Citrus Sinensis ID: 001855

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000----

MAAESTHLQQSQLAVILGPDSAPFETLISHLMSTSNEQRSEAELLFNLCKQQDPDSLTLKLAHLLQRSPHPEARAMAAVLLRKLLTRDDSFLWPRLSLHTQSSLKSMLLQSIQLESAKSISKKLCDTVSELASNILPENGWPELLPFMFQCVSSDSVKLQESAFLIFAQLSQYIGDTLTPHLKHLHAVFLNCLTNSNNPDVKIAALNAVINFIQCLTSSADRDRFQDLLPLMMRTLTESLNNGNEATAQEALELLIELAGTEPRFLRRQLVDVVGSMLQIAEAESLEEGTRHLAIEFVITLAEARERAPGMMRKLPQFINRLFAILMSMLLDIEDDPLWHSAETEDEDAGESSNYSVGQECLDRLAIALGGNTIVPVASEQLPAYLAAPEWQKHHAALIALAQIAEGCAKVMVKNLEQVLSMVLNSFRDPHPRVRWAAINAIGQLSTDLGPDLQNQFHPQVLPALAGAMDDFQNPRVQAHAASAVLNFSENCTPEILTPYLDGIVSKLLVLLQNGKQMVQEGALTALASVADSSQEHFQKYYDAVMPFLKAILVNATDKSNRMLRAKSMECISLVGMAVGKDKFRDDAKQVMEVLMSLQGSQMETDDPTTSYMLQAWARLCKCLGQDFLPYMSVVMPPLLQSAQLKPDVTITSADSDNEIEDSDDDSMETITLGDKRIGIKTSVLEEKATACNMLCCYADELKEGFFPWIDQVAPTLVPLLKFYFHEEVRKAAVSAMPELLRSAKLAIEKGLAPGRNESYVKQLSDFIIPALVEALHKEPDTEICASMLDSLNECIQISGPLLDEGQVRSIVDEIKQVITASSSRKRERAERAKAEDFDAEESELIKEENEQEEEVFDQVGEILGTLIKTFKAAFLPFFDELSSYLTPMWGKDKTAEERRIAICIFDDVAEQCREAALKYYETYLPFLLEACNDENQDVRQAAVYGLGVCAEFGGSVVKPLVGEALSRLNVVIRHPNALQPENLMAYDNAVSALGKICQLFLHG

cccccHHcHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccHHHcccHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccccccccccccccccccHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHcccc

**************VILGPDSAPFETLISHLMSTSNEQRSEAELLFNLCKQQDPDSLTLKLAHLLQRSPHPEARAMAAVLLRKLLTRDDSFLWPRLSLHTQSSLKSMLLQSIQLESAKSISKKLCDTVSELASNILPENGWPELLPFMFQCVSSDSVKLQESAFLIFAQLSQYIGDTLTPHLKHLHAVFLNCLTNSNNPDVKIAALNAVINFIQCLTSSADRDRFQDLLPLMMRTLTESLNNGNEATAQEALELLIELAGTEPRFLRRQLVDVVGSMLQIAEAESLEEGTRHLAIEFVITLAEARERAPGMMRKLPQFINRLFAILMSMLLDIEDDPLWHSAE**D**AGESSNYSVGQECLDRLAIALGGNTIVPVASEQLPAYLAAPEWQKHHAALIALAQIAEGCAKVMVKNLEQVLSMVLNSFRDPHPRVRWAAINAIGQLSTDLGPDLQNQFHPQVLPALAGAMDDFQNPRVQAHAASAVLNFSENCTPEILTPYLDGIVSKLLVLLQNGKQMVQEGALTALASVADSSQEHFQKYYDAVMPFLKAILVNATDKSNRMLRAKSMECISLVGMAVGKDKFRDDAKQVMEVLMSLQGSQ*E*DDPTTSYMLQAWARLCKCLGQDFLPYMSVVMPPLLQSAQLKPDVTITSADSDNEIEDSDDDSMETITLGDKRIGIKTSVLEEKATACNMLCCYADELKEGFFPWIDQVAPTLVPLLKFYFHEEVRKAAVSAMPELLRSAKLAIEKGLAPGRNESYVKQLSDFIIPALVEALHKEPDTEICASMLDSLNECIQISGPLLDEGQVRSIVDEIKQVITASSSRKRERAERA**EDFDAEESELIKEENEQEEEVFDQVGEILGTLIKTFKAAFLPFFDELSSYLTPMWGKDKTAEERRIAICIFDDVAEQCREAALKYYETYLPFLLEACNDENQDVRQAAVYGLGVCAEFGGSVVKPLVGEALSRLNVVIRHPNALQPENLMAYDNAVSALGKICQLFL**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAAESTHLQQSQLAVILGPDSAPFETLISHLMSTSNEQRSEAELLFNLCKQQDPDSLTLKLAHLLQRSPHPEARAMAAVLLRKLLTRDDSFLWPRLSLHTQSSLKSMLLQSIQLESAKSISKKLCDTVSELASNILPENGWPELLPFMFQCVSSDSVKLQESAFLIFAQLSQYIGDTLTPHLKHLHAVFLNCLTNSNNPDVKIAALNAVINFIQCLTSSADRDRFQDLLPLMMRTLTESLNNGNEATAQEALELLIELAGTEPRFLRRQLVDVVGSMLQIAEAESLEEGTRHLAIEFVITLAEARERAPGMMRKLPQFINRLFAILMSMLLDIEDDPLWHSAETEDEDAGESSNYSVGQECLDRLAIALGGNTIVPVASEQLPAYLAAPEWQKHHAALIALAQIAEGCAKVMVKNLEQVLSMVLNSFRDPHPRVRWAAINAIGQLSTDLGPDLQNQFHPQVLPALAGAMDDFQNPRVQAHAASAVLNFSENCTPEILTPYLDGIVSKLLVLLQNGKQMVQEGALTALASVADSSQEHFQKYYDAVMPFLKAILVNATDKSNRMLRAKSMECISLVGMAVGKDKFRDDAKQVMEVLMSLQGSQMETDDPTTSYMLQAWARLCKCLGQDFLPYMSVVMPPLLQSAQLKPDVTITSADSDNEIEDSDDDSMETITLGDKRIGIKTSVLEEKATACNMLCCYADELKEGFFPWIDQVAPTLVPLLKFYFHEEVRKAAVSAMPELLRSAKLAIEKGLAPGRNESYVKQLSDFIIPALVEALHKEPDTEICASMLDSLNECIQISGPLLDEGQVRSIVDEIKQVITASSSRKRERAERAKxxxxxxxxxxxxxxxxxxxxxVFDQVGEILGTLIKTFKAAFLPFFDELSSYLTPMWGKDKTAEERRIAICIFDDVAEQCREAALKYYETYLPFLLEACNDENQDVRQAAVYGLGVCAEFGGSVVKPLVGEALSRLNVVIRHPNALQPENLMAYDNAVSALGKICQLFLHG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Importin-5	Functions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS) in cargo substrates. Is thought to mediate docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to nucleoporin and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to the importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus (By similarity). Mediates the nuclear import of ribosomal proteins RPL23A, RPS7 and RPL5. Binds to a beta-like import receptor binding (BIB) domain of RPL23A. In vitro, mediates nuclear import of H2A, H2B, H3 and H4 histones. In case of HIV-1 infection, binds and mediates the nuclear import of HIV-1 Rev.	probable	O00410
Importin subunit beta-3	Involved in the nuclear import of cdc25 and mcs1.	probable	O74476
Importin-5	Functions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS) in cargo substrates. Is thought to mediate docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to nucleoporin and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to the importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus (By similarity). Mediates the nuclear import of ribosomal proteins RPL23A, RPS7 and RPL5. Binds to a beta-like import receptor binding (BIB) domain of RPL23A (By similarity). In vitro, mediates nuclear import of H2A, H2B, H3 and H4 histones.	probable	Q8BKC5

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2BPT, chain A
Confidence level:confident
Coverage over the Query: 25-836
View the alignment between query and template
View the model in PyMOL

Template: 1U6G, chain C
Confidence level:probable
Coverage over the Query: 1-279,308-355,368-969
View the alignment between query and template
View the model in PyMOL