Citrus Sinensis ID: 001899


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------100
MWLLVDMQRLSSPATGILCSSKLHNNETKLWGFGFRFKLQRRNESVRRRVKLVVSAELSKSFSLNLGLDSQVIQSNDPSQLPWIGPVPGDIAEVEAYCRIFRAAERLHAALMDTLCNPLTGECTVSYEFTPEEKPLLEDKIVSVLGCMLSLLNKGREDVLSGRSSIMNAYRVADISMTEDQLPPLAIFRSEMKRCCESMHIALENYLTPEDVRSLDVWRKLQRLKNVCYDSGFPRGDDYPIHTLFANWSPVYLSNSKDDIASKDSEVTFCRGGQVTEEGLKWLMEKGYKTIVDIRAERVKDNFYEAAIDDAILSGKVELIKIPVEVRTAPTMEQVEKFASLVSNSSKKPLYLHSKEGVWRTYAMVSRWRQYMARCASQISGQTITSNDVLLKDSTRTRKLKASAGKFLLEEKYETVKENQDEIQTKNGVFGFGLSVDMDKRNQSNGAYKGLSSVEGVESAKEVDTAVGSLGTTFSKETDPFKAQVPPSNFVSKKEMSRFFRSKTTSPPRYFNYQSKRMDVLPSEIVSSGPVSGVAETRYSQWSLSGNNLSPNHQNLPAGSEKSSDNNGYVSAGCSTNGFDRGDRSSMTEANLLTSVTKNLDEQVISSSVRDVQRSNGKPSNSGDDDLGPIVGNMCASSTGVVRVQSRKKAEMFLVRTDGFSCNREKVTESSLAFTHPSTQQQMLMWKTTPRTVLVLKKPGPALMEEAKEVASFLYHQEKMNILVEPDVHDIFARIPGFGFVQTFYLQDTSDLHERVDFVACLGGDGVILHASNLFRGAVPPVISFNLGSLGFLTSHPFEDYRQDLRQVIYGNNTLDGVYITLRMRLCCEIFRNGKAMPGKVFDVLNEVVVDRGSNPYLSKIECYEHDRLITKVQGDGVIVATPTGSTAYSTAAGGSMVHPNVPCMLFTPICPHSLSFRPVILPDSARLELKIPDDARSNAWVSFDGKRRQQLSRGDSVRIFMSEHPIPTVNKSDQTGDWFHSLVRCLNWNERLDQKAL
cEEEEECccccccccEEEEccccccccccEEECcEEEEEEEccHHHHHEEEEEEEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccCEEECcccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccccccccccccccccccccCEEEEccccccccccccEEEEEccccccHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHHccccEEEEEEcccccccccHHHHHHHHHHHcccccccEEEEcccccccccEEEEEEEEEHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccccccccccccEEEccccccccEEccccccccccccccccccEEccccccccccccccccCEEEEEcccccHHHHHHHHHHHHHHHcccCEEEEcccHHHHHcccccccccCCccccccccccccEEEEEEEccccHHHHHHHHcccccccEEEEEccccccccccccccHHHHHHHHHcccccccccEEEEEEEEEEEEEEccccccccccccEEEEEEccccccccEEEEEEEccEEEEEEEccEEEEEccccHHHHHHccccccccccccEEEEECccccccccccEEEccccEEEEEEcccccccCEEEEcccccEEcccccEEEEEEcccccCEECcccccccHHHHHHHHcccccccccccc
MWLLVDMQRLSSPATGILCSSKLHNNETKLWGFGFRFKLQRRNESVRRRVKLVVSAELSKSFSLNLGLDSQVIQSNDPSQLPWIGPVPGDIAEVEAYCRIFRAAERLHAALMDTLCNPLTGECTVSYEFTPEEKPLLEDKIVSVLGCMLSLLNKGREDVLSGRSS**************DQLPPLAIFRSEMKRCCESMHIALENYLTPEDVRSLDVWRKLQRLKNVCYDSGFPRGDDYPIHTLFANWSPVYLSNSKDDIASKDSEVTFCRGGQVTEEGLKWLMEKGYKTIVDIRAERVKDNFYEAAIDDAILSGKVELIKIPVEVRTAPTMEQVEKFASLVSNSSKKPLYLHSKEGVWRTYAMVSRWRQYMARCASQISG*********************************************************************************************************************************************************************************************************************