYT1 PE=1 SV=1 Back     alignment and function description
>sp|P21707|SYT1_RAT Synaptotagmin-1 OS=Rattus norvegicus GN=Syt1 PE=1 SV=3 Back     alignment and function description
>sp|Q60HC0|SYT1_MACFA Synaptotagmin-1 OS=Macaca fascicularis GN=SYT1 PE=2 SV=1 Back     alignment and function description
>sp|P21579|SYT1_HUMAN Synaptotagmin-1 OS=Homo sapiens GN=SYT1 PE=1 SV=1 Back     alignment and function description
>sp|P46096|SYT1_MOUSE Synaptotagmin-1 OS=Mus musculus GN=Syt1 PE=1 SV=1 Back     alignment and function description
>sp|Q54E35|GACEE_DICDI Rho GTPase-activating protein gacEE OS=Dictyostelium discoideum GN=gacEE PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1016
2241247261020 predicted protein [Populus trichocarpa] 0.996 0.992 0.729 0.0
2240895431012 predicted protein [Populus trichocarpa] 0.988 0.992 0.724 0.0
3594956341030 PREDICTED: C2 and GRAM domain-containing 0.997 0.983 0.725 0.0
3565328551018 PREDICTED: C2 and GRAM domain-containing 0.995 0.993 0.696 0.0
297843150 1872 C2 domain-containing protein [Arabidopsi 0.992 0.538 0.682 0.0
3341822681020 C2 calcium/lipid-binding and GRAM domain 0.992 0.988 0.688 0.0
3574481131042 Synaptotagmin-1 [Medicago truncatula] gi 0.998 0.973 0.672 0.0
3565557811018 PREDICTED: C2 and GRAM domain-containing 0.995 0.993 0.692 0.0
4494434881034 PREDICTED: C2 and GRAM domain-containing 0.997 0.979 0.698 0.0
3565201201027 PREDICTED: C2 and GRAM domain-containing 0.994 0.983 0.679 0.0
>gi|224124726|ref|XP_002329933.1| predicted protein [Populus trichocarpa] gi|222871955|gb|EEF09086.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1541 bits (3991), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 745/1021 (72%), Positives = 866/1021 (84%), Gaps = 9/1021 (0%)

Query: 1    MKLVVRVIEARNIPAMDQNGYSDPYVRLQLGRQRFKTKVVRKSLSPSWEEEFSFKVEDLK 60
            ++L VRVIEARN+P  D NG SDPY +L+LG+Q+ KTKVV+K+L+PSWEEEFSFKVEDL 
Sbjct: 4    LRLFVRVIEARNLPPTDPNGLSDPYAKLRLGKQKCKTKVVKKNLNPSWEEEFSFKVEDLN 63

Query: 61   DELVISVLDEDKYFNDDFVGFLKIPVSRVFDADNKSLPTAWHSLQPKNKKSKNKDCGEIL 120
            ++LV+ VLDEDK+FNDDFVG +K+PVSRVFDA++KSL TAW+SLQPKNKKSK K+CGEIL
Sbjct: 64   EDLVVCVLDEDKFFNDDFVGLIKVPVSRVFDAEDKSLGTAWYSLQPKNKKSKIKECGEIL 123

Query: 121  LTISFSHNTSSADFNINSDPLDQLKTTESPKRSFSGPSNAPSPVRVEDTTSSREEKSCAQ 180
            L+I  S   S  D N N      +   +SP RSF+G +N+ S  R E+T SS+E+K  AQ
Sbjct: 124  LSICVSQ--SFPDLNCNGSR-KNVDIMQSPSRSFNGMTNSSS-ARSEETASSKEDKFFAQ 179

Query: 181  KTLAGRIAQMFNKNSDTAS---DRGVDFLELPETTKSELFDDKCVDQSSSASFEEAMKTM 237
            K LAGRIAQ+FNKNSD  S    R  +  E  ET  SE+ D+K  DQSSS +FEE MK M
Sbjct: 180  KNLAGRIAQIFNKNSDAISATTSRSTEISEQSETDGSEVCDEKAEDQSSSDNFEELMKEM 239

Query: 238  EPRDLGSEVPSNLPGGVLVDQMYVIAPQDLNTLLFSPDSNFPRTWAEEQGNTELQIGPWR 297
            + RD+GSEVP NLPGGVLVDQ Y+IA  DLN+LLFSPDS+F R+ ++  GN+E Q GPW+
Sbjct: 240  KSRDVGSEVPKNLPGGVLVDQSYLIATPDLNSLLFSPDSSFARSLSDFLGNSEQQFGPWK 299

Query: 298  FENGCESLKRDVTYIKAANKLIKATKGFEEQTYLKADGKVFAILASVSTPEVMYGGSFKT 357
            FENG  SLKR +TY++A +KL+ A K  E+Q Y+K DGK FAIL  VSTP+VMYG +FK 
Sbjct: 300  FENGSGSLKRVITYVRAPSKLVGAVKASEDQIYVKVDGKTFAILNCVSTPDVMYGSTFKV 359

Query: 358  ELLFCITPGPELSSGEQSSHLVISWRMNFLQSTMMKGMIENGARSALRETYEQFATFLSQ 417
            ELL+CITPGPEL SGE++SHLVISWRMNFLQSTM K MIENGAR+ L++++EQF+TFLSQ
Sbjct: 360  ELLYCITPGPELPSGEETSHLVISWRMNFLQSTMFKSMIENGARAGLKDSFEQFSTFLSQ 419

Query: 418  TITPVDSNDMGLNKEQILASLQPEPQSDWKLAVHYFANFTVVSSFFMGIYVLIHIWLATS 477
            T+ PVD  DMG +KEQ+LASL+ EPQSD KLAV YFANFTVVS+FFMG+YV +HIWLA  
Sbjct: 420  TVKPVDLKDMGSSKEQVLASLKAEPQSDRKLAVQYFANFTVVSAFFMGLYVFVHIWLAAP 479

Query: 478  TTIQGLEFVGLDLPDSIGEFIVCGVLVLQGERFLQLISRFMQARKQKGSDHGVKAQGDGW 537
            + IQGLEF+GLDLPDSIGE +VC VL LQ ER L L+SRFMQAR QKG+DHGVKAQGDGW
Sbjct: 480  SAIQGLEFLGLDLPDSIGEVLVCSVLALQCERVLGLLSRFMQARAQKGTDHGVKAQGDGW 539

Query: 538  LLTVALIKGDNLAAVDSSGFCDPYVVFTCNGKSRTSSIKFQQCDPMWNEIFEYDAMDEPP 597
            LLTVALI+G +L  VDSSGFCDPYVVFTCNGK++TSSIKFQ+ DP+WNEIFE+DAMD+PP
Sbjct: 540  LLTVALIEGSHLPTVDSSGFCDPYVVFTCNGKTKTSSIKFQKSDPLWNEIFEFDAMDDPP 599

Query: 598  SMLDVEVYDFDGPFNEATSLGHAEINFVKSDISDLADVWIPLQGKLAQACQSKLHLRIFL 657
            S+LDV+VYDFDGPF+EA SLGH EINFVKS++SDLADVW+PLQGKLAQACQSKLHLRIFL
Sbjct: 600  SVLDVDVYDFDGPFDEAMSLGHTEINFVKSNLSDLADVWVPLQGKLAQACQSKLHLRIFL 659

Query: 658  NNTKGSNVVKEYLTKMEKEVGKKINLRSPQTNSAFQKLFGLPPEEFLINDFTCHLKRKML 717
            NNT+GSNVVKEYL+KMEKEVGKKIN+RSPQTNSAFQK+FGLPPEEFLINDFTCHLKRKM 
Sbjct: 660  NNTRGSNVVKEYLSKMEKEVGKKINVRSPQTNSAFQKVFGLPPEEFLINDFTCHLKRKMP 719

Query: 718  LQGRLFLSARIIGFHANLFGHKTNFFFLWEDIEDIQVLPPSLSSMGSPVIVMTLRQGRGM 777
            LQGRLFLSARIIGF+ANLF  KT FFFLWEDIEDIQ+  P+LSSMGSPVIV+TLRQG+GM
Sbjct: 720  LQGRLFLSARIIGFYANLFRQKTKFFFLWEDIEDIQIYTPTLSSMGSPVIVITLRQGKGM 779

Query: 778  DARHGAKTQDEEGRLKFHFHSFVSYNVAH-RTIMALWKARSLSPEQKVQIVEE-SEAKSL 835
            DARHGAK  D+EGRLKFHF SFVS+NVAH RTIMALWKARSLS EQKVQIVEE SE K L
Sbjct: 780  DARHGAKNIDDEGRLKFHFQSFVSFNVAHSRTIMALWKARSLSLEQKVQIVEEDSETKIL 839

Query: 836  QSEEGGTFLGLEDVTMSEVYSSVLPVPMSFFMELFGGGELERAVMEKAGCVSYSCSSWES 895
            Q+EE G+FLGLEDV+MSEVY++   VP +F ME+FGGGEL+R VMEKAGC+SYS + WES
Sbjct: 840  QTEESGSFLGLEDVSMSEVYAASFSVPTNFVMEMFGGGELDRKVMEKAGCLSYSYTPWES 899

Query: 896  EKLDVYERQIYYRFDKCISRYRGEVTSTQQKSPLPNGNGWLVEEVMTLHGVPLGDYFNLH 955
             K DV+ERQIYYRFDK ISR+ GEVTSTQQK PL +  GWLVEEVMTLHGVPLGDYFNLH
Sbjct: 900  VKTDVHERQIYYRFDKRISRFGGEVTSTQQKYPLSDRKGWLVEEVMTLHGVPLGDYFNLH 959

Query: 956  LRYQVEDSPSRPKGCLAQVYLGVAWLKSTRHQKRITKNIVSNLEDRLRVKLSVIEKEFAA 1015
            LRYQVED PSR KGC  +V +G+ WLKSTRHQKRI+KNI+SNL+DRL+V  S++EKEF  
Sbjct: 960  LRYQVEDFPSRLKGCHVRVSIGIQWLKSTRHQKRISKNILSNLQDRLKVIFSLVEKEFVN 1019

Query: 1016 R 1016
            R
Sbjct: 1020 R 1020




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224089543|ref|XP_002308750.1| predicted protein [Populus trichocarpa] gi|222854726|gb|EEE92273.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359495634|ref|XP_002264782.2| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like [Vitis vinifera] gi|297736702|emb|CBI25738.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356532855|ref|XP_003534985.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like [Glycine max] Back     alignment and taxonomy information
>gi|297843150|ref|XP_002889456.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297335298|gb|EFH65715.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|334182268|ref|NP_171836.3| C2 calcium/lipid-binding and GRAM domain containing protein [Arabidopsis thaliana] gi|75315948|sp|Q9ZVT9.4|C2GR1_ARATH RecName: Full=C2 and GRAM domain-containing protein At1g03370 gi|15778696|gb|AAC72128.2| Contains similarity to gb|AB011110 KIAA0538 protein from Homo sapiens brain and to phospholipid-binding domain C2 PF|00168. ESTs gb|AA585988 and gb|T04384 come from this gene [Arabidopsis thaliana] gi|21539553|gb|AAM53329.1| unknown protein [Arabidopsis thaliana] gi|332189444|gb|AEE27565.1| C2 calcium/lipid-binding and GRAM domain containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357448113|ref|XP_003594332.1| Synaptotagmin-1 [Medicago truncatula] gi|355483380|gb|AES64583.1| Synaptotagmin-1 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356555781|ref|XP_003546208.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like [Glycine max] Back     alignment and taxonomy information
>gi|449443488|ref|XP_004139509.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356520120|ref|XP_003528713.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1016
UNIPROTKB|Q5Z6I41037 OSJNBa0055N24.36 "Putative Osn 0.878 0.861 0.590 0.0
UNIPROTKB|Q66VB01086 Os06g0607900 "Os06g0607900 pro 0.809 0.756 0.554 2.3e-291
TAIR|locus:21577071027 AT5G50170 "AT5G50170" [Arabido 0.988 0.977 0.458 1.6e-246
UNIPROTKB|Q69V64354 P0556B08.10 "C2 domain-contain 0.341 0.980 0.601 4.5e-114
TAIR|locus:2097578594 AT3G59660 "AT3G59660" [Arabido 0.304 0.520 0.277 1.2e-22
UNIPROTKB|F1NF56657 RASA4 "Uncharacterized protein 0.115 0.178 0.327 2.9e-19
UNIPROTKB|E1C578693 MCTP1 "Uncharacterized protein 0.127 0.187 0.316 7.8e-19
RGD|1305199946 Mctp1 "multiple C2 domains, tr 0.137 0.147 0.302 4.3e-18
UNIPROTKB|Q6DN14999 MCTP1 "Multiple C2 and transme 0.135 0.138 0.315 6.2e-18
ZFIN|ZDB-GENE-040718-165419 syt1a "synaptotagmin Ia" [Dani 0.117 0.284 0.364 8.5e-18
UNIPROTKB|Q5Z6I4 OSJNBa0055N24.36 "Putative Osnop" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
 Score = 2780 (983.7 bits), Expect = 0., Sum P(2) = 0.
 Identities = 537/910 (59%), Positives = 682/910 (74%)

Query:   119 ILLTISFSHNTSSADFNINSDPLDQL-KTTESPKRSF--SGPSNAPSPVRVEDTTSS-RE 174
             I L++++   T++    ++ D      K+TE  K S   + P   P+ V   D T   +E
Sbjct:   124 ISLSLNYPEETTTLAHCVSDDLASYSDKSTELQKGSSLPNIPIEIPTSVSGGDETEIIKE 183

