Citrus Sinensis ID: 001921


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990-----
MSDKAEKTCPLCAEEMDLTDQQLKPCNCGYEICVWCWNHIMEMAEKDGTEGRCPACRTAYDKEKIVGMAANCERAVARMTSERRQKSQKAKPKPSEGRMHLTNVRVIQRNLVYIIGLPINLADEDLLQRKEYFGQYGKVLKVSISRTATGDIQHSANNSCCVYITYSREDDAIRCIQSVHSYILDGRPLRACFGTTKYCHAWIRNMPCSVPDCLYLHDFGSQEDSFTKDEIVSAFTRSRVQQIIGATNNMHRRSGNALPPPADEYINSNITSTAKPIAKNSSNIIENPNNGSCADIVAGKSNSLPTAASWVMRVSATLPTNKNLSGPVRPPSNQPKASNGPQVPGTEVVSTTISIQTVQPMEAVATSKVHHKLDPLELGKEYIDALSSTNEEATLDSIPATATSNQYITCRPTSKSSEKDIATPSSRTSSSESTKPFSSPGSVEDESSHIVMDFQGLCCGLSSIGLESQFEKDRSLPVVPNSSISKHVSVNLPGSHGPQEEKSGQFTECKSFQASMAAPTMEDSPDFDDLQFKGLEDMHHLPPISSTPHLPHNLNQSSYLSWQAGDVSNQSNLDGHSGNVPLEHKEVLPSRSENLISNGFITNEASSFFNLDATVQHSSLFSEVGFGSYLGKHDSMVAPLHSNVASDVGESSIISKILSLDADAWEDSLTSPYSFAKLLRESNRQHDSLKMPSLFKESDCRQSRFSFARQEEFSNHASDVEHSLSNIRHSADQHPAPNGLLKNKDIFTDKHQNAFSSSSSMDSDNFLGSHSFISSSVSKAPTSVPPGFAVPNRAPPPGFSPHGTMQKPFDSSASHLRWTSAQAAGNSGPCGDIPFVDPAILEVGKGLQAIGLNNLGCDMRQTPSSQLNPFEHEARLQLLMQQSSSGYQNLRFQDYPMNRFSPPSDTYGISSKVLNQPQPNNLSSFTQSPAQQYRNAHMSTGHLGSLKGVKSINDLGVSDLMTNGGIGFNKFIPSYEDLKCQMSNSSNLYNRGFAM
cccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccHHHccccHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEcEEEEEccccccccHHHHcccccccccccEEEEEEEcccccccccccccccEEEEEEccHHHHHHHHHHHcccccccEEEEEEccccHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccEEccccccccHHcccc
ccccccccccccEcccccccccccccccccHEEHHHHHHHHHccccccccccccccccccccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccEEEEEccccccccHHHHccccHcccccEEEEEEEEccccccccccccccEEEEEEEccHHHHHHHHHHHccccccccEEEEEccccHHHHHHHccccccccccEEEcccccccccccHHHHHHcccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccHHHHHHHcccccccccccccHHHHHHHccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEcccHHHHEcccccccccccccccccccccccHcccccccHHHHHHccccccccccccccccccccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccHHccccc
msdkaektcplcaeemdltdqqlkpcncgyeiCVWCWNHIMEMaekdgtegrcpacrtaydKEKIVGMAANCERAVARMTSERrqksqkakpkpsegrmhltNVRVIQRNLVYIIGlpinladedLLQRKEYFGQYGKVLKVSISrtatgdiqhsannSCCVYITYSREDDAIRCIQSVHSYildgrplracfgttkychawirnmpcsvpdclylhdfgsqedsftkdEIVSAFTRSRVQQIIGATnnmhrrsgnalpppadeyinsnitstakpiaknssniienpnngscadivagksnslptAASWVMRVsatlptnknlsgpvrppsnqpkasngpqvpgtevVSTTISIQTVQPMEAVAtskvhhkldplelGKEYIDALSstneeatldsipatatsnqyitcrptskssekdiatpssrtsssestkpfsspgsvedesshiVMDFQGlccglssiglesqfekdrslpvvpnssiskhvsvnlpgshgpqeeksgqftecksfqasmaaptmedspdfddlqfkgledmhhlppisstphlphnlnqssylswqagdvsnqsnldghsgnvplehkevlpsrsenlisngfitneassffnldatvqhsslfsevgfgsylgkhdsmvaplhsnvasdvgeSSIISKILSldadawedsltspySFAKLLRESnrqhdslkmpslfkesdcrqsrfsFARQEEFSNHASDVEHSlsnirhsadqhpapngllknkdiftdkhqnafsssssmdsdnflgshsfisssvskaptsvppgfavpnrapppgfsphgtmqkpfdssashLRWTsaqaagnsgpcgdipfvdpAILEVGKGLQAiglnnlgcdmrqtpssqlnpfEHEARLQLLMQQsssgyqnlrfqdypmnrfsppsdtygisskvlnqpqpnnlssftqspaqQYRNAhmstghlgslkgvksindlgvsdlmtnggigfnkfipsyedlkcqmsnssnlynrgfam
MSDKAEKTCPLCAEEMDLTDQQLKPCNCGYEICVWCWNHIMEMAEKDGTEGRCPACRTAYDKEKIVGMAANCERAVarmtserrqksqkakpkpsegrmhltnvrVIQRNLVYIIGLPINLADEDLLQRKEYFGQYGKVLKVSISRTatgdiqhsannSCCVYITYSREDDAIRCIQSVHSYILDGRPLRACFGTTKYCHAWIRNMPCSVPDCLYLHDFGSQEDSFTKDEIVSAFTRSRVQQIIgatnnmhrrsGNALPPPADEYINSNITSTAKPIAKNSSNIIENPNNGSCADIVAGKSNSLPTAASWVMRVSATLptnknlsgpvrppsnqpkasngpqvpGTEVVSTTISIQTVQPMEAVATSKVHHKLDPLELGKEYIDALSSTNEeatldsipatatsnqyitcrptskssekdiatpssrtsssestkpfsSPGSVEDESSHIVMDFQGLCCGLSSIGLESQFEKDRSLPVVPNSSISKHVSVNLPGSHGPQEEKSGQFTECKSFQASMAAPTMEDSPDFDDLQFKGLEDMHHLPPISSTPHLPHNLNQSSYLSWQAGDVSNQSNLDGHSGNVPLEHKEVLPSRSENLISNGFITNEASSFFNLDATVQHSSLFSEVGFGSYLGKHDSMVAPLHSNVASDVGESSIISKILSLDADAWEDSLTSPYSFAKLLRESNRqhdslkmpslfkesDCRQSRFSFARQEEFSNHASDVEHSLSNIRHSADQHPAPNGLLKNKDIFTDKHQNAFSSSSSMDSDNFLGSHSFISSSVSKAPTSVPPGFAVPNRAPPPGFSPHGTMQKPFDSSASHLRWTSAQAAGNSGPCGDIPFVDPAILEVGKGLQAIGLNNLGCDMRQTPSSQLNPFEHEARLQLLMQQSSSGYQNLRFQDYPMNRFSPPSDTYGISSKVLNQPQPNNLSSFTQSPAQQYRNAHMSTGHLGSLKGVKSINDLGVSDLMTNGGIGFNKFIPSYEDLKCqmsnssnlynrgfam
MSDKAEKTCPLCAEEMDLTDQQLKPCNCGYEICVWCWNHIMEMAEKDGTEGRCPACRTAYDKEKIVGMAANCERAVARMTSERRQKSQKAKPKPSEGRMHLTNVRVIQRNLVYIIGLPINLADEDLLQRKEYFGQYGKVLKVSISRTATGDIQHSANNSCCVYITYSREDDAIRCIQSVHSYILDGRPLRACFGTTKYCHAWIRNMPCSVPDCLYLHDFGSQEDSFTKDEIVSAFTRSRVQQIIGATNNMHRRSGNALPPPADEYINSNITSTAKPIAKNSSNIIENPNNGSCADIVAGKSNSLPTAASWVMRVSATLPTNKNLSGPVRPPSNQPKASNGPQVPGTEVVSTTISIQTVQPMEAVATSKVHHKLDPLELGKEYIDALSSTNEEATLDSIPATATSNQYITCRPTSKSSEKDIAtpssrtsssestkpfsspgsVEDESSHIVMDFQGLCCGLSSIGLESQFEKDRSLPVVPNSSISKHVSVNLPGSHGPQEEKSGQFTECKSFQASMAAPTMEDSPDFDDLQFKGLEDMHHLPPISSTPHLPHNLNQSSYLSWQAGDVSNQSNLDGHSGNVPLEHKEVLPSRSENLISNGFITNEASSFFNLDATVQHSSLFSEVGFGSYLGKHDSMVAPLHSNVASDVGESSIISKILSLDADAWEDSLTSPYSFAKLLRESNRQHDSLKMPSLFKESDCRQSRFSFARQEEFSNHASDVEHSLSNIRHSADQHPAPNGLLKNKDIFTDKHQNAFsssssmdsdNFLGSHSFISSSVSKAPTSVPPGFAVPNRAPPPGFSPHGTMQKPFDSSASHLRWTSAQAAGNSGPCGDIPFVDPAILEVGKGLQAIGLNNLGCDMRQTPSSQLNPFEHEARLQLLMQQSSSGYQNLRFQDYPMNRFSPPSDTYGISSKVLNQPQPNNLSSFTQSPAQQYRNAHMSTGHLGSLKGVKSINDLGVSDLMTNGGIGFNKFIPSYEDLKCQMSNSSNLYNRGFAM