************************************V***CASSTGVVRVQSRKKAEMFLVRTDGFSCNREKV*****AF*******QMLMWKTTPRTVLVLKKPGPALMEEAKEVASFLYHQEKMNILVEPDVHDIFARIPGFGFVQTFYLQDTSDLHERVDFVACLGGDGVILHASNLFRGAVPPVISFNLGSLGFLTSHPFEDYRQDLRQVIYGNNTLDGVYITLRMRLCCEIFRNGKAMPGKVFDVLNEVVVDRGSNPYLSKIECYEHDRLITKVQGDGVIVATPTGSTAYSTAAGGSMVHPNVPCMLFTPICPHSLSFRPVILPDSARLELKIPDDARSNAWVSFDGKRRQQLSRGDSVRIFMSEHPIPTVNKSDQTGDWFHSLVRCLNWNE*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWLLVDMQRLSSPATGILCSSKLHNNETKLWGFGFRFKLQRRNESVRRRVKLVVSAELSKSFSLNLGLDSQVIQSNDPSQLPWIGPVPGDIAEVEAYCRIFRAAERLHAALMDTLCNPLTGECTVSYEFTPEEKPLLEDKIVSVLGCMLSLLNKGREDVLSGRSSIMNAYRVADISMTEDQLPPLAIFRSEMKRCCESMHIALENYLTPEDVRSLDVWRKLQRLKNVCYDSGFPRGDDYPIHTLFANWSPVYLSNSKDDIASKDSEVTFCRGGQVTEEGLKWLMEKGYKTIVDIRAERVKDNFYEAAIDDAILSGKVELIKIPVEVRTAPTMEQVEKFASLVSNSSKKPLYLHSKEGVWRTYAMVSRWRQYMARCASQISGQTITSNDVLLKDSTRTRKLKASAGKFLLEEKYETVKENQDEIQTKNGVFGFGLSVDMDKRNQSNGAYKGLSSVEGVESAKEVDTAVGSLGTTFSKETDPFKAQVPPSNFVSKKEMSRFFRSKTTSPPRYFNYQSKRMDVLPSEIVSSGPVSGVAETRYSQWSLSGNNLSPNHQNLPAGSEKSSDNNGYVSAGCSTNGFDRGDRSSMTEANLLTSVTKNLDEQVISSSVRDVQRSNGKPSNSGDDDLGPIVGNMCASSTGVVRVQSRKKAEMFLVRTDGFSCNREKVTESSLAFTHPSTQQQMLMWKTTPRTVLVLKKPGPALMEEAKEVASFLYHQEKMNILVEPDVHDIFARIPGFGFVQTFYLQDTSDLHERVDFVACLGGDGVILHASNLFRGAVPPVISFNLGSLGFLTSHPFEDYRQDLRQVIYGNNTLDGVYITLRMRLCCEIFRNGKAMPGKVFDVLNEVVVDRGSNPYLSKIECYEHDRLITKVQGDGVIVATPTGSTAYSTAAGGSMVHPNVPCMLFTPICPHSLSFRPVILPDSARLELKIPDDARSNAWVSFDGKRRQQLSRGDSVRIFMSEHPIPTVNKSDQTGDWFHSLVRCLNWNERLDQKAL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable NAD kinase 2, chloroplastic Involved in chlorophyll synthesis and chloroplast protection against oxidative damage.probableQ53NI2
NAD kinase 2, chloroplastic Involved in chlorophyll synthesis and chloroplast protection against oxidative damage.probableQ9C5W3

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.1.-Phosphotransferases with an alcohol group as acceptor.probable
2.7.1.23NAD(+) kinase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3AFO, chain A
Confidence level:very confident
Coverage over the Query: 660-995
View the alignment between query and template
View the model in PyMOL
Template: 3GXH, chain A
Confidence level:confident
Coverage over the Query: 242-252,267-383
View the alignment between query and template
View the model in PyMOL
Template: 1YWF, chain A
Confidence level:confident
Coverage over the Query: 240-393
View the alignment between query and template
View the model in PyMOL