Query:   175 EKSCAQKTLAGRIAQMFN---KNSD--------TASDRGVDFLELPETTKSELFDDKCVD 223
             ++S    +   R+ Q F+   K+++        T  D   D LE   +T SEL D++  +
Sbjct:   184 DRSNGVPSFVNRLYQFFSAKPKDAEASASAPPLTTGDGNSDILEETPSTSSELPDNQDYE 243

Query:   224 QSSSASFEEAMKTMEPRDLGSEVPSNLPGGVLVDQMYVIAPQDLNTLLFSPDSNFPRTWA 283
                + SF+E +K       G+E+P NL GGVL+DQ+Y +AP DLN LLFSP S+F ++ A
Sbjct:   244 TGVTMSFDEQLKAFGSCHEGNEIPENLSGGVLIDQVYAVAPSDLNGLLFSPSSDFLQSLA 303

Query:   284 EEQGNTELQIGPWRFENGCESLKRDVTYIKAANKLIKATKGFEEQTYLKADGKVFAILAS 343
             E QG T L+I  WR EN  E LKR V+Y KA   L+KA K  E+ +YLKADG ++A LA 
Sbjct:   304 EMQGTTGLEIQQWRLENDGEVLKRVVSYTKAPTALVKAVKATEDVSYLKADGDIYATLAD 363

Query:   344 VSTPEVMYGGSFKTELLFCITPGPELSSGEQSSHLVISWRMNFLQSTMMKGMIENGARSA 403
             VSTP+V +G SF+ E+L CI PGPEL   E+SS LV+SWR+NF+QSTMMKGMIENGA+  
Sbjct:   364 VSTPDVPFGNSFRVEVLTCIMPGPELPDNEKSSRLVVSWRLNFIQSTMMKGMIENGAKQG 423

Query:   404 LRETYEQFATFLSQTITPVDSNDMGLNKEQILASLQPEPQSDWKLAVHYFANFTVVSSFF 463
             L++ Y QF+  L++ I PVDS D     +++L+S+QPE +SDWKLA   F NFTVVSS  
Sbjct:   424 LKDNYIQFSELLARNIRPVDSKDAAAT-DKVLSSVQPEQESDWKLAFRIFGNFTVVSSLV 482

Query:   464 MGIYVLIHIWLATSTTIQGLEFVGLDLPDSIGEFIVCGVLVLQGERFLQLISRFMQARKQ 523
               IYV  HI LA+ + IQGLEF GLDLPDS+GE +VCGVLVLQG+R L +I+RF+QA++Q
Sbjct:   483 AFIYVFSHIILASPSIIQGLEFPGLDLPDSVGEVVVCGVLVLQGQRVLNMIARFIQAKRQ 542

Query:   524 KGSDHGVKAQGDGWLLTVALIKGDNLAAVDSSGFCDPYVVFTCNGKSRTSSIKFQQCDPM 583
             +GSDHGVKAQG+GWLLTVALI G NLAA  SSG+ DPYVVFTCNGK++TSSIKF   +P 
Sbjct:   543 RGSDHGVKAQGNGWLLTVALIDGTNLAATKSSGYSDPYVVFTCNGKTKTSSIKFHTLEPR 602

Query:   584 WNEIFEYDAMDEPPSMLDVEVYDFDGPFNEATSLGHAEINFVKSDISDLADVWIPLQGKL 643
             WNEIFE+DAM++PPS++ + VYDFDGPF+E  SLGHAE+NF+KS++S+L+D+WIPL+GKL
Sbjct:   603 WNEIFEFDAMEDPPSVMKINVYDFDGPFDEVESLGHAEVNFLKSNLSELSDIWIPLKGKL 662

Query:   644 AQACQSKLHLRIFLNNTKGSNVVKEYLTKMEKEVGKKINLRSPQTNSAFQKLFGLPPEEF 703
             AQACQSKLHLRI LNN++G+ V+K+YL KMEKEVGKKI +RSP TNSAFQK+F LPPEEF
Sbjct:   663 AQACQSKLHLRIILNNSRGTEVMKDYLDKMEKEVGKKIAVRSPHTNSAFQKIFSLPPEEF 722

Query:   704 LINDFTCHLKRKMLLQGRLFLSARIIGFHANLFGHKTNFFFLWEDIEDIQVLPPSLSSMG 763
             LINDFTCHLKRKML QGRLFLS RIIGF+ NLFGHKT FFFLWEDIEDIQV+P +L SMG
Sbjct:   723 LINDFTCHLKRKMLTQGRLFLSPRIIGFYTNLFGHKTKFFFLWEDIEDIQVMPATLYSMG 782

Query:   764 SPVIVMTLRQGRGMDARHGAKTQDEEGRLKFHFHSFVSYNVAHRTIMALWKARSLSPEQK 823
             SP +++ L +GRGMDARHGAK  D EGRLKFHF SFVS+NVAH+TIMALWKARSL+PEQK
Sbjct:   783 SPSLLIILHKGRGMDARHGAKQLDNEGRLKFHFQSFVSFNVAHKTIMALWKARSLTPEQK 842

Query:   824 VQIVEE-SEAKSLQSEEGGTFLGLEDVTMSEVYSSVLPVPMSFFMELFGGGELERAVMEK 882
             VQ+VEE SE K LQ+ E  +FLG+ED  MSEV+SS  P  +S  M +F GG LE  VMEK
Sbjct:   843 VQLVEEESEMKDLQNNESDSFLGIEDAKMSEVFSSTKPFDVSTLMSIFEGGPLEHQVMEK 902

Query:   883 AGCVSYSCSSWESEKLDVYERQIYYRFDKCISRYRGEVTSTQQKSPLPNGNGWLVEEVMT 942
              GC+ YS S WES + D Y+RQI+Y+FDK ++R+ GEV STQQKSPLP+ NGWLVEEVMT
Sbjct:   903 IGCMEYSVSPWESVRADAYQRQIHYKFDKRLARHEGEVMSTQQKSPLPDKNGWLVEEVMT 962

Query:   943 LHGVPLGDYFNLHLRYQVEDSPSRPKGCLAQVYLGVAWLKSTRHQKRITKNIVSNLEDRL 1002
             L G+P+G+YFNLH+RYQ+E   S+PK C  QV +G+AWLKS +++K+I + ++S+   RL
Sbjct:   963 LEGIPVGEYFNLHMRYQLEQISSKPKACNVQVSIGIAWLKSCKNRKKIAQEVLSSASSRL 1022

Query:  1003 RVKLSVIEKE 1012
             +    ++EKE
Sbjct:  1023 KKMFGLLEKE 1032


GO:0004842 "ubiquitin-protein ligase activity" evidence=IBA
GO:0005634 "nucleus" evidence=IBA
GO:0005737 "cytoplasm" evidence=IBA
GO:0042787 "protein ubiquitination involved in ubiquitin-dependent protein catabolic process" evidence=IBA
UNIPROTKB|Q66VB0 Os06g0607900 "Os06g0607900 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2157707 AT5G50170 "AT5G50170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q69V64 P0556B08.10 "C2 domain-containing protein-like" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2097578 AT3G59660 "AT3G59660" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1NF56 RASA4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1C578 MCTP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1305199 Mctp1 "multiple C2 domains, transmembrane 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6DN14 MCTP1 "Multiple C2 and transmembrane domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-165 syt1a "synaptotagmin Ia" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9ZVT9C2GR1_ARATHNo assigned EC number0.68850.99210.9882yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1016
cd13219161 cd13219, PH-GRAM_C2-GRAM, C2 and GRAM domain-conta 1e-109
cd00030102 cd00030, C2, C2 domain 6e-29
smart00239101 smart00239, C2, Protein kinase C conserved region 2e-25
pfam0016885 pfam00168, C2, C2 domain 2e-24
cd04026131 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein 1e-23
cd08376116 cd08376, C2B_MCTP_PRT, C2 domain second repeat fou 3e-21
cd08377119 cd08377, C2C_MCTP_PRT, C2 domain third repeat foun 4e-21
cd08682126 cd08682, C2_Rab11-FIP_classI, C2 domain found in R 1e-19
cd04042121 cd04042, C2A_MCTP_PRT, C2 domain first repeat foun 2e-19
cd04024128 cd04024, C2A_Synaptotagmin-like, C2 domain first r 1e-18
cd04019150 cd04019, C2C_MCTP_PRT_plant, C2 domain third repea 2e-18
cd08385124 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain 1e-17
cd00030102 cd00030, C2, C2 domain 2e-17
cd04040115 cd04040, C2D_Tricalbin-like, C2 domain fourth repe 2e-17
cd08386125 cd08386, C2A_Synaptotagmin-7, C2A domain first rep 5e-17
cd04009133 cd04009, C2B_Munc13-like, C2 domain second repeat 6e-17
cd04035123 cd04035, C2A_Rabphilin_Doc2, C2 domain first repea 1e-16
cd08688110 cd08688, C2_KIAA0528-like, C2 domain found in the 1e-16
cd04033133 cd04033, C2_NEDD4_NEDD4L, C2 domain present in the 1e-16
cd04038145 cd04038, C2_ArfGAP, C2 domain present in Arf GTPas 2e-16
cd08375136 cd08375, C2_Intersectin, C2 domain present in Inte 3e-16
cd08391121 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain fir 3e-16
cd08384133 cd08384, C2B_Rabphilin_Doc2, C2 domain second repe 4e-16
cd00276134 cd00276, C2B_Synaptotagmin, C2 domain second repea 7e-16
smart0056860 smart00568, GRAM, domain in glucosyltransferases, 2e-15
cd08402136 cd08402, C2B_Synaptotagmin-1, C2 domain second rep 3e-15
cd08388128 cd08388, C2A_Synaptotagmin-4-11, C2A domain first 3e-15
cd08675137 cd08675, C2B_RasGAP, C2 domain second repeat of Ra 4e-15
pfam0016885 pfam00168, C2, C2 domain 6e-15
smart00239101 smart00239, C2, Protein kinase C conserved region 8e-15
cd04025123 cd04025, C2B_RasA1_RasA4, C2 domain second repeat 5e-14
cd08405136 cd08405, C2B_Synaptotagmin-7, C2 domain second rep 5e-14
cd13220111 cd13220, PH-GRAM_GRAMDC, GRAM domain-containing pr 8e-14
cd04027127 cd04027, C2B_Munc13, C2 domain second repeat in Mu 3e-13
cd04030127 cd04030, C2C_KIAA1228, C2 domain third repeat pres 4e-13
cd04031125 cd04031, C2A_RIM1alpha, C2 domain first repeat con 5e-13
cd04025123 cd04025, C2B_RasA1_RasA4, C2 domain second repeat 6e-13
cd04022127 cd04022, C2A_MCTP_PRT_plant, C2 domain first repea 7e-13
cd04024128 cd04024, C2A_Synaptotagmin-like, C2 domain first r 1e-12
pfam0289360 pfam02893, GRAM, GRAM domain 1e-12
cd04017135 cd04017, C2D_Ferlin, C2 domain fourth repeat in Fe 1e-12
cd08387124 cd08387, C2A_Synaptotagmin-8, C2A domain first rep 1e-12
cd08681118 cd08681, C2_fungal_Inn1p-like, C2 domain found in 2e-12
cd08376116 cd08376, C2B_MCTP_PRT, C2 domain second repeat fou 4e-12
cd04040115 cd04040, C2D_Tricalbin-like, C2 domain fourth repe 4e-12
cd04054121 cd04054, C2A_Rasal1_RasA4, C2 domain first repeat 8e-12
cd04036119 cd04036, C2_cPLA2, C2 domain present in cytosolic 1e-11
cd04020162 cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat 1e-11
COG50381227 COG5038, COG5038, Ca2+-dependent lipid-binding pro 2e-11
cd04037124 cd04037, C2E_Ferlin, C2 domain fifth repeat in Fer 5e-11
cd00275128 cd00275, C2_PLC_like, C2 domain present in Phospho 5e-11
cd04050105 cd04050, C2B_Synaptotagmin-like, C2 domain second 9e-11
cd04011111 cd04011, C2B_Ferlin, C2 domain second repeat in Fe 1e-10
cd04010148 cd04010, C2B_RasA3, C2 domain second repeat presen 1e-10
cd08676153 cd08676, C2A_Munc13-like, C2 domain first repeat i 2e-10
cd04049124 cd04049, C2_putative_Elicitor-responsive_gene, C2 2e-10
cd04041111 cd04041, C2A_fungal, C2 domain first repeat; funga 2e-10
cd08378121 cd08378, C2B_MCTP_PRT_plant, C2 domain second repe 3e-10
cd04046126 cd04046, C2_Calpain, C2 domain present in Calpain 6e-10
cd08390123 cd08390, C2A_Synaptotagmin-15-17, C2A domain first 8e-10
cd08403134 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain s 8e-10
cd04038145 cd04038, C2_ArfGAP, C2 domain present in Arf GTPas 9e-10
cd08404136 cd08404, C2B_Synaptotagmin-4, C2 domain second rep 1e-09
cd04042121 cd04042, C2A_MCTP_PRT, C2 domain first repeat foun 2e-09
cd08384133 cd08384, C2B_Rabphilin_Doc2, C2 domain second repe 3e-09
cd04045120 cd04045, C2C_Tricalbin-like, C2 domain third repea 4e-09
cd08383117 cd08383, C2A_RasGAP, C2 domain (first repeat) of R 6e-09
cd08394127 cd08394, C2A_Munc13, C2 domain first repeat in Mun 1e-08
cd08410135 cd08410, C2B_Synaptotagmin-17, C2 domain second re 3e-08
cd08381122 cd08381, C2B_PI3K_class_II, C2 domain second repea 3e-08
cd04039108 cd04039, C2_PSD, C2 domain present in Phosphatidyl 4e-08
cd1057094 cd10570, PH-GRAM, Pleckstrin Homology-Glucosyltran 4e-08
cd04031125 cd04031, C2A_RIM1alpha, C2 domain first repeat con 5e-08
cd04043126 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (ma 5e-08
cd08382123 cd08382, C2_Smurf-like, C2 domain present in Smad 8e-08
cd08675137 cd08675, C2B_RasGAP, C2 domain second repeat of Ra 1e-07
cd13351125 cd13351, PH-GRAM1_TCB1D9_TCB1D9B, TBC1 domain fami 1e-07
cd00276134 cd00276, C2B_Synaptotagmin, C2 domain second repea 3e-07
cd08403134 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain s 4e-07
cd08391121 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain fir 5e-07
cd04030127 cd04030, C2C_KIAA1228, C2 domain third repeat pres 7e-07
cd08678126 cd08678, C2_C21orf25-like, C2 domain found in the 7e-07
cd08387124 cd08387, C2A_Synaptotagmin-8, C2A domain first rep 1e-06
cd04043126 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (ma 1e-06
cd08389124 cd08389, C2A_Synaptotagmin-14_16, C2A domain first 2e-06
cd08385124 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain 3e-06
cd08405136 cd08405, C2B_Synaptotagmin-7, C2 domain second rep 3e-06
cd04022127 cd04022, C2A_MCTP_PRT_plant, C2 domain first repea 3e-06
COG50381227 COG5038, COG5038, Ca2+-dependent lipid-binding pro 3e-06
cd08400126 cd08400, C2_Ras_p21A1, C2 domain present in RAS p2 3e-06
cd08373127 cd08373, C2A_Ferlin, C2 domain first repeat in Fer 4e-06
cd08377119 cd08377, C2C_MCTP_PRT, C2 domain third repeat foun 6e-06
cd04052111 cd04052, C2B_Tricalbin-like, C2 domain second repe 8e-06
cd04037124 cd04037, C2E_Ferlin, C2 domain fifth repeat in Fer 1e-05
cd04018151 cd04018, C2C_Ferlin, C2 domain third repeat in Fer 1e-05
cd04017135 cd04017, C2D_Ferlin, C2 domain fourth repeat in Fe 2e-05
cd08401121 cd08401, C2A_RasA2_RasA3, C2 domain first repeat p 2e-05
cd04015158 cd04015, C2_plant_PLD, C2 domain present in plant 3e-05
cd04047110 cd04047, C2B_Copine, C2 domain second repeat in Co 4e-05
cd08676153 cd08676, C2A_Munc13-like, C2 domain first repeat i 6e-05
cd08393125 cd08393, C2A_SLP-1_2, C2 domain first repeat prese 7e-05
cd04035123 cd04035, C2A_Rabphilin_Doc2, C2 domain first repea 8e-05
cd04009133 cd04009, C2B_Munc13-like, C2 domain second repeat 1e-04
cd04026131 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein 2e-04
cd04032127 cd04032, C2_Perforin, C2 domain of Perforin 2e-04
cd04016121 cd04016, C2_Tollip, C2 domain present in Toll-inte 2e-04
cd08409137 cd08409, C2B_Synaptotagmin-15, C2 domain second re 2e-04
COG50381227 COG5038, COG5038, Ca2+-dependent lipid-binding pro 3e-04
cd08404136 cd08404, C2B_Synaptotagmin-4, C2 domain second rep 3e-04
cd08402136 cd08402, C2B_Synaptotagmin-1, C2 domain second rep 4e-04
cd04036119 cd04036, C2_cPLA2, C2 domain present in cytosolic 5e-04
cd13216117 cd13216, PH-GRAM2_AGT26, Autophagy-related protein 5e-04
cd08521123 cd08521, C2A_SLP, C2 domain first repeat present i 8e-04
cd04049124 cd04049, C2_putative_Elicitor-responsive_gene, C2 0.001
cd08390123 cd08390, C2A_Synaptotagmin-15-17, C2A domain first 0.001
cd08373127 cd08373, C2A_Ferlin, C2 domain first repeat in Fer 0.001
cd13350135 cd13350, PH-GRAM1_TBC1D8B, TBC1 domain family memb 0.001
cd08685119 cd08685, C2_RGS-like, C2 domain of the Regulator O 0.001
cd04014132 cd04014, C2_PKC_epsilon, C2 domain in Protein Kina 0.002
cd04027127 cd04027, C2B_Munc13, C2 domain second repeat in Mu 0.003
cd08681118 cd08681, C2_fungal_Inn1p-like, C2 domain found in 0.003
cd04011111 cd04011, C2B_Ferlin, C2 domain second repeat in Fe 0.003
cd04046126 cd04046, C2_Calpain, C2 domain present in Calpain 0.003
cd04045120 cd04045, C2C_Tricalbin-like, C2 domain third repea 0.003
cd04044124 cd04044, C2A_Tricalbin-like, C2 domain first repea 0.003
>gnl|CDD|241373 cd13219, PH-GRAM_C2-GRAM, C2 and GRAM domain-containing protein Pleckstrin Homology-Glucosyltransferases, Rab-like GTPase activators and Myotubularins (PH-GRAM) domain Back     alignment and domain information
 Score =  335 bits (861), Expect = e-109
 Identities = 136/161 (84%), Positives = 145/161 (90%), Gaps = 1/161 (0%)

Query: 671 TKMEKEVGKKINLRSPQTNSAFQKLFGLPPEEFLINDFTCHLKRKMLLQGRLFLSARIIG 730
           +KMEKEVGKKINLRSPQ NSAFQKLFGLPPEEFLINDFTC LKRK  LQGRLFLSARIIG
Sbjct: 1   SKMEKEVGKKINLRSPQKNSAFQKLFGLPPEEFLINDFTCALKRKFPLQGRLFLSARIIG 60

Query: 731 FHANLFGHKTNFFFLWEDIEDIQVLPPSLSSMGSPVIVMTLRQGRGMDARHGAKTQDEEG 790
           F++NLFGHKT FFFLWEDIE+IQV PPSL S+GSP IV+ LR+GRG+DARHGAK QD EG
Sbjct: 61  FYSNLFGHKTKFFFLWEDIEEIQVSPPSL-SVGSPSIVIILRKGRGLDARHGAKPQDPEG 119

Query: 791 RLKFHFHSFVSYNVAHRTIMALWKARSLSPEQKVQIVEESE 831
           RLKFHF SFVS+N A RTIMALWK RSLSPEQK QIVEESE
Sbjct: 120 RLKFHFQSFVSFNHAFRTIMALWKNRSLSPEQKKQIVEESE 160


C2GRAM contains two N-terminal C2 domains followed by a single PH-GRAM domain. Since it contains both of these domains it is assumed that this gene cross-links both calcium and phosphoinositide signaling pathways. In general he C2 domain is involved in binding phospholipids in a calcium dependent manner or calcium independent manner. The GRAM domain is found in glucosyltransferases, myotubularins and other putative membrane-associated proteins. The GRAM domain is part of a larger motif with a pleckstrin homology (PH) domain fold. Length = 161