**********LCAEEMDLTDQQLKPCNCGYEICVWCWNHIMEMAEKDGTEGRCPACRTAYDKEKIVGMAANCE**************************HLTNVRVIQRNLVYIIGLPINLADEDLLQRKEYFGQYGKVLKVSISRTATGDIQHSANNSCCVYITYSREDDAIRCIQSVHSYILDGRPLRACFGTTKYCHAWIRNMPCSVPDCLYLHDFGSQEDSFTKDEIVSAFTRSRVQQIIG**************************************************************ASWVMR***************************************ISIQTV**********VHH*LDPLELGKEYI******************************************************************IVMDFQGLCCGLSSIGL********************************************************************************************************************************LISNGFITNEASSFFNLDATVQHSSLFSEVGFGSYLGKHDSMVAPLHSNVASDVGESSIISKILSLDADAWEDSLTSPYSFA********************************************************************************************************************************************************PCGDIPFVDPAILEVGKGLQAIGLNNLGCD***************************************************************************************LKGVKSINDLGVSDLMTNGGIGFNKFIPSYEDLKC***************
****AEKTCPLCAEEMDLTDQQLKPCNCGYEICVWCWNHIMEMAEKDGTEGRCPACRTAYDK*****************************************VRVIQRNLVYIIGLPINLADEDLLQRKEYFGQYGKVLKVSIS**************CCVYITYSREDDAIRCIQSVHSYILDGRPLRACFGTTKYCHAWIRNMPCSVPDCLYLHDFGSQEDSFTK**********************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************AI*******************************************************************************************************GSLKGVKSINDLGVSDLMTNGGIGFNKFIPSYEDLKCQMSNSSNLYNRGFAM
********CPLCAEEMDLTDQQLKPCNCGYEICVWCWNHIMEMAEKDGTEGRCPACRTAYDKEKIVGMAANCERA**********************RMHLTNVRVIQRNLVYIIGLPINLADEDLLQRKEYFGQYGKVLKVSISRTATGDIQHSANNSCCVYITYSREDDAIRCIQSVHSYILDGRPLRACFGTTKYCHAWIRNMPCSVPDCLYLHDFGSQEDSFTKDEIVSAFTRSRVQQIIGATNNMHRRSGNALPPPADEYINSNITSTAKPIAKNSSNIIENPNNGSCADIVAGKSNSLPTAASWVMRVSATLPTNKNLS**********************VVSTTISIQTVQPMEAVATSKVHHKLDPLELGKEYIDALSSTNEEATLDSIPATATSNQYITCR***********************************SSHIVMDFQGLCCGLSSIGLESQFEKDRSLPVVPNSSISKHVSVNLP************FTECKSFQASMAAPTMEDSPDFDDLQFKGLEDMHHLPPISSTPHLPHNLNQSSYLSWQAGDVSNQSNLDGHSGNVPLEHKEVLPSRSENLISNGFITNEASSFFNLDATVQHSSLFSEVGFGSYLGKHDSMVAPLHSNVASDVGESSIISKILSLDADAWEDSLTSPYSFAKLLRESNRQHDSLKMPSLFKESDCRQSRFSFARQEEFSNHASDVEHSLSNIRHSADQHPAPNGLLKNKDIFTDKHQN**********DNFLGSHSFISS*********PPGFAVPNRAPPPGFSPHGTMQKPFDSSASHLRWTSAQAAGNSGPCGDIPFVDPAILEVGKGLQAIGLNNLGCDMRQTPSSQLNPFEHEARLQLLMQQSSSGYQNLRFQDYPMNRFSPPSDTYGISSKVLNQPQPNNLSSFTQSPAQQYRNAHMSTGHLGSLKGVKSINDLGVSDLMTNGGIGFNKFIPSYEDLKCQMSNSSNLYNRGFAM
******KTCPLCAEEMDLTDQQLKPCNCGYEICVWCWNHIMEMAEKDGTEGRCPACRTAYDKEKIVGMAANCERAVARMTSERRQKSQKAKPKPSEGRMHLTNVRVIQRNLVYIIGLPINLADEDLLQRKEYFGQYGKVLKVSISRTATG****SANNSCCVYITYSREDDAIRCIQSVHSYILDGRPLRACFGTTKYCHAWIRNMPCSVPDCLYLHDFGSQEDSFTKDEIVSAF**********************************************************************************************************************************************************************************************************************************************************************************************************************************S***W*AGD*S*******************************************DATVQHS*********SYLGKHDSMVAPLHSNVASDVGESSIISKILSLDADAWEDSLTSPYSFAKLLRE******************************EFSNHASDVEHSLSNIRHSAD********************************NFL****F***SV***PTSVPPGFAVPNRA************************TSAQAAG**GPCGDIPFVDPAILEVGKGLQAIGLNNLGCDMRQTPSSQLNPFEHEARLQLLMQQSSSGYQNLRFQDYPMNRFSPPSDTYGISSKVLNQPQPNNLSSFTQSPAQQYRNAHMSTGHLGSLKGVKSINDLGVSDLMTNGGIGFNKFIPSYEDLKCQMSNSSNLYNRGFAM
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDKAEKTCPLCAEEMDLTDQQLKPCNCGYEICVWCWNHIMEMAEKDGTEGRCPACRTAYDKEKIVGMAANCERAVARMTSERRQKSQKAKPKPSEGRMHLTNVRVIQRNLVYIIGLPINLADEDLLQRKEYFGQYGKVLKVSISRTATGDIQHSANNSCCVYITYSREDDAIRCIQSVHSYILDGRPLRACFGTTKYCHAWIRNMPCSVPDCLYLHDFGSQEDSFTKDEIVSAFTRSRVQQIIGATNNMHRRSGNALPPPADEYINSNITSTAKPIAKNSSNIIENPNNGSCADIVAGKSNSLPTAASWVMRVSATLPTNKNLSGPVRPPSNQPKASNGPQVPGTEVVSTTISIQTVQPMEAVATSKVHHKLDPLELGKEYIDALSSTNEEATLDSIPATATSNQYITCRPTSKSSEKDIATPSSRTSSSESTKPFSSPGSVEDESSHIVMDFQGLCCGLSSIGLESQFEKDRSLPVVPNSSISKHVSVNLPGSHGPQEEKSGQFTECKSFQASMAAPTMEDSPDFDDLQFKGLEDMHHLPPISSTPHLPHNLNQSSYLSWQAGDVSNQSNLDGHSGNVPLEHKEVLPSRSENLISNGFITNEASSFFNLDATVQHSSLFSEVGFGSYLGKHDSMVAPLHSNVASDVGESSIISKILSLDADAWEDSLTSPYSFAKLLRESNRQHDSLKMPSLFKESDCRQSRFSFARQEEFSNHASDVEHSLSNIRHSADQHPAPNGLLKNKDIFTDKHQNAFSSSSSMDSDNFLGSHSFISSSVSKAPTSVPPGFAVPNRAPPPGFSPHGTMQKPFDSSASHLRWTSAQAAGNSGPCGDIPFVDPAILEVGKGLQAIGLNNLGCDMRQTPSSQLNPFEHEARLQLLMQQSSSGYQNLRFQDYPMNRFSPPSDTYGISSKVLNQPQPNNLSSFTQSPAQQYRNAHMSTGHLGSLKGVKSINDLGVSDLMTNGGIGFNKFIPSYEDLKCQMSNSSNLYNRGFAM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query995 2.2.26 [Sep-21-2011]
O95628575 CCR4-NOT transcription co no no 0.229 0.396 0.415 1e-54
Q8BT14575 CCR4-NOT transcription co no no 0.229 0.396 0.415 2e-54
P34909587 General negative regulato yes no 0.319 0.541 0.352 8e-53
Q09818489 Putative general negative yes no 0.224 0.456 0.419 4e-43
Q66JB7380 RNA binding protein fox-1 no no 0.082 0.215 0.266 0.0006
>sp|O95628|CNOT4_HUMAN CCR4-NOT transcription complex subunit 4 OS=Homo sapiens GN=CNOT4 PE=1 SV=3 Back     alignment and function desciption
 Score =  215 bits (547), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 98/236 (41%), Positives = 150/236 (63%), Gaps = 8/236 (3%)

Query: 9   CPLCAEEMDLTDQQLKPCNCGYEICVWCWNHIMEMAEKDGTEGRCPACRTAYDKEKIVGM 68
           CPLC E +++ D    PC CGY+IC +CW+ I     +    G CPACR  Y ++  V  
Sbjct: 14  CPLCMEPLEIDDINFFPCTCGYQICRFCWHRI-----RTDENGLCPACRKPYPEDPAVYK 68

Query: 69  AANCERAVARMTSERRQKSQKAKPKPSEGRMHLTNVRVIQRNLVYIIGLPINLADEDLLQ 128
             + E  + R+ +E++QK  + K K SE R HL +VRV+Q+NLV+++GL   LAD ++L+
Sbjct: 69  PLSQEE-LQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRLADPEVLK 127

Query: 129 RKEYFGQYGKVLKVSISRTATGDIQHSANNSCCVYITYSREDDAIRCIQSVHSYILDGRP 188
           R EYFG++GK+ KV I+ + +     S   S   Y+TY R +DA+R IQ V++ ++DGR 
Sbjct: 128 RPEYFGKFGKIHKVVINNSTS--YAGSQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRT 185

Query: 189 LRACFGTTKYCHAWIRNMPCSVPDCLYLHDFGSQEDSFTKDEIVSAFTRSRVQQII 244
           L+A  GTTKYC  +++NM C  PDC+YLH+ G +  SFTK+E+ +   +   Q+++
Sbjct: 186 LKASLGTTKYCSYFLKNMQCPKPDCMYLHELGDEAASFTKEEMQAGKHQEYEQKLL 241




Has E3 ubiquitin ligase activity. The CCR4-NOT complex functions as general transcription regulation complex.
Homo sapiens (taxid: 9606)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q8BT14|CNOT4_MOUSE CCR4-NOT transcription complex subunit 4 OS=Mus musculus GN=Cnot4 PE=1 SV=2 Back     alignment and function description
>sp|P34909|NOT4_YEAST General negative regulator of transcription subunit 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOT2 PE=1 SV=1 Back     alignment and function description
>sp|Q09818|YAC4_SCHPO Putative general negative regulator of transcription C16C9.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC16C9.04c PE=3 SV=1 Back     alignment and function description
>sp|Q66JB7|RFOX2_XENTR RNA binding protein fox-1 homolog 2 OS=Xenopus tropicalis GN=rbfox2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query995
3594786731024 PREDICTED: uncharacterized protein LOC10 0.967 0.940 0.460 0.0
2977461851022 unnamed protein product [Vitis vinifera] 0.965 0.940 0.459 0.0
3565425731022 PREDICTED: uncharacterized protein LOC10 0.961 0.936 0.438 0.0
3565412791023 PREDICTED: uncharacterized protein LOC10 0.971 0.945 0.437 0.0
3565574791045 PREDICTED: uncharacterized protein LOC10 0.961 0.915 0.432 0.0
3565501791003 PREDICTED: uncharacterized protein LOC10 0.935 0.928 0.424 0.0
357472457 1223 CCR4-NOT transcription complex subunit [ 0.971 0.790 0.418 0.0
3574537191007 CCR4-NOT transcription complex subunit [ 0.958 0.947 0.423 0.0
2977935731001 hypothetical protein ARALYDRAFT_358235 [ 0.940 0.935 0.404 1e-173
334188516987 RNA binding (RRM/RBD/RNP motifs) family 0.944 0.952 0.400 1e-169
>gi|359478673|ref|XP_002281895.2| PREDICTED: uncharacterized protein LOC100267264 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  831 bits (2146), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/1056 (46%), Positives = 632/1056 (59%), Gaps = 93/1056 (8%)

Query: 1    MSDKAEKTCPLCAEEMDLTDQQLKPCNCGYEICVWCWNHIMEMAEKDGTEGRCPACRTAY 60
            MSD+ EKTCPLCAEEMDLTDQQLKPC CGYEICVWCW+HIM MAEKD TEGRCPACR  Y
Sbjct: 1    MSDEGEKTCPLCAEEMDLTDQQLKPCKCGYEICVWCWHHIMNMAEKDETEGRCPACRVPY 60

Query: 61   DKEKIVGMAANCERAVARMTSERRQKSQKAKPKPSEGRMHLTNVRVIQRNLVYIIGLPIN 120
            +KEKIVGMAA+C+R VA +  ER+ KSQKAK K SEGR  L +VRVIQRNLVYI+GLP+N
Sbjct: 61   NKEKIVGMAADCKRLVAEINLERKMKSQKAKTKLSEGRKQLGSVRVIQRNLVYIVGLPLN 120

Query: 121  LADEDLLQRKEYFGQYGKVLKVSISRTATGDIQHSANNSCCVYITYSREDDAIRCIQSVH 180
            LADEDLLQRKEYFG YGKVLKVS+SRTA G IQ   NN+C VYITYS+E++A+RCIQ+VH
Sbjct: 121  LADEDLLQRKEYFGLYGKVLKVSMSRTAAGVIQQFPNNTCSVYITYSKEEEAVRCIQTVH 180

Query: 181  SYILDGRPLRACFGTTKYCHAWIRNMPCSVPDCLYLHDFGSQEDSFTKDEIVSAFTRSRV 240
             ++LDGRPLRACFGTTKYCH W+RN+PC+ PDCLYLH+ GSQEDSFTKDEI+S++TR+RV
Sbjct: 181  GFVLDGRPLRACFGTTKYCHQWLRNVPCNNPDCLYLHEIGSQEDSFTKDEIISSYTRNRV 240

Query: 241  QQIIGATNNMHRRSGNALPPPADEYINSNITSTAKPIAKNSSNIIENPNNGSCADIVAGK 300
            QQI GATNN+ RRSGN LPPPADEY N++  S  KPI KN+SN   +   GS  +  +G+
Sbjct: 241  QQITGATNNLQRRSGNMLPPPADEYCNNSSASMGKPITKNASNNSVSIAKGSPPNSSSGR 300

Query: 301  SNSLPTAASWVMRVSATLPTNKNLSGPVRPPSNQPKASNGPQVPGTEVVSTTISIQTVQP 360
            SN+LP AASW MR S +     +LS    P   +P + +G     + V STT+ + T   
Sbjct: 301  SNALPAAASWGMRSSNSQTMASSLSCGNGPFKQKPDSFSGSVAFSSAVTSTTLPLTT--- 357

Query: 361  MEAVAT-SKV---------------HHKLDPLELGKEYIDALSSTNEEATLDSIPATATS 404
             +AVA  S+V                 KL+ LE  K++I ++ ++    T D  PA+   
Sbjct: 358  -QAVALHSEVGKKPTLNEENRLINPKGKLESLESMKQHI-SMDTSEGLITPDEAPASLPL 415

Query: 405  NQYITCRPTSKSSEKDIATPSSRTSSSESTKPFSSPGSVEDESSHIVMDFQGLCCGLSSI 464
               ++C PTSK +++ I+     T+SS+ T+  +  GS  + +     +   L   +SS+
Sbjct: 416  GGQLSCPPTSKDNDRGISLSPKVTNSSDFTRQPNCSGSEREGNVATDGNLHNLLSDMSSM 475

Query: 465  GLESQFEKDRSLPVVPNSSISKHVSVNLPGSHGPQEEKSGQFTEC--------------- 509
             ++ Q + +    +  N S+S +     PGS G Q+  + QF E                
Sbjct: 476  SIDRQLKSEHPGVLRSNCSLSDNGLTQTPGSQGLQQYYAEQFKESLTSPVSRKVSTTING 535

Query: 510  ----------KSFQASMAAPTM-----EDSPDFDDLQFKGLEDMHHLPPISSTPHLPHNL 554
                      +S   +   P M     +D   FD+ + K  E +     + ++ HL H+ 
Sbjct: 536  VCVPDEQNDWRSDSQTQVVPNMCSEMEDDLLSFDNQRLKDSEVVSGTTYLPNSSHLLHHS 595

Query: 555  NQSSYLSWQAGDVSNQSNLDGHSGNVPLEHKE--VLPSRSENLISNGFITNEASSFFNLD 612
            N     S Q  D+ N  + +     V  +  E  +  +   ++ISNGF      +   LD
Sbjct: 596  NDLRGKSSQHNDIHNGVSFNADPIFVGRKFSEGSLTHAPGASVISNGFPEKRVGNSAGLD 655

Query: 613  ATVQHSSLFSEVGFGSYLGKHDSMVAPLHSNVASDVGESSIISKILSLDADAWEDSLTSP 672
                                        +++   DVGE+SIIS ILSLD DAW+DS+TSP
Sbjct: 656  RA--------------------------NASTTMDVGENSIISNILSLDFDAWDDSITSP 689

Query: 673  YSFAKLLRESNRQHDSLKMPSLFKESDCRQSRFSFARQEEFSNHASDVEHSLSNIRHSAD 732
             + A+LL E+++QH SLK    +K  +  QSRFSFARQEE  N   D+E S SNI     
Sbjct: 690  QNLAQLLGENDKQHSSLKTSGSWKVQNSNQSRFSFARQEESKNQVFDIEPSFSNIGQVPR 749

Query: 733  QHPAPNGLLKNKDIFTDKHQNA--FSSSSSMDSDNFLGSHSFISS---SVSKAPTSVPPG 787
                    ++++D F DK  N   FSS+   +SDNF   HS ISS   S S+A  S PPG
Sbjct: 750  NCSFNQNFVESRDPFLDKLGNGSLFSSNIFGESDNFAPGHSVISSNKISASRAQISAPPG 809

Query: 788  FAVPNRAPPPGFSPHGTMQKPFDS-SASHLRWTSA-------QAAGNSGPCGDIPFVDPA 839
            F VP+RAPPPGFS H   ++ FD+ S +HL  TS+         +GN    GDI F+DPA
Sbjct: 810  FTVPSRAPPPGFSSHERTEQAFDAISGNHLLDTSSLLRNPYQTPSGNIASAGDIEFIDPA 869

Query: 840  ILEVGKGLQAIGLNNLGCDMRQTPSSQLNPFEHEARLQLLMQQSSSGYQNLRFQDYPMNR 899
            IL VGKG    GLNN   DMR     QL+ FE+EARLQLLMQ+S S +QNLRF D     
Sbjct: 870  ILAVGKGRLPGGLNNPALDMRSNFHPQLSAFENEARLQLLMQRSLSPHQNLRFADIGEG- 928

Query: 900  FSPPSDTYGISSKVLNQPQPNNLSSFTQSPAQQYRNAHMSTGHLGSLKGVKSINDLGVSD 959
            FSP  D YGI S+++ Q Q +N+S F Q   QQ RNA MS GH      ++S NDL +++
Sbjct: 929  FSPLGDAYGIPSRLMEQSQASNISPFAQLSLQQSRNAIMSNGHWDGWNEIQSGNDLNMAE 988

Query: 960  LMTNGGIGFNKFIPSYEDLKCQMSNSSNLYNRGFAM 995
            L+ N  +G+NKF   YED K +M  S +LYNR F +
Sbjct: 989  LLRNERLGYNKFYTGYEDSKFRMPPSGDLYNRTFGI 1024




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297746185|emb|CBI16241.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356542573|ref|XP_003539741.1| PREDICTED: uncharacterized protein LOC100801880 [Glycine max] Back     alignment and taxonomy information
>gi|356541279|ref|XP_003539106.1| PREDICTED: uncharacterized protein LOC100813427 [Glycine max] Back     alignment and taxonomy information
>gi|356557479|ref|XP_003547043.1| PREDICTED: uncharacterized protein LOC100796804 [Glycine max] Back     alignment and taxonomy information
>gi|356550179|ref|XP_003543466.1| PREDICTED: uncharacterized protein LOC100805811 [Glycine max] Back     alignment and taxonomy information
>gi|357472457|ref|XP_003606513.1| CCR4-NOT transcription complex subunit [Medicago truncatula] gi|355507568|gb|AES88710.1| CCR4-NOT transcription complex subunit [Medicago truncatula] Back     alignment and taxonomy information
>gi|357453719|ref|XP_003597140.1| CCR4-NOT transcription complex subunit [Medicago truncatula] gi|355486188|gb|AES67391.1| CCR4-NOT transcription complex subunit [Medicago truncatula] Back     alignment and taxonomy information
>gi|297793573|ref|XP_002864671.1| hypothetical protein ARALYDRAFT_358235 [Arabidopsis lyrata subsp. lyrata] gi|297310506|gb|EFH40930.1| hypothetical protein ARALYDRAFT_358235 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|334188516|ref|NP_001190578.1| RNA binding (RRM/RBD/RNP motifs) family protein [Arabidopsis thaliana] gi|332009906|gb|AED97289.1| RNA binding (RRM/RBD/RNP motifs) family protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query995
TAIR|locus:2085617989 AT3G45630 [Arabidopsis thalian 0.951 0.957 0.384 5.3e-143
TAIR|locus:2056563960 AT2G28540 [Arabidopsis thalian 0.403 0.417 0.525 1.3e-141
UNIPROTKB|E2QXU8710 CNOT4 "Uncharacterized protein 0.272 0.381 0.385 9.7e-58
RGD|1310318710 Cnot4 "CCR4-NOT transcription 0.272 0.381 0.385 1.2e-57
UNIPROTKB|F1MAD6713 Cnot4 "Protein Cnot4" [Rattus 0.229 0.319 0.415 2e-54
UNIPROTKB|F8VQP3713 CNOT4 "CCR4-NOT transcription 0.229 0.319 0.415 2e-54
UNIPROTKB|F1MWA7642 CNOT4 "Uncharacterized protein 0.229 0.355 0.415 5.2e-54
UNIPROTKB|E2QXU7642 CNOT4 "Uncharacterized protein 0.229 0.355 0.415 5.2e-54
SGD|S000000870587 MOT2 "Ubiquitin-protein ligase 0.406 0.688 0.321 1.6e-53
UNIPROTKB|E2QXU6572 CNOT4 "Uncharacterized protein 0.272 0.473 0.385 2.7e-53
TAIR|locus:2085617 AT3G45630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1398 (497.2 bits), Expect = 5.3e-143, P = 5.3e-143
 Identities = 399/1037 (38%), Positives = 555/1037 (53%)

Query:     1 MSDKAEKTCPLCAEEMDLTDQQLKPCNCGYEICVWCWNHIMEMAEKDGTEGRCPACRTAY 60
             MSD  EKTCPLCAEEMDLTDQQLKPC CGY+ICVWCW+HIM+MAEKD +EGRCPACRT Y
Sbjct:     1 MSDYGEKTCPLCAEEMDLTDQQLKPCKCGYQICVWCWHHIMDMAEKDQSEGRCPACRTPY 60

Query:    61 DKEKIVGMAANCERAVARMTSERRQKSQKAKPKPSEGRMHLTNVRVIQRNLVYIIGLPIN 120
             DKEKIVGM  + ER  +    +R+ K QK+KPK S+GR  LT+VRV+QRNLVYI+GLP+N
Sbjct:    61 DKEKIVGMTVDQERLASEGNMDRK-KIQKSKPKSSDGRKPLTSVRVVQRNLVYIVGLPLN 119

Query:   121 LADEDLLQRKEYFGQYGKVLKVSISRTATGDIQHSANNSCCVYITYSREDDAIRCIQSVH 180
             LADEDLLQRKEYFGQYGKVLKVS+SRTATG IQ   NN+C VYITY +E++AIRCIQSVH
Sbjct:   120 LADEDLLQRKEYFGQYGKVLKVSMSRTATGLIQQFPNNTCSVYITYGKEEEAIRCIQSVH 179

Query:   181 SYILDGRPLRACFGTTKYCHAWIRNMPCSVPDCLYLHDFGSQEDSFTKDEIVSAFTRSRV 240
              +ILDG+ L+ACFGTTKYCHAW+RN+ C+  DCLYLH+ GSQEDSFTKDEI+SA TR  V
Sbjct:   180 GFILDGKALKACFGTTKYCHAWLRNVACNNQDCLYLHEVGSQEDSFTKDEIISAHTR--V 237

Query:   241 QQIIGATNNMHRRSGNALPPPADEYINSNITSTAKPIAK-NSSNIIENPNNGSCADIVAG 299
             QQI GATN M  RSG+ LPPP D Y + +  ST  PIAK  SS  +  P +   +   +G
Sbjct:   238 QQITGATNTMQYRSGSMLPPPLDAYTSDS--STGNPIAKVPSSTSVSAPKSSPPSGS-SG 294

Query:   300 KSNSLPTAASWVMRVSA--TLPTNKNLSGPVRPPSNQPKAS-NGPQVPGTEV-------V 349
             KS +LP AASW  R++   +L T+   +G +    NQ   S NG     T V       V
Sbjct:   295 KSTALPAAASWGARLTNQHSLATSALSNGSL---DNQRSTSENGTLATSTVVTKAANGPV 351

Query:   350 STTISIQTV---QPMEAVATSKVHHKLDPLELGKEYIDALS----STNEEATLDSIPATA 402
             S++ S+Q     + ++++A       L PL+  K  +D  S    S N + + + I    
Sbjct:   352 SSSNSLQKAPLKEEIQSLAEKSKPGVLKPLQQ-KIVLDPESKRTTSPNRDPSSNQISCLV 410

Query:   403 TS--NQYITCRPTS--KSSE--KDIAXXXXXXXXXXXXXX-XXXXXXVEDESSHIVMDFQ 455
              S  N  +  +P++   S E   +IA                       DE+  + +   
Sbjct:   411 ESSYNSRVIDKPSAVENSLEHTSEIAEDVFDVGKLSADVAWMGITTNSRDETPGVPVVI- 469

Query:   456 GLCCGLSSIGLESQFEKD-RSLPVVPNSSISK---HVSVNLPGSHGPQEEKSGQFTECKS 511
             G  C L SI   +Q + D ++L      S +       ++L G HG + E   + +  +S
Sbjct:   470 GTHCDLGSI---TQSDNDVQNLEQCRKQSPTNTYAEADISLNGIHGSRPEWDWR-SGLQS 525

Query:   512 FQASMAAPT-MEDSPDFDDLQFKGLEDM--HHLPPISSTPHLPHNLNQSSYLSWQAGDVS 568
              Q  +  P  + D   F++ + +G+ +   H     SS+  +  + N  +  S+Q  + S
Sbjct:   526 -QIDVKEPLEVNDFSSFNNNR-RGIAEAVSHSTSKFSSSISILDS-NHLASRSFQNRETS 582

Query:   569 NQSNLDGHSGNVPLEHKEVLPSRSENLISNGFITNEASSFFNLDATVQHSSLFSEVGFGS 628
                 +D  +G+      E+   R    + NGF + +A S       ++HS LF+  G  +
Sbjct:   583 --CGMDSKTGS----SFEIGSDRLH--LPNGF-SEKAMS------NMEHS-LFANEGRSN 626

Query:   629 YLGKHDSMVAPLHSNVAS-DVGESSIISKILSLDADAWEDSLTSPYSFAKLLRESNRQHD 687
                  D ++    SN+   D  + S+ S+          D   S    + LL++ N Q  
Sbjct:   627 IQNTEDDII----SNILDFDPWDESLTSQHNFAKLLGQSDHRASTLESSNLLKQHNDQSR 682

Query:   688 SLKMPSLFKESDCRQSRFSFARQEEFSNHASDVEHSLSNIRHSADQHPAPNGLLKNKDIF 747
                       S    +R S++   + S      E   +   +  D+  + NG   N   +
Sbjct:   683 FSFARHEESNSQAYDNR-SYSIYGQLSRDQPLQEFGANRDMYQ-DKLGSQNGFASN---Y 737

Query:   748 TDKHQNAFXXXXXXXXXNFLGSHSFISSSVS-KAPTSVPP-GFAVPNRAPPPGFSPHGTM 805
             +  ++  F             + + +S+     AP  +PP GF+   R         GT 
Sbjct:   738 SGGYEQ-FATSPGLSSYKSPVARTQVSAPPGFSAPNRLPPPGFSSHQRGDLSSDIASGT- 795

Query:   806 QKPFDSSASHLR--WTSAQAAGNSGPCGDIPFVDPAILEVGKGLQAIGLNNLGCDMRQTP 863
              +  DS A+ LR  +     +GN    GDI F+DPAIL VG+G    G+     D+R   
Sbjct:   796 -RLLDS-ANLLRNAYHVPPPSGNLNAAGDIEFIDPAILAVGRGRLHNGMETADFDLRSGF 853

Query:   864 SSQLNPFEHEARLQLLMQQSSSGYQNLRFQDYP--MNRFSPP-SDTYGISSKVLNQPQPN 920
             SSQLN F+++ARLQLL Q+S +  Q   F D P  +N FS   SD YGISS+  +Q Q  
Sbjct:   854 SSQLNSFDNDARLQLLAQRSLAAQQVNGFHD-PRNVNNFSSSFSDPYGISSRPTDQTQGT 912

Query:   921 NLSSFTQSPAQQYRNAHMSTGHLGSL-KGVKSINDLGVSDLMTNGGIGFNKFIPS-YEDL 978
              LS FTQ P Q   N  +S GH  +     +S N+LG++ L+ N  +GFN  + S +E+ 
Sbjct:   913 GLSPFTQLPRQASANPLLSNGHWDNKWNEPQSGNNLGITQLLRNERMGFNDNVYSGFEEP 972

Query:   979 KCQMSNSSNLYNRGFAM 995
             K +     + YNR + +
Sbjct:   973 KFRRPGPGDPYNRTYGI 989




GO:0000166 "nucleotide binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003723 "RNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
GO:0009506 "plasmodesma" evidence=IDA
TAIR|locus:2056563 AT2G28540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E2QXU8 CNOT4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1310318 Cnot4 "CCR4-NOT transcription complex, subunit 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MAD6 Cnot4 "Protein Cnot4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F8VQP3 CNOT4 "CCR4-NOT transcription complex subunit 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MWA7 CNOT4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QXU7 CNOT4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
SGD|S000000870 MOT2 "Ubiquitin-protein ligase subunit of the CCR4-NOT complex" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|E2QXU6 CNOT4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00024454001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (1000 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query995
COG5175480 COG5175, MOT2, Transcriptional repressor [Transcri 3e-66
cd1243898 cd12438, RRM_CNOT4, RNA recognition motif in Eukar 5e-52
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 9e-13
pfam0007670 pfam00076, RRM_1, RNA recognition motif 5e-12
smart0036073 smart00360, RRM, RNA recognition motif 7e-11
smart0036170 smart00361, RRM_1, RNA recognition motif 4e-10
pfam1389356 pfam13893, RRM_5, RNA recognition motif 2e-07
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 1e-06
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 3e-06
cd1223289 cd12232, RRM3_U2AF65, RNA recognition motif 3 foun 8e-06
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 4e-05
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 5e-05
cd1237485 cd12374, RRM_UHM_SPF45_PUF60, RNA recognition moti 6e-05
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 9e-05
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 9e-05
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 2e-04
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 2e-04
cd1241774 cd12417, RRM_SAFB_like, RNA recognition motif in t 2e-04
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 2e-04
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 2e-04
cd1238772 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 3e-04
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 4e-04
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 5e-04
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 5e-04
cd1263380 cd12633, RRM1_FCA, RNA recognition motif 1 in plan 5e-04
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 6e-04
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 0.001
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 0.001
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 0.002
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 0.002
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 0.004
>gnl|CDD|227502 COG5175, MOT2, Transcriptional repressor [Transcription] Back     alignment and domain information
 Score =  230 bits (588), Expect = 3e-66
 Identities = 123/382 (32%), Positives = 194/382 (50%), Gaps = 20/382 (5%)

Query: 2   SDKAEKTCPLCAEEMDLTDQQLKPCNCGYEICVWCWNHIMEMAEKDGTEGRCPACRTAYD 61
           S+  E  CPLC E MD+TD+   PC CGY+IC +C+N+I     +    GRCPACR  YD
Sbjct: 10  SEDEEDYCPLCIEPMDITDKNFFPCPCGYQICQFCYNNI-----RQNLNGRCPACRRKYD 64

Query: 62  KEKI--VGMAANCERAVARMTSERRQKSQKAKPKPSEGRMHLTNVRVIQRNLVYIIGLPI 119
            E +  V ++    +       ER+ + ++ K    + R HL+N+RV+Q+NLVY+IG+P 
Sbjct: 65  DENVRYVTLSPEELKMELARKEERKMREKERKEAEGQNRKHLSNIRVVQKNLVYVIGIPP 124

Query: 120 NLADED---LLQRKEYFGQYGKVLKVSISRTATGDIQHSANNSCCVYITYSREDDAIRCI 176
            +ADE+   +L+R EYFGQYGK+ K+ +++  +    +S  +   VYITYS ++DA RCI
Sbjct: 125 KVADEEVAPVLKRHEYFGQYGKIKKIVVNKKTSSL--NSTASHAGVYITYSTKEDAARCI 182

Query: 177 QSVHSYILDGRPLRACFGTTKYCHAWIRNMPCSVPDCLYLHDFGSQEDSFTKDEIVSAFT 236
             V   +LDGR L+A +GTTKYC +++RN  C  PDC+YLH+ G ++DS TKDE+ +   
Sbjct: 183 AEVDGSLLDGRVLKATYGTTKYCTSYLRNAVCPNPDCMYLHEPGPEKDSLTKDELCN--- 239

Query: 237 RSRVQQIIGATNNMHRRSGNALPPPADEYINSNITSTAKPIA-----KNSSNIIENPNNG 291
                      N   +R   +      +    N T T  P A     K+ ++ +    + 
Sbjct: 240 SQHKLHGSEVRNKNKKRIHRSTSTARYDTDLLNFTGTPSPAAMEAQFKHKTSRVFKAPDK 299

Query: 292 SCADIVAGKSNSLPTAASWVMRVSATLPTNKNLSGPVRPPSNQPKASNGPQVPGTEVVST 351
                +   +    T  +     S  LPT  +  G     +     +      G++   +
Sbjct: 300 ILFPPLDFTNTQSATPVTLSNSSSINLPTLNDSLGHHTETTTTTNTNATSHSHGSKKKQS 359

Query: 352 TISIQTVQPMEAVATSKVHHKL 373
             + +   P +A+  +   H L
Sbjct: 360 LAAEEYKDPYDALGNAARLHSL 381


Length = 480

>gnl|CDD|240884 cd12438, RRM_CNOT4, RNA recognition motif in Eukaryotic CCR4-NOT transcription complex subunit 4 (NOT4) and similar proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|214637 smart00361, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|240678 cd12232, RRM3_U2AF65, RNA recognition motif 3 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240820 cd12374, RRM_UHM_SPF45_PUF60, RNA recognition motif in UHM domain of 45 kDa-splicing factor (SPF45) and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold attachment factor (SAFB) family Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|241077 cd12633, RRM1_FCA, RNA recognition motif 1 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 995
COG5175480 MOT2 Transcriptional repressor [Transcription] 100.0
KOG2068327 consensus MOT2 transcription factor [Transcription 100.0
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 99.82
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.45
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.45
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.43
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.37
KOG0114124 consensus Predicted RNA-binding protein (RRM super 99.27
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.26
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 99.21
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.2
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 99.19
smart0036272 RRM_2 RNA recognition motif. 99.18
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 99.18
PLN03120260 nucleic acid binding protein; Provisional 99.17
KOG0125376 consensus Ataxin 2-binding protein (RRM superfamil 99.16
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 99.16
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 99.14
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.13
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.13
TIGR01645612 half-pint poly-U binding splicing factor, half-pin 99.13
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.13
TIGR01645612 half-pint poly-U binding splicing factor, half-pin 99.12
smart0036071 RRM RNA recognition motif. 99.08
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.08
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.08
KOG0122270 consensus Translation initiation factor 3, subunit 99.08
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.08
KOG4207256 consensus Predicted splicing factor, SR protein su 99.07
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 99.04
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 99.04
PLN03213759 repressor of silencing 3; Provisional 99.04
KOG0121153 consensus Nuclear cap-binding protein complex, sub 99.02
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.02
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 99.0
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 98.99
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 98.96
smart0036170 RRM_1 RNA recognition motif. 98.94
TIGR01648578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 98.92
KOG0126219 consensus Predicted RNA-binding protein (RRM super 98.91
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 98.89
PLN03121243 nucleic acid binding protein; Provisional 98.87
TIGR01648578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 98.85
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 98.84
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 98.8
KOG0108435 consensus mRNA cleavage and polyadenylation factor 98.77
KOG0117506 consensus Heterogeneous nuclear ribonucleoprotein 98.73
KOG0113335 consensus U1 small nuclear ribonucleoprotein (RRM 98.61
KOG2068327 consensus MOT2 transcription factor [Transcription 98.57
KOG0117506 consensus Heterogeneous nuclear ribonucleoprotein 98.57
KOG0127678 consensus Nucleolar protein fibrillarin NOP77 (RRM 98.54
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 98.54
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 98.53
KOG0127678 consensus Nucleolar protein fibrillarin NOP77 (RRM 98.52
KOG0144510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 98.52
KOG0132894 consensus RNA polymerase II C-terminal domain-bind 98.4
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 98.4
KOG0124544 consensus Polypyrimidine tract-binding protein PUF 98.3
KOG4661940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 98.27
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 98.25
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 98.22
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 98.21
KOG0533243 consensus RRM motif-containing protein [RNA proces 98.21
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 98.17
KOG0144510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 98.17
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 98.16
KOG0123369 consensus Polyadenylate-binding protein (RRM super 98.12
KOG0109346 consensus RNA-binding protein LARK, contains RRM a 98.11
KOG0153377 consensus Predicted RNA-binding protein (RRM super 98.05
KOG0123369 consensus Polyadenylate-binding protein (RRM super 98.04
KOG0151877 consensus Predicted splicing regulator, contains R 98.02
KOG0109346 consensus RNA-binding protein LARK, contains RRM a 97.97
KOG0415479 consensus Predicted peptidyl prolyl cis-trans isom 97.96
KOG1548382 consensus Transcription elongation factor TAT-SF1 97.89
KOG4660549 consensus Protein Mei2, essential for commitment t 97.82
KOG1548382 consensus Transcription elongation factor TAT-SF1 97.78
KOG0124544 consensus Polypyrimidine tract-binding protein PUF 97.75
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 97.65
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 97.63
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 97.62
KOG4454267 consensus RNA binding protein (RRM superfamily) [G 97.53
KOG2202260 consensus U2 snRNP splicing factor, small subunit, 97.48
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 97.48
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 97.48
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 97.38
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 97.29
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 97.28
KOG4212608 consensus RNA-binding protein hnRNP-M [RNA process 97.25
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 97.22
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 97.12
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 97.11
KOG1995351 consensus Conserved Zn-finger protein [General fun 97.07
KOG4212608 consensus RNA-binding protein hnRNP-M [RNA process 97.01
PLN021891040 cellulose synthase 97.0
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 96.97
KOG1457284 consensus RNA binding protein (contains RRM repeat 96.94
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 96.9
KOG1996378 consensus mRNA splicing factor [RNA processing and 96.88
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 96.87
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 96.79
PLN024361094 cellulose synthase A 96.68
cd0016245 RING RING-finger (Really Interesting New Gene) dom 96.61
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 96.6
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 96.53
KOG2314698 consensus Translation initiation factor 3, subunit 96.47
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 96.44
PHA02929238 N1R/p28-like protein; Provisional 96.33
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 96.13
KOG4211510 consensus Splicing factor hnRNP-F and related RNA- 95.8
PLN022481135 cellulose synthase-like protein 95.53
KOG4210285 consensus Nuclear localization sequence binding pr 95.42
KOG2177386 consensus Predicted E3 ubiquitin ligase [Posttrans 95.41
PLN02195977 cellulose synthase A 95.41
smart0050463 Ubox Modified RING finger domain. Modified RING fi 95.38
KOG1365508 consensus RNA-binding protein Fusilli, contains RR 95.17
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 95.09
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 95.08
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 95.07
PF1463444 zf-RING_5: zinc-RING finger domain 95.07
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 94.91
KOG3152278 consensus TBP-binding protein, activator of basal 94.91
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 94.88
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 94.82
TIGR00599397 rad18 DNA repair protein rad18. This family is bas 94.81
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 94.72
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 94.44
PF1456980 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A. 94.34
COG5236493 Uncharacterized conserved protein, contains RING Z 94.31
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 94.15
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 94.08
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 94.04
PLN026381079 cellulose synthase A (UDP-forming), catalytic subu 94.03
PLN029151044 cellulose synthase A [UDP-forming], catalytic subu 93.98
KOG0226290 consensus RNA-binding proteins [General function p 93.81
PHA02926242 zinc finger-like protein; Provisional 93.66
KOG4307944 consensus RNA binding protein RBM12/SWAN [General 93.24
PLN024001085 cellulose synthase 93.19
PF04641260 Rtf2: Rtf2 RING-finger 93.0
KOG2416718 consensus Acinus (induces apoptotic chromatin cond 92.75
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 92.69
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 92.51
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 92.35
KOG0129520 consensus Predicted RNA-binding protein (RRM super 92.29
KOG3002299 consensus Zn finger protein [General function pred 92.21
KOG4285350 consensus Mitotic phosphoprotein [Cell cycle contr 91.81
KOG4211510 consensus Splicing factor hnRNP-F and related RNA- 91.65
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 91.53
COG5432391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 90.79
KOG0112975 consensus Large RNA-binding protein (RRM superfami 90.69
KOG1457284 consensus RNA binding protein (contains RRM repeat 90.57
KOG0129520 consensus Predicted RNA-binding protein (RRM super 90.08
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 89.42
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 88.58
KOG0115275 consensus RNA-binding protein p54nrb (RRM superfam 88.06
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 87.34
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 87.27
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 86.42
KOG2164513 consensus Predicted E3 ubiquitin ligase [Posttrans 85.67
KOG1365508 consensus RNA-binding protein Fusilli, contains RR 85.56
KOG1855484 consensus Predicted RNA-binding protein [General f 85.4
KOG4307944 consensus RNA binding protein RBM12/SWAN [General 85.36
KOG0311381 consensus Predicted E3 ubiquitin ligase [Posttrans 85.08
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 84.71
KOG3800300 consensus Predicted E3 ubiquitin ligase containing 84.46
KOG2135526 consensus Proteins containing the RNA recognition 83.54
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 83.26
KOG0287442 consensus Postreplication repair protein RAD18 [Re 83.21
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 83.14
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 82.36
KOG2857157 consensus Predicted MYND Zn-finger protein/hormone 81.16
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 80.93
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
Probab=100.00  E-value=4.4e-79  Score=648.59  Aligned_cols=229  Identities=45%  Similarity=0.920  Sum_probs=207.1

Q ss_pred             CcccCCCCCCcccCCCccCCCccccCCCCchhhhhHHHHHHhhhccCCCCCCccccccccccchhccccchHHHHHHH--
Q 001921            2 SDKAEKTCPLCAEEMDLTDQQLKPCNCGYEICVWCWNHIMEMAEKDGTEGRCPACRTAYDKEKIVGMAANCERAVARM--   79 (995)
Q Consensus         2 sDe~d~~CPLC~EelD~TD~~F~PC~CGYQIC~fC~h~I~~~aek~~~~grCPACRrpYdee~I~~~~~~~eel~a~~--   79 (995)
                      |+|+|..||||+|+||+||++|+||+||||||+||||+|+     .+.+||||||||-|+++.+.|.++++||+..++  
T Consensus        10 sedeed~cplcie~mditdknf~pc~cgy~ic~fc~~~ir-----q~lngrcpacrr~y~denv~~~~~s~ee~kmel~r   84 (480)
T COG5175          10 SEDEEDYCPLCIEPMDITDKNFFPCPCGYQICQFCYNNIR-----QNLNGRCPACRRKYDDENVRYVTLSPEELKMELAR   84 (480)
T ss_pred             cccccccCcccccccccccCCcccCCcccHHHHHHHHHHH-----hhccCCChHhhhhccccceeEEecCHHHHHHHHHh
Confidence            4566677999999999999999999999999999999996     479999999999999999999999999997664  


Q ss_pred             HHHHHHhhhhcCCCCCcCcCCCCCcccccCCEEEEeCCCCCCChHH---HHHhHhhhcCCCceEEEEEeecCCCCcccCC
Q 001921           80 TSERRQKSQKAKPKPSEGRMHLTNVRVIQRNLVYIIGLPINLADED---LLQRKEYFGQYGKVLKVSISRTATGDIQHSA  156 (995)
Q Consensus        80 ~~~kkqK~qk~K~k~se~RK~LanVRVIQKNLVYVvGLP~~IAeED---LLRk~EyFGQYGKIiKIvInrd~~g~~q~~~  156 (995)
                      +.+||++++++|+.+-.+||||+++||||||||||+||++++++|+   +|+++|||||||+|.||+|++.....+  ..
T Consensus        85 k~erk~rekerke~e~~nrkhlsniRVvQKNLvYVigi~pkva~Ee~~~vLk~~eyFGQyGkI~KIvvNkkt~s~n--st  162 (480)
T COG5175          85 KEERKMREKERKEAEGQNRKHLSNIRVVQKNLVYVIGIPPKVADEEVAPVLKRHEYFGQYGKIKKIVVNKKTSSLN--ST  162 (480)
T ss_pred             hhhhhccHHHHhhhhcccccccccceeeecceeEEecCCCCCCcccccccccchhhhhhccceeEEEecccccccc--cc
Confidence            3466666777788888899999999999999999999999999999   899999999999999999998664321  11


Q ss_pred             CCCcEEEEEeCCHHHHHHHHHHhCCCCCCCeEEEEEeccCCcccccccCCCCCCCCCcccccCCCCCCCccHHHHHHhhc
Q 001921          157 NNSCCVYITYSREDDAIRCIQSVHSYILDGRPLRACFGTTKYCHAWIRNMPCSVPDCLYLHDFGSQEDSFTKDEIVSAFT  236 (995)
Q Consensus       157 ~~rgsAYVTFsrkEDA~rAIqaLNG~~LdGRvLRASfGTTKYCs~FLRn~~C~NpdCmYLHE~g~e~DsfTKeEm~s~~t  236 (995)
                      ....++||||.++|||.+||..|||..+|||.|||+|||||||++||||++|.||+||||||.|+++|+|||+||....+
T Consensus       163 ~~h~gvYITy~~kedAarcIa~vDgs~~DGr~lkatYGTTKYCtsYLRn~~CpNp~CMyLHEpg~e~Ds~tK~el~n~qh  242 (480)
T COG5175         163 ASHAGVYITYSTKEDAARCIAEVDGSLLDGRVLKATYGTTKYCTSYLRNAVCPNPDCMYLHEPGPEKDSLTKDELCNSQH  242 (480)
T ss_pred             cccceEEEEecchHHHHHHHHHhccccccCceEeeecCchHHHHHHHcCCCCCCCCeeeecCCCcccccccHHHHhhhhh
Confidence            22367899999999999999999999999999999999999999999999999999999999999999999999997544


Q ss_pred             c
Q 001921          237 R  237 (995)
Q Consensus       237 r  237 (995)
                      .
T Consensus       243 ~  243 (480)
T COG5175         243 K  243 (480)
T ss_pred             h
Confidence            3



>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>PLN02189 cellulose synthase Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>PLN02436 cellulose synthase A Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>PLN02248 cellulose synthase-like protein Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02195 cellulose synthase A Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PLN02638 cellulose synthase A (UDP-forming), catalytic subunit Back     alignment and domain information
>PLN02915 cellulose synthase A [UDP-forming], catalytic subunit Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>PLN02400 cellulose synthase Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only] Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG2857 consensus Predicted MYND Zn-finger protein/hormone receptor interactor [Transcription] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query995
2cpi_A111 Solution Structure Of The Rna Recognition Motif Of 5e-20
1ur6_B52 Nmr Based Structural Model Of The Ubch5b-Cnot4 Comp 1e-08
1e4u_A78 N-Terminal Ring Finger Domain Of Human Not-4 Length 3e-08
>pdb|2CPI|A Chain A, Solution Structure Of The Rna Recognition Motif Of Cnot4 Length = 111 Back     alignment and structure

Iteration: 1

Score = 97.1 bits (240), Expect = 5e-20, Method: Composition-based stats. Identities = 46/96 (47%), Positives = 68/96 (70%), Gaps = 2/96 (2%) Query: 104 VRVIQRNLVYIIGLPINLADEDLLQRKEYFGQYGKVLKVSISRTATGDIQHSANNSCCVY 163 VRV+Q+NLV+++GL LAD ++L+R EYFG++GK+ KV I+ + + S S Y Sbjct: 10 VRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHKVVINNSTS--YAGSQGPSASAY 67 Query: 164 ITYSREDDAIRCIQSVHSYILDGRPLRACFGTTKYC 199 +TY R +DA+R IQ V++ ++DGR L+A GTTKYC Sbjct: 68 VTYIRSEDALRAIQCVNNVVVDGRTLKASLGTTKYC 103
>pdb|1UR6|B Chain B, Nmr Based Structural Model Of The Ubch5b-Cnot4 Complex Length = 52 Back     alignment and structure
>pdb|1E4U|A Chain A, N-Terminal Ring Finger Domain Of Human Not-4 Length = 78 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query995
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 2e-38
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 3e-20
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 1e-09
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-09
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 3e-05
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 6e-04
2f3j_A177 RNA and export factor binding protein 2; RRM domai 3e-09
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 9e-09
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 1e-08
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 1e-08
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 2e-08
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 2e-08
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 3e-08
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 2e-07
2kt5_A124 RNA and export factor-binding protein 2; chaperone 4e-08
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 5e-08
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 7e-08
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 1e-05
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 6e-04
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 8e-08
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 8e-08
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 9e-08
2i2y_A150 Fusion protein consists of immunoglobin G- binding 1e-07
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 1e-07
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 3e-07
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 6e-07
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 7e-07
1x5p_A97 Negative elongation factor E; structure genomics, 7e-07
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 8e-07
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 9e-07
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 1e-05
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 1e-06
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 1e-06
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 1e-06
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 2e-05
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 1e-06
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 2e-04
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 1e-06
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 1e-06
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 1e-06
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 1e-06
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 1e-06
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 1e-06
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 1e-06
2cpj_A99 Non-POU domain-containing octamer-binding protein; 2e-06
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 2e-06
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-06
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 2e-06
1x5o_A114 RNA binding motif, single-stranded interacting pro 2e-06
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 2e-06
1x4e_A85 RNA binding motif, single-stranded interacting pro 2e-06
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 2e-06
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 2e-04
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 3e-06
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 3e-06
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 3e-06
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 3e-06
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 3e-06
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 3e-06
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 4e-06
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 5e-06
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 6e-06
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 5e-05
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 6e-06
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 6e-06
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 6e-06
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 6e-06
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 7e-06
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 7e-06
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 8e-06
2krb_A81 Eukaryotic translation initiation factor 3 subunit 8e-06
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 9e-06
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 9e-06
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 9e-06
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 9e-06
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 1e-05
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-05
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 2e-05
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 2e-05
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 5e-05
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 2e-05
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 2e-05
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 3e-05
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 3e-05
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 4e-04
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 3e-05
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 3e-05
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 3e-05
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 3e-05
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 3e-05
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 4e-05
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 5e-05
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 5e-05
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 6e-05
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 6e-05
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 6e-05
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 6e-05
2dit_A112 HIV TAT specific factor 1 variant; structural geno 7e-05
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 8e-05
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 8e-05
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 9e-05
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 9e-05
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 9e-05
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-04
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 1e-04
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 1e-04
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 1e-04
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 1e-04
2dis_A109 Unnamed protein product; structural genomics, RRM 1e-04
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 1e-04
2dnl_A114 Cytoplasmic polyadenylation element binding protei 2e-04
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 2e-04
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 2e-04
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 2e-04
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 2e-04
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 2e-04
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 2e-04
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 2e-04
2cph_A107 RNA binding motif protein 19; RNA recognition moti 2e-04
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 3e-04
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 3e-04
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 3e-04
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 4e-04
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 4e-04
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 5e-04
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 5e-04
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 5e-04
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 6e-04
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 6e-04
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 6e-04
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 6e-04
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 8e-04
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 8e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-04
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 9e-04
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
 Score =  138 bits (348), Expect = 2e-38
 Identities = 46/103 (44%), Positives = 69/103 (66%), Gaps = 2/103 (1%)

Query: 97  GRMHLTNVRVIQRNLVYIIGLPINLADEDLLQRKEYFGQYGKVLKVSISRTATGDIQHSA 156
                 +VRV+Q+NLV+++GL   LAD ++L+R EYFG++GK+ KV I+ + +     S 
Sbjct: 3   SGSSGASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHKVVINNSTSY--AGSQ 60

Query: 157 NNSCCVYITYSREDDAIRCIQSVHSYILDGRPLRACFGTTKYC 199
             S   Y+TY R +DA+R IQ V++ ++DGR L+A  GTTKYC
Sbjct: 61  GPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASLGTTKYC 103


>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} PDB: 3us5_A 2dny_A Length = 118 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Length = 105 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Length = 105 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Length = 114 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Length = 104 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Length = 93 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query995
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.84
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.65
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.6
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.6
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.6
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.6
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.6
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.59
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.58
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.58
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.58
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.57
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.57
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.57
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.57
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.57
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.57
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.57
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.57
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.56
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.56
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.56
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.56
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.56
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.56
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.55
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.55
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.55
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.55
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.55
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.55
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.55
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.55
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.54
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.54
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.54
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.54
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.54
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.54
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.54
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.54
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.53
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.53
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.53
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.53
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.53
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.53
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.52
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.52
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.52
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.52
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.52
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.52
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.52
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.51
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.51
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.51
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.51
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.51
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.51
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.51
2div_A99 TRNA selenocysteine associated protein; structural 99.51
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.5
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.5
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.5
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.5
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.5
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.5
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.5
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.5
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.49
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.49
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.49
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.49
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.49
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.49
2dis_A109 Unnamed protein product; structural genomics, RRM 99.48
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.48
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.48
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.48
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.48
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.48
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.48
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.48
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.48
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.48
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.48
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.48
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.47
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.47
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.47
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.47
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.47
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.47
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.47
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.47
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.47
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.47
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.47
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.47
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.46
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.46
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.46
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.46
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.46
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.46
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.46
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.46
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.46
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.45
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.45
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.45
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.45
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.45
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.45
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.44
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.44
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.44
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.44
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.44
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.43
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.43
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.43
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.43
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.43
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.43
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.42
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.42
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.42
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.42
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.42
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.42
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.42
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.41
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.41
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.41
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.41
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.41
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.4
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.4
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.4
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.4
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.4
1x5p_A97 Negative elongation factor E; structure genomics, 99.39
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.39
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.39
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.39
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.39
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.39
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.38
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.09
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.38
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.38
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.37
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.37
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.37
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.37
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.36
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.36
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.36
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.36
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.35
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.35
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.34
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.34
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.34
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.32
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.32
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.31
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.3
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.29
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.29
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.29
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.28
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.28
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.28
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.28
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.26
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.25
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.25
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.25
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.25
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.24
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.24
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.24
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.23
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.23
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.22
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.22
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.21
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.21
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.21
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.21
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.2
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.19
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.19
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.16
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.14
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.13
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.12
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.12
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.06
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.05
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 98.92
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 98.9
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.78
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 98.65
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.5
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.3
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.11
2ecm_A55 Ring finger and CHY zinc finger domain- containing 97.77
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 97.77
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 97.73
2ect_A78 Ring finger protein 126; metal binding protein, st 97.68
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 97.66
2ysl_A73 Tripartite motif-containing protein 31; ring-type 97.62
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 97.62
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 97.62
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 97.6
2ecw_A85 Tripartite motif-containing protein 30; metal bind 97.58
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 97.55
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 97.52
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 97.51
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 97.49
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 97.42
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 97.4
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 97.4
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 97.39
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 97.36
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 97.35
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 97.33
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 97.31
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 97.23
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 97.16
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 97.1
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 97.09
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 97.06
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 97.04
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 97.04
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 97.04
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 97.03
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 97.03
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 96.95
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 96.94
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 96.89
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 96.89
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 96.83
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 96.82
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 96.81
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 96.78
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 96.77
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 96.76
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 96.74
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 96.72
1z6u_A150 NP95-like ring finger protein isoform B; structura 96.68
2ea5_A68 Cell growth regulator with ring finger domain prot 96.68
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 96.63
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 96.59
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 96.53
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 96.49
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 96.44
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 96.4
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 96.39
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 96.38
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 96.3
2ysj_A63 Tripartite motif-containing protein 31; ring-type 96.25
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.04
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 95.9
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 95.89
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 95.88
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 95.67
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 95.63
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 95.61
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 95.59
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 95.56
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 95.38
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 94.77
2f42_A179 STIP1 homology and U-box containing protein 1; cha 94.36
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 94.06
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 93.89
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 93.83
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 93.41
2i2y_A150 Fusion protein consists of immunoglobin G- binding 92.5
3pq1_A464 Poly(A) RNA polymerase; nucleotidyl transferase, R 91.59
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 90.14
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 89.9
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 89.85
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 89.7
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 87.05
3nw0_A238 Non-structural maintenance of chromosomes element 81.55
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 81.24
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
Probab=99.84  E-value=7.8e-21  Score=171.00  Aligned_cols=103  Identities=45%  Similarity=0.779  Sum_probs=90.9

Q ss_pred             cCCCCCcccccCCEEEEeCCCCCCChHHHHHhHhhhcCCCceEEEEEeecCCCCcccCCCCCcEEEEEeCCHHHHHHHHH
Q 001921           98 RMHLTNVRVIQRNLVYIIGLPINLADEDLLQRKEYFGQYGKVLKVSISRTATGDIQHSANNSCCVYITYSREDDAIRCIQ  177 (995)
Q Consensus        98 RK~LanVRVIQKNLVYVvGLP~~IAeEDLLRk~EyFGQYGKIiKIvInrd~~g~~q~~~~~rgsAYVTFsrkEDA~rAIq  177 (995)
                      -++++++|++++++|||+|||+.+++++|++..++|++||+|.+|.|.++..+.  ....++|+|||+|.+.++|.+||+
T Consensus         4 ~s~~~~~r~~~~~~l~V~nLp~~~~~~~l~~~~~~F~~~G~i~~v~i~~~~~~~--~~~~~~G~afV~f~~~~~A~~Ai~   81 (111)
T 2cpi_A            4 GSSGASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHKVVINNSTSYA--GSQGPSASAYVTYIRSEDALRAIQ   81 (111)
T ss_dssp             CSSCSCCCCCCSSCEEEEEECTTTCCHHHHHSTTTTTTTSCEEEEEEECCSSCC--SSSCCCEEEEEEESSHHHHHHHHH
T ss_pred             CCCCccccccCCCEEEEECCCCCCCHHHHHHHHHHhhccCCEEEEEEecCCCcC--ccCCCCeEEEEEECcHHHHHHHHH
Confidence            358899999999999999999999999985334899999999999998776432  112457999999999999999999


Q ss_pred             HhCCCCCCCeEEEEEeccCCccccc
Q 001921          178 SVHSYILDGRPLRACFGTTKYCHAW  202 (995)
Q Consensus       178 aLNG~~LdGRvLRASfGTTKYCs~F  202 (995)
                      .|||..++||.|+|.|+++|+|+.|
T Consensus        82 ~lng~~~~gr~l~V~~a~~k~~~~~  106 (111)
T 2cpi_A           82 CVNNVVVDGRTLKASLGTTKYCSYS  106 (111)
T ss_dssp             HHTTEEETTEEEEEESCCCCSCSST
T ss_pred             HhCCCEECCEEEEEEeccccccccc
Confidence            9999999999999999999999876



>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 995
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 5e-17
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 2e-10
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 4e-10
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 1e-09
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 2e-09
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 2e-09
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 8e-09
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 1e-08
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 1e-08
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 2e-08
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 3e-08
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 4e-08
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 6e-08
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 8e-08
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-07
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 2e-07
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 3e-07
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 3e-07
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 4e-07
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 4e-07
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 4e-07
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 6e-07
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 6e-07
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 9e-07
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 1e-06
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 2e-06
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 2e-06
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 3e-06
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 5e-06
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 7e-06
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 8e-06
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 1e-05
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 1e-05
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 2e-05
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-05
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 2e-05
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 2e-05
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 2e-05
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 3e-05
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 4e-05
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 5e-05
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 8e-05
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 8e-05
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 1e-04
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 2e-04
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 2e-04
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 2e-04
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 7e-04
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 0.001
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 0.001
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 0.002
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 0.002
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 0.002
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 0.002
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 0.002
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 0.003
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 0.004
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 0.004
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: E3 ubiquitin protein ligase CNOT4
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 74.9 bits (183), Expect = 5e-17
 Identities = 40/89 (44%), Positives = 63/89 (70%), Gaps = 2/89 (2%)

Query: 103 NVRVIQRNLVYIIGLPINLADEDLLQRKEYFGQYGKVLKVSISRTATGDIQHSANNSCCV 162
           +VRV+Q+NLV+++GL   LAD ++L+R EYFG++GK+ KV I+ + +     S   S   
Sbjct: 2   SVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHKVVINNSTSYA--GSQGPSASA 59

Query: 163 YITYSREDDAIRCIQSVHSYILDGRPLRA 191
           Y+TY R +DA+R IQ V++ ++DGR L+A
Sbjct: 60  YVTYIRSEDALRAIQCVNNVVVDGRTLKA 88


>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query995
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.88
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.68
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.65
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.65
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.64
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.64
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.64
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.64
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.63
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.62
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.62
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.62
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.61
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.61
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.61
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.6
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.6
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.6
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.6
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.6
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.6
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.59
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.59
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.58
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.58
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.58
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.58
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.57
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.57
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.57
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.57
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.56
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.55
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.54
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.54
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.53
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.53
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.53
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.53
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.53
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.53
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.53
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.53
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.53
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.53
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.52
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.52
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.52
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.51
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.51
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.51
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.5
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.5
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.5
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.47
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.47
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.47
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.46
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.46
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.45
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.45
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.45
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.45
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.44
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.44
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.43
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.42
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.42
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.41
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.4
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.4
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.37
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.37
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.37
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.37
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.36
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.34
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.32
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.32
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.25
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.24
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.22
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.15
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.12
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.11
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.05
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.93
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.84
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.02
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 97.91
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 97.7
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 97.59
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 97.42
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 97.25
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 97.07
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 97.05
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 96.77
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 96.7
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 96.48
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 96.32
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 96.2
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 95.99
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 95.89
d2c2la280 STIP1 homology and U box-containing protein 1, STU 95.81
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 95.6
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 95.57
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 95.15
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 93.24
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 80.28
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: E3 ubiquitin protein ligase CNOT4
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.88  E-value=3.8e-23  Score=180.36  Aligned_cols=89  Identities=45%  Similarity=0.802  Sum_probs=80.2

Q ss_pred             CCcccccCCEEEEeCCCCCCChHHHHHhHhhhcCCCceEEEEEeecCCCCcccCCCCCcEEEEEeCCHHHHHHHHHHhCC
Q 001921          102 TNVRVIQRNLVYIIGLPINLADEDLLQRKEYFGQYGKVLKVSISRTATGDIQHSANNSCCVYITYSREDDAIRCIQSVHS  181 (995)
Q Consensus       102 anVRVIQKNLVYVvGLP~~IAeEDLLRk~EyFGQYGKIiKIvInrd~~g~~q~~~~~rgsAYVTFsrkEDA~rAIqaLNG  181 (995)
                      ++|||||+|+|||+|||+.+++|||++..|+|++||+|.+|.|.+++.+..  ....+|+|||+|.+.|||.+||+.|||
T Consensus         1 ~~~Rviq~n~vyV~nLp~~~t~~~l~~~~e~F~~~G~I~~v~i~~~~~~~~--~~~~~g~aFV~f~~~~~A~~Ai~~lng   78 (89)
T d2cpia1           1 ASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHKVVINNSTSYAG--SQGPSASAYVTYIRSEDALRAIQCVNN   78 (89)
T ss_dssp             SCCCCCCSSCEEEEEECTTTCCHHHHHSTTTTTTTSCEEEEEEECCSSCCS--SSCCCEEEEEEESSHHHHHHHHHHHTT
T ss_pred             CceeEEecCEEEEECCCCccCHHHHHHHHHHhcccCCceEEEEeeccCcCC--CCCcceEEEEecccchhHHHHHHHhCC
Confidence            689999999999999999999999987679999999999999998765431  224568999999999999999999999


Q ss_pred             CCCCCeEEEEE
Q 001921          182 YILDGRPLRAC  192 (995)
Q Consensus       182 ~~LdGRvLRAS  192 (995)
                      ..++||.||||
T Consensus        79 ~~~~gr~lkvS   89 (89)
T d2cpia1          79 VVVDGRTLKAS   89 (89)
T ss_dssp             EEETTEEEEEE
T ss_pred             CEECCEEEEEC
Confidence            99999999997



>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure