BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 001962
         (990 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3TGX|A Chain A, Il-21:il21r Complex
 pdb|3TGX|C Chain C, Il-21:il21r Complex
 pdb|3TGX|E Chain E, Il-21:il21r Complex
 pdb|3TGX|G Chain G, Il-21:il21r Complex
 pdb|3TGX|I Chain I, Il-21:il21r Complex
 pdb|3TGX|K Chain K, Il-21:il21r Complex
 pdb|3TGX|M Chain M, Il-21:il21r Complex
 pdb|3TGX|O Chain O, Il-21:il21r Complex
          Length = 219

 Score = 30.4 bits (67), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 5/54 (9%)

Query: 563 AILELWRPNPSELTLLLTKGI-----EATSLKASPTAYTLTGSSDPCYVEAYHL 611
            ILE+W  +PS LTL           EATS     +A+  T ++  C+++ +H 
Sbjct: 16  CILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHF 69


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.134    0.395 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 24,898,285
Number of Sequences: 62578
Number of extensions: 951311
Number of successful extensions: 1827
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1826
Number of HSP's gapped (non-prelim): 1
length of query: 990
length of database: 14,973,337
effective HSP length: 108
effective length of query: 882
effective length of database: 8,214,913
effective search space: 7245553266
effective search space used: 7245553266
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 56 (26.2 bits)