>gnl|CDD|175973 cd00030, C2, C2 domain Back     alignment and domain information
>gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>gnl|CDD|215765 pfam00168, C2, C2 domain Back     alignment and domain information
>gnl|CDD|175992 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>gnl|CDD|176022 cd08376, C2B_MCTP_PRT, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176023 cd08377, C2C_MCTP_PRT, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176064 cd08682, C2_Rab11-FIP_classI, C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>gnl|CDD|176007 cd04042, C2A_MCTP_PRT, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|175990 cd04024, C2A_Synaptotagmin-like, C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|175986 cd04019, C2C_MCTP_PRT_plant, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|176031 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>gnl|CDD|175973 cd00030, C2, C2 domain Back     alignment and domain information
>gnl|CDD|176005 cd04040, C2D_Tricalbin-like, C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176032 cd08386, C2A_Synaptotagmin-7, C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>gnl|CDD|175976 cd04009, C2B_Munc13-like, C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>gnl|CDD|176000 cd04035, C2A_Rabphilin_Doc2, C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>gnl|CDD|176070 cd08688, C2_KIAA0528-like, C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>gnl|CDD|175999 cd04033, C2_NEDD4_NEDD4L, C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>gnl|CDD|176003 cd04038, C2_ArfGAP, C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>gnl|CDD|176021 cd08375, C2_Intersectin, C2 domain present in Intersectin Back     alignment and domain information
>gnl|CDD|176037 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176030 cd08384, C2B_Rabphilin_Doc2, C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>gnl|CDD|175975 cd00276, C2B_Synaptotagmin, C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>gnl|CDD|214725 smart00568, GRAM, domain in glucosyltransferases, myotubularins and other putative membrane-associated proteins Back     alignment and domain information
>gnl|CDD|176047 cd08402, C2B_Synaptotagmin-1, C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>gnl|CDD|176034 cd08388, C2A_Synaptotagmin-4-11, C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>gnl|CDD|176057 cd08675, C2B_RasGAP, C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>gnl|CDD|215765 pfam00168, C2, C2 domain Back     alignment and domain information
>gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>gnl|CDD|175991 cd04025, C2B_RasA1_RasA4, C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>gnl|CDD|176050 cd08405, C2B_Synaptotagmin-7, C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>gnl|CDD|241374 cd13220, PH-GRAM_GRAMDC, GRAM domain-containing protein (GRAMDC) Pleckstrin Homology-Glucosyltransferases, Rab-like GTPase activators and Myotubularins (PH-GRAM) domain Back     alignment and domain information
>gnl|CDD|175993 cd04027, C2B_Munc13, C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>gnl|CDD|175996 cd04030, C2C_KIAA1228, C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>gnl|CDD|175997 cd04031, C2A_RIM1alpha, C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>gnl|CDD|175991 cd04025, C2B_RasA1_RasA4, C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>gnl|CDD|175989 cd04022, C2A_MCTP_PRT_plant, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|175990 cd04024, C2A_Synaptotagmin-like, C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|217271 pfam02893, GRAM, GRAM domain Back     alignment and domain information
>gnl|CDD|175984 cd04017, C2D_Ferlin, C2 domain fourth repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176033 cd08387, C2A_Synaptotagmin-8, C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>gnl|CDD|176063 cd08681, C2_fungal_Inn1p-like, C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>gnl|CDD|176022 cd08376, C2B_MCTP_PRT, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176005 cd04040, C2D_Tricalbin-like, C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176018 cd04054, C2A_Rasal1_RasA4, C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>gnl|CDD|176001 cd04036, C2_cPLA2, C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>gnl|CDD|175987 cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|176002 cd04037, C2E_Ferlin, C2 domain fifth repeat in Ferlin Back     alignment and domain information
>gnl|CDD|175974 cd00275, C2_PLC_like, C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>gnl|CDD|176015 cd04050, C2B_Synaptotagmin-like, C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|175978 cd04011, C2B_Ferlin, C2 domain second repeat in Ferlin Back     alignment and domain information
>gnl|CDD|175977 cd04010, C2B_RasA3, C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) Back     alignment and domain information
>gnl|CDD|176058 cd08676, C2A_Munc13-like, C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>gnl|CDD|176014 cd04049, C2_putative_Elicitor-responsive_gene, C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>gnl|CDD|176006 cd04041, C2A_fungal, C2 domain first repeat; fungal group Back     alignment and domain information
>gnl|CDD|176024 cd08378, C2B_MCTP_PRT_plant, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|176011 cd04046, C2_Calpain, C2 domain present in Calpain proteins Back     alignment and domain information
>gnl|CDD|176036 cd08390, C2A_Synaptotagmin-15-17, C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>gnl|CDD|176048 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>gnl|CDD|176003 cd04038, C2_ArfGAP, C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>gnl|CDD|176049 cd08404, C2B_Synaptotagmin-4, C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>gnl|CDD|176007 cd04042, C2A_MCTP_PRT, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176030 cd08384, C2B_Rabphilin_Doc2, C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>gnl|CDD|176010 cd04045, C2C_Tricalbin-like, C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176029 cd08383, C2A_RasGAP, C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>gnl|CDD|176040 cd08394, C2A_Munc13, C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>gnl|CDD|176055 cd08410, C2B_Synaptotagmin-17, C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>gnl|CDD|176027 cd08381, C2B_PI3K_class_II, C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>gnl|CDD|176004 cd04039, C2_PSD, C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>gnl|CDD|241306 cd10570, PH-GRAM, Pleckstrin Homology-Glucosyltransferases, Rab-like GTPase activators and Myotubularins (PH-GRAM) domain Back     alignment and domain information
>gnl|CDD|175997 cd04031, C2A_RIM1alpha, C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>gnl|CDD|176008 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>gnl|CDD|176028 cd08382, C2_Smurf-like, C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>gnl|CDD|176057 cd08675, C2B_RasGAP, C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>gnl|CDD|241505 cd13351, PH-GRAM1_TCB1D9_TCB1D9B, TBC1 domain family members 9 and 9B (TBC1D9 and TBC1D9B) Pleckstrin Homology-Glucosyltransferases, Rab-like GTPase activators and Myotubularins (PH-GRAM) domain, repeat 1 Back     alignment and domain information
>gnl|CDD|175975 cd00276, C2B_Synaptotagmin, C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>gnl|CDD|176048 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>gnl|CDD|176037 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|175996 cd04030, C2C_KIAA1228, C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>gnl|CDD|176060 cd08678, C2_C21orf25-like, C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>gnl|CDD|176033 cd08387, C2A_Synaptotagmin-8, C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>gnl|CDD|176008 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>gnl|CDD|176035 cd08389, C2A_Synaptotagmin-14_16, C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>gnl|CDD|176031 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>gnl|CDD|176050 cd08405, C2B_Synaptotagmin-7, C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>gnl|CDD|175989 cd04022, C2A_MCTP_PRT_plant, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|176045 cd08400, C2_Ras_p21A1, C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>gnl|CDD|176019 cd08373, C2A_Ferlin, C2 domain first repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176023 cd08377, C2C_MCTP_PRT, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176017 cd04052, C2B_Tricalbin-like, C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176002 cd04037, C2E_Ferlin, C2 domain fifth repeat in Ferlin Back     alignment and domain information
>gnl|CDD|175985 cd04018, C2C_Ferlin, C2 domain third repeat in Ferlin Back     alignment and domain information
>gnl|CDD|175984 cd04017, C2D_Ferlin, C2 domain fourth repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176046 cd08401, C2A_RasA2_RasA3, C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>gnl|CDD|175982 cd04015, C2_plant_PLD, C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>gnl|CDD|176012 cd04047, C2B_Copine, C2 domain second repeat in Copine Back     alignment and domain information
>gnl|CDD|176058 cd08676, C2A_Munc13-like, C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>gnl|CDD|176039 cd08393, C2A_SLP-1_2, C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>gnl|CDD|176000 cd04035, C2A_Rabphilin_Doc2, C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>gnl|CDD|175976 cd04009, C2B_Munc13-like, C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>gnl|CDD|175992 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>gnl|CDD|175998 cd04032, C2_Perforin, C2 domain of Perforin Back     alignment and domain information
>gnl|CDD|175983 cd04016, C2_Tollip, C2 domain present in Toll-interacting protein (Tollip) Back     alignment and domain information
>gnl|CDD|176054 cd08409, C2B_Synaptotagmin-15, C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|176049 cd08404, C2B_Synaptotagmin-4, C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>gnl|CDD|176047 cd08402, C2B_Synaptotagmin-1, C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>gnl|CDD|176001 cd04036, C2_cPLA2, C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>gnl|CDD|241370 cd13216, PH-GRAM2_AGT26, Autophagy-related protein 26/Sterol 3-beta-glucosyltransferase Pleckstrin homology (PH) domain, repeat 2 Back     alignment and domain information
>gnl|CDD|176056 cd08521, C2A_SLP, C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176014 cd04049, C2_putative_Elicitor-responsive_gene, C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>gnl|CDD|176036 cd08390, C2A_Synaptotagmin-15-17, C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>gnl|CDD|176019 cd08373, C2A_Ferlin, C2 domain first repeat in Ferlin Back     alignment and domain information
>gnl|CDD|241504 cd13350, PH-GRAM1_TBC1D8B, TBC1 domain family member 8B (TBC1D8B) Pleckstrin Homology-Glucosyltransferases, Rab-like GTPase activators and Myotubularins (PH-GRAM) domain, repeat 1 Back     alignment and domain information
>gnl|CDD|176067 cd08685, C2_RGS-like, C2 domain of the Regulator Of G-Protein Signaling (RGS) family Back     alignment and domain information
>gnl|CDD|175981 cd04014, C2_PKC_epsilon, C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>gnl|CDD|175993 cd04027, C2B_Munc13, C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>gnl|CDD|176063 cd08681, C2_fungal_Inn1p-like, C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>gnl|CDD|175978 cd04011, C2B_Ferlin, C2 domain second repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176011 cd04046, C2_Calpain, C2 domain present in Calpain proteins Back     alignment and domain information
>gnl|CDD|176010 cd04045, C2C_Tricalbin-like, C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176009 cd04044, C2A_Tricalbin-like, C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1016
KOG1032 590 consensus Uncharacterized conserved protein, conta 99.96
KOG1032590 consensus Uncharacterized conserved protein, conta 99.93
KOG1028421 consensus Ca2+-dependent phospholipid-binding prot 99.89
cd04016121 C2_Tollip C2 domain present in Toll-interacting pr 99.86
COG50381227 Ca2+-dependent lipid-binding protein, contains C2 99.84
cd04016121 C2_Tollip C2 domain present in Toll-interacting pr 99.83
cd08682126 C2_Rab11-FIP_classI C2 domain found in Rab11-famil 99.82
cd08682126 C2_Rab11-FIP_classI C2 domain found in Rab11-famil 99.81
cd04019150 C2C_MCTP_PRT_plant C2 domain third repeat found in 99.8
cd08376116 C2B_MCTP_PRT C2 domain second repeat found in Mult 99.8
cd04042121 C2A_MCTP_PRT C2 domain first repeat found in Multi 99.8
cd08379126 C2D_MCTP_PRT_plant C2 domain fourth repeat found i 99.79
cd04022127 C2A_MCTP_PRT_plant C2 domain first repeat found in 99.78
cd08681118 C2_fungal_Inn1p-like C2 domain found in fungal Ing 99.78
cd04019150 C2C_MCTP_PRT_plant C2 domain third repeat found in 99.78
cd04022127 C2A_MCTP_PRT_plant C2 domain first repeat found in 99.78
cd04042121 C2A_MCTP_PRT C2 domain first repeat found in Multi 99.78
cd04036119 C2_cPLA2 C2 domain present in cytosolic PhosphoLip 99.78
cd08379126 C2D_MCTP_PRT_plant C2 domain fourth repeat found i 99.77
cd08395120 C2C_Munc13 C2 domain third repeat in Munc13 (mamma 99.77
cd04024128 C2A_Synaptotagmin-like C2 domain first repeat pres 99.77
cd08375136 C2_Intersectin C2 domain present in Intersectin. A 99.76
cd08391121 C2A_C2C_Synaptotagmin_like C2 domain first and thi 99.76
cd08401121 C2A_RasA2_RasA3 C2 domain first repeat present in 99.76
cd04024128 C2A_Synaptotagmin-like C2 domain first repeat pres 99.76
cd08401121 C2A_RasA2_RasA3 C2 domain first repeat present in 99.76
cd08378121 C2B_MCTP_PRT_plant C2 domain second repeat found i 99.75
KOG1030168 consensus Predicted Ca2+-dependent phospholipid-bi 99.75
cd08378121 C2B_MCTP_PRT_plant C2 domain second repeat found i 99.75
cd04025123 C2B_RasA1_RasA4 C2 domain second repeat present in 99.74
cd04033133 C2_NEDD4_NEDD4L C2 domain present in the Human neu 99.74
cd08400126 C2_Ras_p21A1 C2 domain present in RAS p21 protein 99.74
cd08678126 C2_C21orf25-like C2 domain found in the Human chro 99.74
cd04015158 C2_plant_PLD C2 domain present in plant phospholip 99.74
cd04017135 C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl 99.74
cd08681118 C2_fungal_Inn1p-like C2 domain found in fungal Ing 99.74
cd08678126 C2_C21orf25-like C2 domain found in the Human chro 99.74
KOG2059800 consensus Ras GTPase-activating protein [Signal tr 99.74
cd04025123 C2B_RasA1_RasA4 C2 domain second repeat present in 99.73
cd04046126 C2_Calpain C2 domain present in Calpain proteins. 99.73
cd08376116 C2B_MCTP_PRT C2 domain second repeat found in Mult 99.73
KOG1030168 consensus Predicted Ca2+-dependent phospholipid-bi 99.73
cd08381122 C2B_PI3K_class_II C2 domain second repeat present 99.73
cd04054121 C2A_Rasal1_RasA4 C2 domain first repeat present in 99.73
cd08375136 C2_Intersectin C2 domain present in Intersectin. A 99.72
cd04010148 C2B_RasA3 C2 domain second repeat present in RAS p 99.72
cd08377119 C2C_MCTP_PRT C2 domain third repeat found in Multi 99.72
cd04033133 C2_NEDD4_NEDD4L C2 domain present in the Human neu 99.72
cd08377119 C2C_MCTP_PRT C2 domain third repeat found in Multi 99.72
cd04010148 C2B_RasA3 C2 domain second repeat present in RAS p 99.72
cd04043126 C2_Munc13_fungal C2 domain in Munc13 (mammalian un 99.72
cd08677118 C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a 99.71
cd04050105 C2B_Synaptotagmin-like C2 domain second repeat pre 99.71
cd04028146 C2B_RIM1alpha C2 domain second repeat contained in 99.71
cd04014132 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) 99.71
cd04054121 C2A_Rasal1_RasA4 C2 domain first repeat present in 99.71
cd04027127 C2B_Munc13 C2 domain second repeat in Munc13 (mamm 99.71
cd08394127 C2A_Munc13 C2 domain first repeat in Munc13 (mamma 99.7
cd08381122 C2B_PI3K_class_II C2 domain second repeat present 99.7
cd08395120 C2C_Munc13 C2 domain third repeat in Munc13 (mamma 99.7
cd08400126 C2_Ras_p21A1 C2 domain present in RAS p21 protein 99.7
cd04027127 C2B_Munc13 C2 domain second repeat in Munc13 (mamm 99.7
cd08382123 C2_Smurf-like C2 domain present in Smad ubiquitina 99.7
cd04017135 C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl 99.7
cd08373127 C2A_Ferlin C2 domain first repeat in Ferlin. Ferli 99.69
cd04015158 C2_plant_PLD C2 domain present in plant phospholip 99.69
cd04046126 C2_Calpain C2 domain present in Calpain proteins. 99.69
cd08688110 C2_KIAA0528-like C2 domain found in the Human KIAA 99.69
cd08677118 C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a 99.69
cd08392128 C2A_SLP-3 C2 domain first repeat present in Synapt 99.69
cd04028146 C2B_RIM1alpha C2 domain second repeat contained in 99.69
cd04036119 C2_cPLA2 C2 domain present in cytosolic PhosphoLip 99.69
cd04029125 C2A_SLP-4_5 C2 domain first repeat present in Syna 99.68
cd08688110 C2_KIAA0528-like C2 domain found in the Human KIAA 99.68
cd08393125 C2A_SLP-1_2 C2 domain first repeat present in Syna 99.68
cd04050105 C2B_Synaptotagmin-like C2 domain second repeat pre 99.68
cd08385124 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe 99.67
cd04041111 C2A_fungal C2 domain first repeat; fungal group. C 99.67
cd08387124 C2A_Synaptotagmin-8 C2A domain first repeat presen 99.67
cd04039108 C2_PSD C2 domain present in Phosphatidylserine dec 99.67
cd04018151 C2C_Ferlin C2 domain third repeat in Ferlin. Ferli 99.67
cd08382123 C2_Smurf-like C2 domain present in Smad ubiquitina 99.67
cd08393125 C2A_SLP-1_2 C2 domain first repeat present in Syna 99.67
cd08392128 C2A_SLP-3 C2 domain first repeat present in Synapt 99.66
cd04040115 C2D_Tricalbin-like C2 domain fourth repeat present 99.66
cd04031125 C2A_RIM1alpha C2 domain first repeat contained in 99.66
cd08685119 C2_RGS-like C2 domain of the Regulator Of G-Protei 99.66
cd08391121 C2A_C2C_Synaptotagmin_like C2 domain first and thi 99.66
cd04018151 C2C_Ferlin C2 domain third repeat in Ferlin. Ferli 99.65
cd08394127 C2A_Munc13 C2 domain first repeat in Munc13 (mamma 99.65
cd08373127 C2A_Ferlin C2 domain first repeat in Ferlin. Ferli 99.65
cd04043126 C2_Munc13_fungal C2 domain in Munc13 (mammalian un 99.65
cd08386125 C2A_Synaptotagmin-7 C2A domain first repeat presen 99.65
cd04011111 C2B_Ferlin C2 domain second repeat in Ferlin. Ferl 99.65
cd04044124 C2A_Tricalbin-like C2 domain first repeat present 99.65
cd04029125 C2A_SLP-4_5 C2 domain first repeat present in Syna 99.64
cd04030127 C2C_KIAA1228 C2 domain third repeat present in unc 99.64
cd04051125 C2_SRC2_like C2 domain present in Soybean genes Re 99.64
cd08388128 C2A_Synaptotagmin-4-11 C2A domain first repeat pre 99.63
cd04014132 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) 99.63
cd04044124 C2A_Tricalbin-like C2 domain first repeat present 99.63
cd04051125 C2_SRC2_like C2 domain present in Soybean genes Re 99.63
cd08690155 C2_Freud-1 C2 domain found in 5' repressor element 99.63
KOG0696683 consensus Serine/threonine protein kinase [Signal 99.63
cd08685119 C2_RGS-like C2 domain of the Regulator Of G-Protei 99.62
cd04011111 C2B_Ferlin C2 domain second repeat in Ferlin. Ferl 99.62
cd08680124 C2_Kibra C2 domain found in Human protein Kibra. K 99.62
cd04049124 C2_putative_Elicitor-responsive_gene C2 domain pre 99.62
cd04031125 C2A_RIM1alpha C2 domain first repeat contained in 99.62
cd04020162 C2B_SLP_1-2-3-4 C2 domain second repeat present in 99.62
cd08680124 C2_Kibra C2 domain found in Human protein Kibra. K 99.62
cd08691137 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li 99.62
cd04039108 C2_PSD C2 domain present in Phosphatidylserine dec 99.62
cd04041111 C2A_fungal C2 domain first repeat; fungal group. C 99.62
cd08521123 C2A_SLP C2 domain first repeat present in Synaptot 99.62
cd08387124 C2A_Synaptotagmin-8 C2A domain first repeat presen 99.61
cd08388128 C2A_Synaptotagmin-4-11 C2A domain first repeat pre 99.61
cd08386125 C2A_Synaptotagmin-7 C2A domain first repeat presen 99.61
cd08390123 C2A_Synaptotagmin-15-17 C2A domain first repeat pr 99.61
cd04045120 C2C_Tricalbin-like C2 domain third repeat present 99.61
cd08385124 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe 99.61
cd08676153 C2A_Munc13-like C2 domain first repeat in Munc13 ( 99.61
cd08675137 C2B_RasGAP C2 domain second repeat of Ras GTPase a 99.6
cd08389124 C2A_Synaptotagmin-14_16 C2A domain first repeat pr 99.6
cd04038145 C2_ArfGAP C2 domain present in Arf GTPase Activati 99.6
cd08389124 C2A_Synaptotagmin-14_16 C2A domain first repeat pr 99.6
cd04032127 C2_Perforin C2 domain of Perforin. Perforin contai 99.59
cd04013146 C2_SynGAP_like C2 domain present in Ras GTPase act 99.59
cd04030127 C2C_KIAA1228 C2 domain third repeat present in unc 99.59
cd04013146 C2_SynGAP_like C2 domain present in Ras GTPase act 99.58
cd08691137 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li 99.58
cd04037124 C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli 99.57
cd04049124 C2_putative_Elicitor-responsive_gene C2 domain pre 99.57
KOG0696683 consensus Serine/threonine protein kinase [Signal 99.57
cd08521123 C2A_SLP C2 domain first repeat present in Synaptot 99.57
cd04021125 C2_E3_ubiquitin_ligase C2 domain present in E3 ubi 99.57
cd08690155 C2_Freud-1 C2 domain found in 5' repressor element 99.57
cd04045120 C2C_Tricalbin-like C2 domain third repeat present 99.56
cd08383117 C2A_RasGAP C2 domain (first repeat) of Ras GTPase 99.56
cd04009133 C2B_Munc13-like C2 domain second repeat in Munc13 99.56
cd04038145 C2_ArfGAP C2 domain present in Arf GTPase Activati 99.56
cd08675137 C2B_RasGAP C2 domain second repeat of Ras GTPase a 99.56
cd04021125 C2_E3_ubiquitin_ligase C2 domain present in E3 ubi 99.56
cd04052111 C2B_Tricalbin-like C2 domain second repeat present 99.55
cd08384133 C2B_Rabphilin_Doc2 C2 domain second repeat present 99.55
cd08406136 C2B_Synaptotagmin-12 C2 domain second repeat prese 99.55
cd08390123 C2A_Synaptotagmin-15-17 C2A domain first repeat pr 99.55
cd08383117 C2A_RasGAP C2 domain (first repeat) of Ras GTPase 99.54
cd04032127 C2_Perforin C2 domain of Perforin. Perforin contai 99.54
cd00275128 C2_PLC_like C2 domain present in Phosphoinositide- 99.54
cd04026131 C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( 99.53
cd04020162 C2B_SLP_1-2-3-4 C2 domain second repeat present in 99.53
cd04040115 C2D_Tricalbin-like C2 domain fourth repeat present 99.53
cd08404136 C2B_Synaptotagmin-4 C2 domain second repeat presen 99.53
PLN03008 868 Phospholipase D delta 99.53
cd08407138 C2B_Synaptotagmin-13 C2 domain second repeat prese 99.53
cd00275128 C2_PLC_like C2 domain present in Phosphoinositide- 99.53
cd04048120 C2A_Copine C2 domain first repeat in Copine. There 99.53
cd08676153 C2A_Munc13-like C2 domain first repeat in Munc13 ( 99.52
cd08406136 C2B_Synaptotagmin-12 C2 domain second repeat prese 99.52
cd04009133 C2B_Munc13-like C2 domain second repeat in Munc13 99.52
cd08405136 C2B_Synaptotagmin-7 C2 domain second repeat presen 99.51
cd04037124 C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli 99.51
cd08402136 C2B_Synaptotagmin-1 C2 domain second repeat presen 99.51
cd08407138 C2B_Synaptotagmin-13 C2 domain second repeat prese 99.5
cd08410135 C2B_Synaptotagmin-17 C2 domain second repeat prese 99.5
cd08404136 C2B_Synaptotagmin-4 C2 domain second repeat presen 99.5
cd08384133 C2B_Rabphilin_Doc2 C2 domain second repeat present 99.5
cd08692135 C2B_Tac2-N C2 domain second repeat found in Tac2-N 99.49
cd04026131 C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( 99.49
cd08402136 C2B_Synaptotagmin-1 C2 domain second repeat presen 99.48
KOG1011 1283 consensus Neurotransmitter release regulator, UNC- 99.48
PLN03008868 Phospholipase D delta 99.48
cd08686118 C2_ABR C2 domain in the Active BCR (Breakpoint clu 99.48
cd08403134 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe 99.48
cd04035123 C2A_Rabphilin_Doc2 C2 domain first repeat present 99.47
cd04052111 C2B_Tricalbin-like C2 domain second repeat present 99.47
cd08408138 C2B_Synaptotagmin-14_16 C2 domain second repeat pr 99.47
cd08405136 C2B_Synaptotagmin-7 C2 domain second repeat presen 99.47
cd08408138 C2B_Synaptotagmin-14_16 C2 domain second repeat pr 99.46
PF0289369 GRAM: GRAM domain; InterPro: IPR004182 The GRAM do 99.46
cd04048120 C2A_Copine C2 domain first repeat in Copine. There 99.46
cd00276134 C2B_Synaptotagmin C2 domain second repeat present 99.46
PLN032002102 cellulose synthase-interactive protein; Provisiona 99.45
cd08692135 C2B_Tac2-N C2 domain second repeat found in Tac2-N 99.45
cd08410135 C2B_Synaptotagmin-17 C2 domain second repeat prese 99.43
cd08403134 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe 99.43
KOG1028421 consensus Ca2+-dependent phospholipid-binding prot 99.43
KOG10111283 consensus Neurotransmitter release regulator, UNC- 99.43
cd08409137 C2B_Synaptotagmin-15 C2 domain second repeat prese 99.43
cd08409137 C2B_Synaptotagmin-15 C2 domain second repeat prese 99.42
cd00276134 C2B_Synaptotagmin C2 domain second repeat present 99.41
cd08686118 C2_ABR C2 domain in the Active BCR (Breakpoint clu 99.4
cd04035123 C2A_Rabphilin_Doc2 C2 domain first repeat present 99.39
KOG13261105 consensus Membrane-associated protein FER-1 and re 99.38
cd04047110 C2B_Copine C2 domain second repeat in Copine. Ther 99.37
cd04047110 C2B_Copine C2 domain second repeat in Copine. Ther 99.35
PF0016885 C2: C2 domain; InterPro: IPR000008 The C2 domain i 99.35
smart0056861 GRAM domain in glucosyltransferases, myotubularins 99.31
PLN032002102 cellulose synthase-interactive protein; Provisiona 99.3
PF0016885 C2: C2 domain; InterPro: IPR000008 The C2 domain i 99.28
KOG2059 800 consensus Ras GTPase-activating protein [Signal tr 99.21
PLN02223537 phosphoinositide phospholipase C 99.19
cd00030102 C2 C2 domain. The C2 domain was first identified i 99.18
smart00239101 C2 Protein kinase C conserved region 2 (CalB). Ca2 99.1
cd00030102 C2 C2 domain. The C2 domain was first identified i 99.08
PLN02223537 phosphoinositide phospholipase C 99.06
smart00239101 C2 Protein kinase C conserved region 2 (CalB). Ca2 99.04
KOG1328 1103 consensus Synaptic vesicle protein BAIAP3, involve 99.03
PLN02952599 phosphoinositide phospholipase C 99.03
PLN02270 808 phospholipase D alpha 99.02
cd08374133 C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli 99.0
cd08374133 C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli 99.0
PLN02230598 phosphoinositide phospholipase C 4 98.98
PLN02952599 phosphoinositide phospholipase C 98.98
COG5038 1227 Ca2+-dependent lipid-binding protein, contains C2 98.98
KOG0169746 consensus Phosphoinositide-specific phospholipase 98.96
PLN02270808 phospholipase D alpha 98.92
PLN02230598 phosphoinositide phospholipase C 4 98.9
PLN02222581 phosphoinositide phospholipase C 2 98.88
PLN02222581 phosphoinositide phospholipase C 2 98.86
PLN02228567 Phosphoinositide phospholipase C 98.84
PLN02228567 Phosphoinositide phospholipase C 98.83
KOG0169746 consensus Phosphoinositide-specific phospholipase 98.8
KOG1031 1169 consensus Predicted Ca2+-dependent phospholipid-bi 98.79
KOG12641267 consensus Phospholipase C [Lipid transport and met 98.76
KOG13281103 consensus Synaptic vesicle protein BAIAP3, involve 98.73
KOG12641267 consensus Phospholipase C [Lipid transport and met 98.69
cd08689109 C2_fungal_Pkc1p C2 domain found in protein kinase 98.69
KOG1031 1169 consensus Predicted Ca2+-dependent phospholipid-bi 98.66
cd08689109 C2_fungal_Pkc1p C2 domain found in protein kinase 98.65
KOG1013362 consensus Synaptic vesicle protein rabphilin-3A [I 98.53
PLN02352 758 phospholipase D epsilon 98.4
PLN02352758 phospholipase D epsilon 98.19
KOG13261105 consensus Membrane-associated protein FER-1 and re 97.93
KOG09051639 consensus Phosphoinositide 3-kinase [Signal transd 97.78
PLN02964 644 phosphatidylserine decarboxylase 97.69
KOG1013362 consensus Synaptic vesicle protein rabphilin-3A [I 97.68
KOG09051639 consensus Phosphoinositide 3-kinase [Signal transd 97.63
KOG4347 671 consensus GTPase-activating protein VRP [General f 97.24
KOG2060405 consensus Rab3 effector RIM1 and related proteins, 97.08
cd08683143 C2_C2cd3 C2 domain found in C2 calcium-dependent d 97.07
cd08683143 C2_C2cd3 C2 domain found in C2 calcium-dependent d 97.02
PLN02964644 phosphatidylserine decarboxylase 96.91
KOG1327529 consensus Copine [Signal transduction mechanisms] 96.9
KOG2060405 consensus Rab3 effector RIM1 and related proteins, 96.71
KOG1327529 consensus Copine [Signal transduction mechanisms] 96.57
KOG3837523 consensus Uncharacterized conserved protein, conta 96.41
KOG3837523 consensus Uncharacterized conserved protein, conta 96.23
cd08684103 C2A_Tac2-N C2 domain first repeat found in Tac2-N 95.93
PF12416340 DUF3668: Cep120 protein; InterPro: IPR022136 This 95.86
PF15627156 CEP76-C2: CEP76 C2 domain 95.75
PF12416340 DUF3668: Cep120 protein; InterPro: IPR022136 This 95.6
cd08684103 C2A_Tac2-N C2 domain first repeat found in Tac2-N 95.56
PF15627156 CEP76-C2: CEP76 C2 domain 95.53
KOG12651189 consensus Phospholipase C [Lipid transport and met 95.49
cd08398158 C2_PI3K_class_I_alpha C2 domain present in class I 95.01
cd08693173 C2_PI3K_class_I_beta_delta C2 domain present in cl 94.88
cd08380156 C2_PI3K_like C2 domain present in phosphatidylinos 93.95
PF1447096 bPH_3: Bacterial PH domain 93.79
cd08693173 C2_PI3K_class_I_beta_delta C2 domain present in cl 93.7
cd08398158 C2_PI3K_class_I_alpha C2 domain present in class I 93.64
KOG12651189 consensus Phospholipase C [Lipid transport and met 93.22
PF10358143 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; 93.04
cd08397159 C2_PI3K_class_III C2 domain present in class III p 92.89
PF10698159 DUF2505: Protein of unknown function (DUF2505); In 92.61
cd04012171 C2A_PI3K_class_II C2 domain first repeat present i 92.29
PF10358143 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; 92.25
KOG1452442 consensus Predicted Rho GTPase-activating protein 91.79
cd08380156 C2_PI3K_like C2 domain present in phosphatidylinos 91.65
cd0868798 C2_PKN-like C2 domain in Protein kinase C-like (PK 89.66
cd0868798 C2_PKN-like C2 domain in Protein kinase C-like (PK 89.36
PF14844106 PH_BEACH: PH domain associated with Beige/BEACH; P 89.03
cd04012171 C2A_PI3K_class_II C2 domain first repeat present i 88.89
cd08397159 C2_PI3K_class_III C2 domain present in class III p 88.05
PF00792142 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: I 87.27
cd08399178 C2_PI3K_class_I_gamma C2 domain present in class I 86.81
smart00142100 PI3K_C2 Phosphoinositide 3-kinase, region postulat 86.06
PF10698159 DUF2505: Protein of unknown function (DUF2505); In 84.34
PF1160589 Vps36_ESCRT-II: Vacuolar protein sorting protein 3 84.24
cd08399178 C2_PI3K_class_I_gamma C2 domain present in class I 83.57
>KOG1032 consensus Uncharacterized conserved protein, contains GRAM domain [Function unknown] Back     alignment and domain information
Probab=99.96  E-value=1e-29  Score=298.25  Aligned_cols=288  Identities=22%  Similarity=0.310  Sum_probs=212.7

Q ss_pred             CCcccccccceeceeeeeccccceeeeeccEEEEeeccCCceEEEEEecccceEEEEcCCcccCCCCCeEEEEEeecCCC
Q 001766          698 LPPEEFLINDFTCHLKRKMLLQGRLFLSARIIGFHANLFGHKTNFFFLWEDIEDIQVLPPSLSSMGSPVIVMTLRQGRGM  777 (1016)
Q Consensus       698 l~~~E~l~~~~~c~~~~~~~~~Grlyis~~~~cF~s~~~g~~t~~~i~~~dI~~i~k~~~~~~~~~~~~~~i~l~~~~~~  777 (1016)
                      +|+++.|+.+|+|+++|.|.+|||||++..||||||++|||.|+.+||+++|.-|+|+.++.                  
T Consensus       117 ~~~~~~l~~~~~cal~reillQGrmyis~~~icF~s~i~gw~~~~vIpf~eI~~ikk~~tag------------------  178 (590)
T KOG1032|consen  117 VPDPEILLTDYSCALQREILLQGRMYISEEHICFNSNIFGWETKVVIPFDEITLIKKTKTAG------------------  178 (590)
T ss_pred             CCCcceeeeecchhhccccccccccccccceeeecccccCccceeEEeeeeeeeeehhhhcc------------------
Confidence            88999999999999999999999999999999999999999999999999999999999543                  


Q ss_pred             CCCCCceeeccCCceEEEeccCcCHHHHHHHHHHHHHhc---CCCchhhccccc--cccc-cc------cCCCC--CCCC
Q 001766          778 DARHGAKTQDEEGRLKFHFHSFVSYNVAHRTIMALWKAR---SLSPEQKVQIVE--ESEA-KS------LQSEE--GGTF  843 (1016)
Q Consensus       778 ~~~~~~~~~~~~~~~~~~f~sf~~rd~~~~~i~~~w~~~---~~~~~~~~~~~~--~~~~-~~------~~~e~--~~~~  843 (1016)
                       .+++++.++ .+..+|+|+||.+||.+|++|..+-+.-   .-++..-.....  +.+. ++      ...++  ....
T Consensus       179 -~fpn~i~i~-t~~~ky~f~s~~Srda~~~~~~~~~~~~~~~s~s~~~~~~~l~~~~~~~~~~~~~~~~~~~~~s~~~~s  256 (590)
T KOG1032|consen  179 -IFPNAIEIT-TGTTKYIFVSLLSRDATYKLIKLLLHKFLDSSGSPRADSDYLSSVEPEVNDDQQGNVDNSQSPSALQNS  256 (590)
T ss_pred             -CCCcceEEe-cCCCcceeeecccCccHHHHHHHhhhhcccccCCccccchhcccCCCCcCcccccccccCCCccccccc
Confidence             457778887 3667999999999999999886654421   111110000000  0000 00      00000  0000


Q ss_pred             CCCC-------------CcccceeecccccCChhheee-ecCCChhHHHHHHHcCcceeeecccccCCCCceEEEEEEEE
Q 001766          844 LGLE-------------DVTMSEVYSSVLPVPMSFFME-LFGGGELERAVMEKAGCVSYSCSSWESEKLDVYERQIYYRF  909 (1016)
Q Consensus       844 ~~~~-------------~~~~~~v~~~~~p~~~~~~f~-lF~~~~~~~~~~~~~g~~~~~~~~W~~~~~~~~~R~~sy~~  909 (1016)
                      .+.+             ......+....|.+++..+|+ ||++..|...+.+.++..+++..+|.....+...|.++|+.
T Consensus       257 ~~~~~~e~~~~~~~~~~~~~~~v~~~~~~s~~~~~~~~~lf~d~~~~~~~l~~~~~~~vs~~~~~~~~~~~~~r~~~y~~  336 (590)
T KOG1032|consen  257 FDSPKEEELEHDFSCSLSRLFGVLGRLPFSAPIGAFFSLLFGDNTFFFFFLEDQDEIQVSPIPWKGPRSGILLRTLSYTK  336 (590)
T ss_pred             cCCCccccccccccccccccccccccccccccccccceeeccCcceeeeccccccccccccccccCCCccceeEeccCCc
Confidence            0100             111223344567799999997 59988899999999999999999998776788999999996


Q ss_pred             eeccCCCccccC--ce-EEEEeccCCCcEEEEEEEEeCCCCCCCceEEEEEEEEEeCCCCCCccEEEEEEEEEEeeccch
Q 001766          910 DKCISRYRGEVT--ST-QQKSPLPNGNGWLVEEVMTLHGVPLGDYFNLHLRYQVEDSPSRPKGCLAQVYLGVAWLKSTRH  986 (1016)
Q Consensus       910 ~~~~~~~~~~v~--~~-q~~~~~~~~~~~vv~~~~~~~dVPygd~F~v~~r~~i~~~~~~~~~c~l~V~~~V~w~Kst~~  986 (1016)
                      ..+. +.|+..|  .. |...+..-..++.|...+.|++||||++|.|++||+|+|...  +.|+|+|+++|+|.|++|.
T Consensus       337 ~l~~-~~gPk~t~~~~~~~l~~~~~~~~~~vls~t~~~~vps~~~f~v~~~y~i~~~~~--~~~~l~v~~~V~~~~~sw~  413 (590)
T KOG1032|consen  337 GLPA-KSGPKSTDCEGTQTLHHQDLEKYFRVLSETLTPDVPSGDSFYVKTRYLISRAGS--NSCKLKVSTSVEWTKSSWD  413 (590)
T ss_pred             cCCC-cCCCccccccceeeEEeccchhhhhhhheeccCCccccceeeeeEEEEEEecCC--cceeecceeEEEeccCchh
Confidence            5443 4444433  22 333333334458899999999999999999999999999876  9999999999999999999


Q ss_pred             hhhhhhhhHHhHHHHHHHHHHHHHhhh
Q 001766          987 QKRITKNIVSNLEDRLRVKLSVIEKEF 1013 (1016)
Q Consensus       987 K~~Ie~~~~~~~~~~~~~~~~~~~~ev 1013 (1016)
                      +.+++.++.     ..+.+++.+++.+
T Consensus       414 ~~~~~~~~~-----~~k~lv~~~~~~~  435 (590)
T KOG1032|consen  414 VPVSEIGSN-----TLKDLVEILEKLL  435 (590)
T ss_pred             hcccccccc-----chhhHHHHHHHHH
Confidence            999988875     4455555555544



>KOG1032 consensus Uncharacterized conserved protein, contains GRAM domain [Function unknown] Back     alignment and domain information
>KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) Back     alignment and domain information
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08375 C2_Intersectin C2 domain present in Intersectin Back     alignment and domain information
>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>KOG1030 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin Back     alignment and domain information
>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd04046 C2_Calpain C2 domain present in Calpain proteins Back     alignment and domain information
>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>KOG1030 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd08375 C2_Intersectin C2 domain present in Intersectin Back     alignment and domain information
>cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) Back     alignment and domain information
>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) Back     alignment and domain information
>cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>cd08677 C2A_Synaptotagmin-13 C2 domain Back     alignment and domain information
>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin Back     alignment and domain information
>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin Back     alignment and domain information
>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>cd04046 C2_Calpain C2 domain present in Calpain proteins Back     alignment and domain information
>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>cd08677 C2A_Synaptotagmin-13 C2 domain Back     alignment and domain information
>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 Back     alignment and domain information
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 Back     alignment and domain information
>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>cd04041 C2A_fungal C2 domain first repeat; fungal group Back     alignment and domain information
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>cd04018 C2C_Ferlin C2 domain third repeat in Ferlin Back     alignment and domain information
>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 Back     alignment and domain information
>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family Back     alignment and domain information
>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>cd04018 C2C_Ferlin C2 domain third repeat in Ferlin Back     alignment and domain information
>cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin Back     alignment and domain information
>cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin Back     alignment and domain information
>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 Back     alignment and domain information
>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family Back     alignment and domain information
>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin Back     alignment and domain information
>cd08680 C2_Kibra C2 domain found in Human protein Kibra Back     alignment and domain information
>cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>cd08680 C2_Kibra C2 domain found in Human protein Kibra Back     alignment and domain information
>cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) Back     alignment and domain information
>cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>cd04041 C2A_fungal C2 domain first repeat; fungal group Back     alignment and domain information
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd04032 C2_Perforin C2 domain of Perforin Back     alignment and domain information
>cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family Back     alignment and domain information
>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family Back     alignment and domain information
>cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) Back     alignment and domain information
>cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin Back     alignment and domain information
>cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) Back     alignment and domain information
>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd04032 C2_Perforin C2 domain of Perforin Back     alignment and domain information
>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>PLN03008 Phospholipase D delta Back     alignment and domain information
>cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 Back     alignment and domain information
>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>cd04048 C2A_Copine C2 domain first repeat in Copine Back     alignment and domain information
>cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin Back     alignment and domain information
>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 Back     alignment and domain information
>cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03008 Phospholipase D delta Back     alignment and domain information
>cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein Back     alignment and domain information
>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>PF02893 GRAM: GRAM domain; InterPro: IPR004182 The GRAM domain is found in glucosyltransferases, myotubularins and other putative membrane-associated proteins Back     alignment and domain information
>cd04048 C2A_Copine C2 domain first repeat in Copine Back     alignment and domain information
>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein Back     alignment and domain information
>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>cd04047 C2B_Copine C2 domain second repeat in Copine Back     alignment and domain information
>cd04047 C2B_Copine C2 domain second repeat in Copine Back     alignment and domain information
>PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking Back     alignment and domain information
>smart00568 GRAM domain in glucosyltransferases, myotubularins and other putative membrane-associated proteins Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>PLN02223 phosphoinositide phospholipase C Back     alignment and domain information
>cd00030 C2 C2 domain Back     alignment and domain information
>smart00239 C2 Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>cd00030 C2 C2 domain Back     alignment and domain information
>PLN02223 phosphoinositide phospholipase C Back     alignment and domain information
>smart00239 C2 Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>PLN02270 phospholipase D alpha Back     alignment and domain information
>cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin Back     alignment and domain information
>cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin Back     alignment and domain information
>PLN02230 phosphoinositide phospholipase C 4 Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] Back     alignment and domain information
>PLN02270 phospholipase D alpha Back     alignment and domain information
>PLN02230 phosphoinositide phospholipase C 4 Back     alignment and domain information
>PLN02222 phosphoinositide phospholipase C 2 Back     alignment and domain information
>PLN02222 phosphoinositide phospholipase C 2 Back     alignment and domain information
>PLN02228 Phosphoinositide phospholipase C Back     alignment and domain information
>PLN02228 Phosphoinositide phospholipase C Back     alignment and domain information
>KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] Back     alignment and domain information
>KOG1031 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>KOG1264 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG1264 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae Back     alignment and domain information
>KOG1031 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae Back     alignment and domain information
>KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02352 phospholipase D epsilon Back     alignment and domain information
>PLN02352 phospholipase D epsilon Back     alignment and domain information
>KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0905 consensus Phosphoinositide 3-kinase [Signal transduction mechanisms] Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0905 consensus Phosphoinositide 3-kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4347 consensus GTPase-activating protein VRP [General function prediction only] Back     alignment and domain information
>KOG2060 consensus Rab3 effector RIM1 and related proteins, contain PDZ and C2 domains [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd08683 C2_C2cd3 C2 domain found in C2 calcium-dependent domain containing 3 (C2cd3) proteins Back     alignment and domain information
>cd08683 C2_C2cd3 C2 domain found in C2 calcium-dependent domain containing 3 (C2cd3) proteins Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG1327 consensus Copine [Signal transduction mechanisms] Back     alignment and domain information
>KOG2060 consensus Rab3 effector RIM1 and related proteins, contain PDZ and C2 domains [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1327 consensus Copine [Signal transduction mechanisms] Back     alignment and domain information
>KOG3837 consensus Uncharacterized conserved protein, contains DM14 and C2 domains [General function prediction only] Back     alignment and domain information
>KOG3837 consensus Uncharacterized conserved protein, contains DM14 and C2 domains [General function prediction only] Back     alignment and domain information
>cd08684 C2A_Tac2-N C2 domain first repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>PF12416 DUF3668: Cep120 protein; InterPro: IPR022136 This domain family is found in eukaryotes, and is typically between 75 and 114 amino acids in length Back     alignment and domain information
>PF15627 CEP76-C2: CEP76 C2 domain Back     alignment and domain information
>PF12416 DUF3668: Cep120 protein; InterPro: IPR022136 This domain family is found in eukaryotes, and is typically between 75 and 114 amino acids in length Back     alignment and domain information
>cd08684 C2A_Tac2-N C2 domain first repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>PF15627 CEP76-C2: CEP76 C2 domain Back     alignment and domain information
>KOG1265 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>cd08398 C2_PI3K_class_I_alpha C2 domain present in class I alpha phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08693 C2_PI3K_class_I_beta_delta C2 domain present in class I beta and delta phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08380 C2_PI3K_like C2 domain present in phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF14470 bPH_3: Bacterial PH domain Back     alignment and domain information
>cd08693 C2_PI3K_class_I_beta_delta C2 domain present in class I beta and delta phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08398 C2_PI3K_class_I_alpha C2 domain present in class I alpha phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>KOG1265 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>PF10358 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; InterPro: IPR019448 This entry represents the N-terminal 150 residues of a family of conserved proteins which are induced by oestrogen [] Back     alignment and domain information
>cd08397 C2_PI3K_class_III C2 domain present in class III phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF10698 DUF2505: Protein of unknown function (DUF2505); InterPro: IPR019639 This entry represents proteins found Actinobacteria and Proteobacteria Back     alignment and domain information
>cd04012 C2A_PI3K_class_II C2 domain first repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF10358 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; InterPro: IPR019448 This entry represents the N-terminal 150 residues of a family of conserved proteins which are induced by oestrogen [] Back     alignment and domain information
>KOG1452 consensus Predicted Rho GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>cd08380 C2_PI3K_like C2 domain present in phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08687 C2_PKN-like C2 domain in Protein kinase C-like (PKN) proteins Back     alignment and domain information
>cd08687 C2_PKN-like C2 domain in Protein kinase C-like (PKN) proteins Back     alignment and domain information
>PF14844 PH_BEACH: PH domain associated with Beige/BEACH; PDB: 1MI1_B 1T77_C Back     alignment and domain information
>cd04012 C2A_PI3K_class_II C2 domain first repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08397 C2_PI3K_class_III C2 domain present in class III phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF00792 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: IPR002420 Phosphatidylinositol 3-kinase (PI3-kinase) (2 Back     alignment and domain information
>cd08399 C2_PI3K_class_I_gamma C2 domain present in class I gamma phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>smart00142 PI3K_C2 Phosphoinositide 3-kinase, region postulated to contain C2 domain Back     alignment and domain information
>PF10698 DUF2505: Protein of unknown function (DUF2505); InterPro: IPR019639 This entry represents proteins found Actinobacteria and Proteobacteria Back     alignment and domain information
>PF11605 Vps36_ESCRT-II: Vacuolar protein sorting protein 36 Vps36; InterPro: IPR021648 Vps36 is a subunit of ESCRT-II, a protein involved in driving protein sorting from endosomes to lysosomes Back     alignment and domain information
>cd08399 C2_PI3K_class_I_gamma C2 domain present in class I gamma phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1016
2r83_A284 Crystal Structure Analysis Of Human Synaptotagmin 1 3e-14
2ep6_A133 Solution Structure Of The Second C2 Domain From Hum 9e-13
1byn_A128 Solution Structure Of The Calcium-Bound First C2-Do 9e-13
3f04_A143 Crystal Structure Of Synaptotagmin I C2a Domain Len 1e-12
1rsy_A152 Structure Of The First C2-domain Of Synaptotagmin I 1e-12
3jzy_A510 Crystal Structure Of Human Intersectin 2 C2 Domain 1e-12
3f00_A143 Crystal Structure Of Synaptotagmin I C2a Domain Wit 1e-12
3hn8_A296 Crystal Structure Of Synaptotagmin Length = 296 2e-11
3hn8_A296 Crystal Structure Of Synaptotagmin Length = 296 5e-06
1dqv_A296 Crystal Structure Of Synaptotagmin Iii C2aC2B Lengt 2e-11
1dqv_A296 Crystal Structure Of Synaptotagmin Iii C2aC2B Lengt 5e-06
1dsy_A139 C2 Domain From Protein Kinase C (Alpha) Complexed W 2e-11
3gpe_A137 Crystal Structure Analysis Of Pkc (Alpha)-C2 Domain 2e-11
3kwt_A148 Munc13-1 C2b-Domain, Calcium-Free Length = 148 3e-11
2d8k_A141 Solution Structure Of The First C2 Domain Of Synapt 6e-11
2d8k_A141 Solution Structure Of The First C2 Domain Of Synapt 3e-04
2uzp_A144 Crystal Structure Of The C2 Domain Of Human Protein 2e-10
4dnl_A140 Crystal Structure Of A C2 Domain Of A Protein Kinas 2e-10
2cm6_A166 Crystal Structure Of The C2b Domain Of Rabphilin3a 4e-10
2nsq_A155 Crystal Structure Of The C2 Domain Of The Human E3 5e-10
3rpb_A140 The C2b-Domain Of Rabphilin: Structural Variations 5e-10
1ugk_A138 Solution Structure Of The First C2 Domain Of Synapt 9e-10
3pfq_A674 Crystal Structure And Allosteric Activation Of Prot 2e-09
1rh8_A142 Three-Dimensional Structure Of The Calcium-Free Pic 2e-09
3b7y_A153 Crystal Structure Of The C2 Domain Of The E3 Ubiqui 2e-09
2cm5_A166 Crystal Structure Of The C2b Domain Of Rabphilin Le 5e-09
1a25_A149 C2 Domain From Protein Kinase C (Beta) Length = 149 6e-09
2chd_A142 Crystal Structure Of The C2a Domain Of Rabphilin-3a 1e-08
3m7f_B176 Crystal Structure Of The Nedd4 C2GRB10 SH2 COMPLEX 1e-08
2k3h_A140 Structural Determinants For Ca2+ And Pip2 Binding B 1e-08
1tjm_A159 Crystallographic Identification Of Sr2+ Coordinatio 4e-07
2lha_A151 Solution Structure Of C2b With Ip6 Length = 151 6e-07
1k5w_A152 Three-Dimensional Structure Of The Synaptotagmin 1 6e-07
3n5a_A138 Synaptotagmin-7, C2b-Domain, Calcium Bound Length = 1e-06
1wfj_A136 C2 Domain-Containing Protein From Putative Elicitor 1e-06
2enp_A147 Solution Structure Of The First C2 Domain From Huma 7e-06
>pdb|2R83|A Chain A, Crystal Structure Analysis Of Human Synaptotagmin 1 C2a-c2b Length = 284 Back     alignment and structure

Iteration: 1

Score = 77.8 bits (190), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 46/130 (35%), Positives = 78/130 (60%), Gaps = 10/130 (7%) Query: 2 KLVVRVIEARNIPAMDQNGYSDPYVRLQL---GRQRFKTKVVRKSLSPSWEEEFSFKV-- 56 +L+V +I+A +PA+D G SDPYV++ L +++F+TKV RK+L+P + E+F+FKV Sbjct: 20 QLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPY 79 Query: 57 -EDLKDELVISVLDEDKYFNDDFVGFLKIPVSRVFDADNKSLPTAWHSLQPKNKKSKNKD 115 E LV++V D D++ D +G K+P++ V D + W LQ K+ + K Sbjct: 80 SELAGKTLVMAVYDFDRFSKHDIIGEFKVPMNTV---DFGHVTEEWRDLQSAEKEEQEK- 135 Query: 116 CGEILLTISF 125 G+I ++ + Sbjct: 136 LGDICFSLRY 145
>pdb|2EP6|A Chain A, Solution Structure Of The Second C2 Domain From Human Mctp2 Protein Length = 133 Back     alignment and structure
>pdb|1BYN|A Chain A, Solution Structure Of The Calcium-Bound First C2-Domain Of Synaptotagmin I Length = 128 Back     alignment and structure
>pdb|3F04|A Chain A, Crystal Structure Of Synaptotagmin I C2a Domain Length = 143 Back     alignment and structure
>pdb|1RSY|A Chain A, Structure Of The First C2-domain Of Synaptotagmin I: A Novel Ca2+(slash)phospholipid Binding Fold Length = 152 Back     alignment and structure
>pdb|3JZY|A Chain A, Crystal Structure Of Human Intersectin 2 C2 Domain Length = 510 Back     alignment and structure
>pdb|3F00|A Chain A, Crystal Structure Of Synaptotagmin I C2a Domain With Cu(Ii) Length = 143 Back     alignment and structure
>pdb|3HN8|A Chain A, Crystal Structure Of Synaptotagmin Length = 296 Back     alignment and structure
>pdb|3HN8|A Chain A, Crystal Structure Of Synaptotagmin Length = 296 Back     alignment and structure
>pdb|1DQV|A Chain A, Crystal Structure Of Synaptotagmin Iii C2aC2B Length = 296 Back     alignment and structure
>pdb|1DQV|A Chain A, Crystal Structure Of Synaptotagmin Iii C2aC2B Length = 296 Back     alignment and structure
>pdb|1DSY|A Chain A, C2 Domain From Protein Kinase C (Alpha) Complexed With Ca2+ And Phosphatidylserine Length = 139 Back     alignment and structure
>pdb|3GPE|A Chain A, Crystal Structure Analysis Of Pkc (Alpha)-C2 Domain Complexed With Ca2+ And Ptdins(4,5)p2 Length = 137 Back     alignment and structure
>pdb|3KWT|A Chain A, Munc13-1 C2b-Domain, Calcium-Free Length = 148 Back     alignment and structure
>pdb|2D8K|A Chain A, Solution Structure Of The First C2 Domain Of Synaptotagmin Vii Length = 141 Back     alignment and structure
>pdb|2D8K|A Chain A, Solution Structure Of The First C2 Domain Of Synaptotagmin Vii Length = 141 Back     alignment and structure
>pdb|2UZP|A Chain A, Crystal Structure Of The C2 Domain Of Human Protein Kinase C Gamma. Length = 144 Back     alignment and structure
>pdb|4DNL|A Chain A, Crystal Structure Of A C2 Domain Of A Protein Kinase C Alpha (Prkca) From Homo Sapiens At 1.90 A Resolution Length = 140 Back     alignment and structure
>pdb|2CM6|A Chain A, Crystal Structure Of The C2b Domain Of Rabphilin3a Length = 166 Back     alignment and structure
>pdb|2NSQ|A Chain A, Crystal Structure Of The C2 Domain Of The Human E3 Ubiquitin-Protein Ligase Nedd4-Like Protein Length = 155 Back     alignment and structure
>pdb|3RPB|A Chain A, The C2b-Domain Of Rabphilin: Structural Variations In A Janus-Faced Domain Length = 140 Back     alignment and structure
>pdb|1UGK|A Chain A, Solution Structure Of The First C2 Domain Of Synaptotagmin Iv From Human Fetal Brain (Kiaa1342) Length = 138 Back     alignment and structure
>pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 Back     alignment and structure
>pdb|1RH8|A Chain A, Three-Dimensional Structure Of The Calcium-Free Piccolo C2a- Domain Length = 142 Back     alignment and structure
>pdb|3B7Y|A Chain A, Crystal Structure Of The C2 Domain Of The E3 Ubiquitin- Protein Ligase Nedd4 Length = 153 Back     alignment and structure
>pdb|2CM5|A Chain A, Crystal Structure Of The C2b Domain Of Rabphilin Length = 166 Back     alignment and structure
>pdb|1A25|A Chain A, C2 Domain From Protein Kinase C (Beta) Length = 149 Back     alignment and structure
>pdb|2CHD|A Chain A, Crystal Structure Of The C2a Domain Of Rabphilin-3a Length = 142 Back     alignment and structure
>pdb|3M7F|B Chain B, Crystal Structure Of The Nedd4 C2GRB10 SH2 COMPLEX Length = 176 Back     alignment and structure
>pdb|2K3H|A Chain A, Structural Determinants For Ca2+ And Pip2 Binding By The C2a Domain Of Rabphilin-3a Length = 140 Back     alignment and structure
>pdb|1TJM|A Chain A, Crystallographic Identification Of Sr2+ Coordination Site In Synaptotagmin I C2b Domain Length = 159 Back     alignment and structure
>pdb|2LHA|A Chain A, Solution Structure Of C2b With Ip6 Length = 151 Back     alignment and structure
>pdb|1K5W|A Chain A, Three-Dimensional Structure Of The Synaptotagmin 1 C2b- Domain: Synaptotagmin 1 As A Phospholipid Binding Machine Length = 152 Back     alignment and structure
>pdb|3N5A|A Chain A, Synaptotagmin-7, C2b-Domain, Calcium Bound Length = 138 Back     alignment and structure
>pdb|1WFJ|A Chain A, C2 Domain-Containing Protein From Putative Elicitor- Responsive Gene Length = 136 Back     alignment and structure
>pdb|2ENP|A Chain A, Solution Structure Of The First C2 Domain From Human BK Protein Length = 147 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1016
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 6e-43
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 5e-21
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 1e-40
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 3e-13
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 3e-39
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 6e-14
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 2e-38
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 1e-19
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 2e-37
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 5e-17
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 3e-36
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 4e-19
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 1e-35
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 1e-13
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 1e-34
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 1e-16
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 8e-33
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 2e-15
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 2e-32
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 3e-15
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 5e-31
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 2e-15
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 9e-31
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 2e-13
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 9e-31
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 2e-15
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 1e-30
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 1e-07
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 2e-30
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 2e-12
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 2e-30
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 8e-12
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 2e-30
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 9e-16
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 4e-30
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 2e-15
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 1e-29
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 6e-06
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 2e-29
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 7e-16
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 4e-29
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 3e-15
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 7e-29
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 2e-14
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 1e-28
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 2e-24
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 3e-13
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 6e-10
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 2e-28
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 2e-10
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 4e-28
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 8e-24
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 7e-12
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 5e-11
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 2e-27
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 2e-15
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 4e-27
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 9e-14
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 4e-27
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 2e-15
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 5e-26
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 6e-11
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 9e-26
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 1e-16
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 1e-25
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 1e-14
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 2e-25
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 5e-11
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 3e-25
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 4e-14
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 3e-25
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 3e-11
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 4e-25
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 3e-10
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 6e-25
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 2e-10
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 6e-24
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 5e-10
1cjy_A749 CPLA2, protein (cytosolic phospholipase A2); lipid 6e-21
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 3e-09
3nsj_A540 Perforin-1; pore forming protein, immune system; H 8e-17
3nsj_A540 Perforin-1; pore forming protein, immune system; H 1e-09
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 5e-15
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
3bxj_A483 RAS GTPase-activating protein syngap; GTPase activ 2e-10
3bxj_A483 RAS GTPase-activating protein syngap; GTPase activ 8e-04
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 1e-09
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 8e-07
2enj_A138 NPKC-theta, protein kinase C theta type; beta-sand 2e-04
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133 Back     alignment and structure
 Score =  151 bits (384), Expect = 6e-43
 Identities = 42/127 (33%), Positives = 70/127 (55%), Gaps = 7/127 (5%)

Query: 2   KLVVRVIEARNIPAMDQNGYSDPYVRLQLGRQRFKTKVVRKSLSPSWEEEFSFKVEDLKD 61
            L V+V++A ++ A D +G SDP+  L+LG  R +T  V K+L+P W + F+F ++D+ D
Sbjct: 14  ILQVKVLKAADLLAADFSGKSDPFCLLELGNDRLQTHTVYKNLNPEWNKVFTFPIKDIHD 73

Query: 62  ELVISVLDEDKYFNDDFVGFLKIPVSRVFDADNKSLPTAWHSLQPKNKKSKNKDCGEILL 121
            L ++V DED     DF+G + IP+  + D          + L+ K+ +   K  G I L
Sbjct: 74  VLEVTVFDEDGDKPPDFLGKVAIPLLSIRDGQPN-----CYVLKNKDLEQAFK--GVIYL 126

Query: 122 TISFSHN 128
            +   +N
Sbjct: 127 EMDLIYN 133


>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133 Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153 Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153 Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} PDB: 3kwt_A* Length = 148 Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} PDB: 3kwt_A* Length = 148 Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Length = 173 Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Length = 173 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Length = 132 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Length = 132 Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Length = 149 Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Length = 149 Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} Length = 153 Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} Length = 153 Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Length = 152 Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Length = 152 Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Length = 131 Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Length = 131 Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 147 Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 147 Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Length = 143 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Length = 143 Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Length = 142 Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Length = 142 Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Length = 167 Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Length = 167 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126 Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 141 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 141 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Length = 129 Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Length = 129 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157 Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Length = 142 Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Length = 142 Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Length = 166 Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Length = 166 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Length = 148 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Length = 148 Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 142 Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 142 Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Length = 138 Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Length = 138 Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Length = 134 Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Length = 134 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Length = 171 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Length = 171 Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Length = 159 Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Length = 159 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Length = 155 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Length = 155 Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Length = 153 Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Length = 153 Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Length = 749 Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Length = 749 Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Length = 540 Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Length = 540 Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Length = 144 Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Length = 144 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Length = 483 Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Length = 483 Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Length = 510 Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Length = 624 Back     alignment and structure
>2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} Length = 138 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1016
d2ep6a1126 b.7.1.1 (A:92-217) Multiple C2 and transmembrane d 1e-23
d2ep6a1126 b.7.1.1 (A:92-217) Multiple C2 and transmembrane d 7e-15
d1wfja_136 b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr 3e-23
d1wfja_136 b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr 1e-09
d2cjta1128 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus no 8e-22
d2cjta1128 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus no 7e-09
d2nq3a1133 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itc 1e-21
d2nq3a1133 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itc 4e-09
d1a25a_132 b.7.1.2 (A:) C2 domain from protein kinase c (beta 2e-20
d1a25a_132 b.7.1.2 (A:) C2 domain from protein kinase c (beta 3e-15
d2bwqa1125 b.7.1.2 (A:729-853) Regulating synaptic membrane e 2e-20
d2bwqa1125 b.7.1.2 (A:729-853) Regulating synaptic membrane e 8e-15
d1rsya_143 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 7e-19
d1rsya_143 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 9e-14
d1w15a_138 b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi 1e-18
d1w15a_138 b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi 2e-08
d1uowa_157 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 8e-18
d1uowa_157 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 9e-07
d1rh8a_142 b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [Tax 1e-17
d1rh8a_142 b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [Tax 5e-10
d1ugka_138 b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens 2e-17
d1ugka_138 b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens 2e-07
d2cm5a1137 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat ( 4e-17
d2cm5a1137 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat ( 2e-07
d1rlwa_126 b.7.1.1 (A:) Domain from cytosolic phospholipase A 2e-16
d1rlwa_126 b.7.1.1 (A:) Domain from cytosolic phospholipase A 6e-12
d1qasa2131 b.7.1.1 (A:626-756) PI-specific phospholipase C is 3e-15
d1qasa2131 b.7.1.1 (A:626-756) PI-specific phospholipase C is 1e-13
d1dqva2145 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus 1e-14
d1dqva2145 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus 5e-07
d1gmia_136 b.7.1.1 (A:) Domain from protein kinase C epsilon 6e-14
d1wfma_138 b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapie 3e-12
d1wfma_138 b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapie 1e-09
d1dqva1130 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus 4e-12
d1bdya_123 b.7.1.1 (A:) Domain from protein kinase C delta {R 1e-10
d1bdya_123 b.7.1.1 (A:) Domain from protein kinase C delta {R 3e-08
d2zkmx2122 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human 4e-08
d2zkmx2122 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human 1e-05
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure

class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: PLC-like (P variant)
domain: Multiple C2 and transmembrane domain-containing protein 2, MCTP2
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 94.9 bits (235), Expect = 1e-23
 Identities = 42/127 (33%), Positives = 70/127 (55%), Gaps = 7/127 (5%)

Query: 2   KLVVRVIEARNIPAMDQNGYSDPYVRLQLGRQRFKTKVVRKSLSPSWEEEFSFKVEDLKD 61
            L V+V++A ++ A D +G SDP+  L+LG  R +T  V K+L+P W + F+F ++D+ D
Sbjct: 7   ILQVKVLKAADLLAADFSGKSDPFCLLELGNDRLQTHTVYKNLNPEWNKVFTFPIKDIHD 66

Query: 62  ELVISVLDEDKYFNDDFVGFLKIPVSRVFDADNKSLPTAWHSLQPKNKKSKNKDCGEILL 121
            L ++V DED     DF+G + IP+  + D          + L+ K+ +   K  G I L
Sbjct: 67  VLEVTVFDEDGDKPPDFLGKVAIPLLSIRDGQPN-----CYVLKNKDLEQAFK--GVIYL 119

Query: 122 TISFSHN 128
            +   +N
Sbjct: 120 EMDLIYN 126


>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 128 Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 128 Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 142 Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 142 Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 137 Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 137 Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 131 Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 131 Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Length = 136 Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 130 Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 123 Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 123 Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1016
d2ep6a1126 Multiple C2 and transmembrane domain-containing pr 99.94
d2ep6a1126 Multiple C2 and transmembrane domain-containing pr 99.93
d1wfja_136 C2 domain protein At1g63220 {Thale cress (Arabidop 99.91
d1wfja_136 C2 domain protein At1g63220 {Thale cress (Arabidop 99.91
d1gmia_136 Domain from protein kinase C epsilon {Rat (Rattus 99.91
d1rlwa_126 Domain from cytosolic phospholipase A2 {Human (Hom 99.91
d2nq3a1133 E3 ubiquitin-protein ligase Itchy {Human (Homo sap 99.91
d1a25a_132 C2 domain from protein kinase c (beta) {Rat (Rattu 99.9
d2nq3a1133 E3 ubiquitin-protein ligase Itchy {Human (Homo sap 99.89
d1qasa2131 PI-specific phospholipase C isozyme D1 (PLC-D1), C 99.89
d1gmia_136 Domain from protein kinase C epsilon {Rat (Rattus 99.88
d1rsya_143 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.88
d1a25a_132 C2 domain from protein kinase c (beta) {Rat (Rattu 99.88
d1rh8a_142 Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} 99.87
d1rlwa_126 Domain from cytosolic phospholipase A2 {Human (Hom 99.87
d2cjta1128 Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 99.87
d1qasa2131 PI-specific phospholipase C isozyme D1 (PLC-D1), C 99.87
d1rsya_143 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.86
d2cjta1128 Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 99.86
d1rh8a_142 Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} 99.85
d1dqva1130 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.85
d1dqva1130 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.85
d1wfma_138 Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 99.83
d2bwqa1125 Regulating synaptic membrane exocytosis protein, r 99.82
d1uowa_157 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.81
d2bwqa1125 Regulating synaptic membrane exocytosis protein, r 99.81
d2cm5a1137 C2b-domain of rabphilin {Rat (Rattus norvegicus) [ 99.8
d1uowa_157 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.8
d1w15a_138 Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 99.8
d1wfma_138 Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 99.8
d1ugka_138 Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 99.79
d2cm5a1137 C2b-domain of rabphilin {Rat (Rattus norvegicus) [ 99.79
d1ugka_138 Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 99.79
d1w15a_138 Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 99.78
d1bdya_123 Domain from protein kinase C delta {Rat (Rattus no 99.75
d1dqva2145 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.74
d1dqva2145 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.73
d1bdya_123 Domain from protein kinase C delta {Rat (Rattus no 99.72
d2zkmx2122 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.64
d2zkmx2122 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.63
d1e7ua2174 Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa) 95.73
d1e7ua2174 Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa) 95.62
d2caya1130 Vacuolar protein sorting protein 36, VPS36 {Baker' 94.38
d2hthb1129 Vacuolar protein sorting protein 36, VPS36 {Human 92.72
d1zsqa1125 Myotubularin-related protein 2, N-terminal domain 89.93
d2rnrb1108 TFIIH basal transcription factor complex p62 subun 89.83
d1t77a2110 Lipopolysaccharide-responsive and beige-like ancho 89.61
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: PLC-like (P variant)
domain: Multiple C2 and transmembrane domain-containing protein 2, MCTP2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.94  E-value=6.1e-26  Score=157.38  Aligned_cols=120  Identities=26%  Similarity=0.392  Sum_probs=101.1

Q ss_pred             CCEEEEEEEEEEECCCCCCCCCCCCCEEEEEECCEEEEEECCCCCCCCEEEEEEEEEEECCCCCEEEEEEEECCCCCCCC
Q ss_conf             88499999997563999998888872999999893545545889999836179999921799976999999716899988
Q 001766          535 DGWLLTVALIKGDNLAAVDSSGFCDPYVVFTCNGKSRTSSIKFQQCDPMWNEIFEYDAMDEPPSMLDVEVYDFDGPFNEA  614 (1016)
Q Consensus       535 ~~~~L~V~v~~a~~L~~~d~~g~~DPYv~i~~~~~~~~T~v~~~t~nP~WnE~f~f~v~~~~~~~L~i~V~D~d~~~~~d  614 (1016)
                      +-|+|+|+|++|+||+.+|..|.+||||++.+++++++|++++++.||.|||+|.|.+.. +...|.|+|||+|. +++|
T Consensus         4 ~~G~L~V~v~~A~~L~~~d~~g~~Dpyv~v~~~~~~~~T~~~~~t~nP~wne~f~f~v~~-~~~~L~i~V~d~~~-~~~d   81 (126)
T d2ep6a1           4 DVGILQVKVLKAADLLAADFSGKSDPFCLLELGNDRLQTHTVYKNLNPEWNKVFTFPIKD-IHDVLEVTVFDEDG-DKPP   81 (126)
T ss_dssp             CSEEEEEEEEEEESCCCSSSSSCCCEEEEEEETTEEEECCCCSSCSSCCCCEEEEEEESC-TTCEEEEEEEEEET-TEEE
T ss_pred             CCEEEEEEEEEEECCCCCCCCCCCCEEEEEECCCEEEEEEEECCCEEEEEEEEEEEEEEC-CCCEEEEEEEECCC-CCCC
T ss_conf             619999999982789887889996959999769858877740774057898999999843-67500899999369-8476


Q ss_pred             CEEEEEEEECEECCCCCCEEEEEECCCCC-CCCCCCEEEEEEEEE
Q ss_conf             40058999811147999332899777677-674463079999996
Q 001766          615 TSLGHAEINFVKSDISDLADVWIPLQGKL-AQACQSKLHLRIFLN  658 (1016)
Q Consensus       615 d~iG~~~i~l~~i~~~~~~~~w~~L~~~~-~~~~~g~l~l~~~~~  658 (1016)
                      ++||++.+++.++..+.  ..|+.|.... .....|.|+|++++.
T Consensus        82 ~~lG~~~i~l~~l~~~~--~~~~~l~~~~~~~~~~G~i~l~~~~i  124 (126)
T d2ep6a1          82 DFLGKVAIPLLSIRDGQ--PNCYVLKNKDLEQAFKGVIYLEMDLI  124 (126)
T ss_dssp             EECCBCEEEGGGCCSSC--CEECCCBCSCTTSCCSSEEEEEEEEE
T ss_pred             CEEEEEEEEHHHCCCCC--CEEEECCCCCCCCCEEEEEEEEEEEE
T ss_conf             25899999989988999--64998415489975429999999999



>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2caya1 b.55.1.12 (A:1-99,A:252-282) Vacuolar protein sorting protein 36, VPS36 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hthb1 b.55.1.12 (B:3-131) Vacuolar protein sorting protein 36, VPS36 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zsqa1 b.55.1.8 (A:74-198) Myotubularin-related protein 2, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rnrb1 b.55.1.9 (B:1-108) TFIIH basal transcription factor complex p62 subunit (BTF2-p62), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t77a2 b.55.1.6 (A:2076-2185) Lipopolysaccharide-responsive and beige-like anchor protein LRBA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure