Citrus Sinensis ID: 001972

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------99
MAQTRRYVPNQQLDLEQILQEAQYRWLRPTEICEILRNYQKFHLTPDPPVRPPAGSLFLFDRKALRYFRKDGHRWRKKKDGKTVKEAHEKLKAGSIDVLHCYYAHGEDNENFQRRSYWMLDGQLEHIVLVHYREVKEGYKSGRSAADPGSQIESSQTSSARSLAQANSSAPAAQTSHASIPNKIDWNGQAVSSEFEDVDSGHGSGTPSVAQSIYGSMSQNASLVAASIAGLPELSRHPQWFAGSKINHGSGSSMWPQIDNSSRNATSVLDQHGHQNFYVGQPSGADFITHKLTDARLASDSTIANIGTCGERLITDIDVHAVTTSSQGASQAGIKPKEELGELKKLDSFGRWMDQEIGGDCDDSLMASDSGNYWNTLDAENDDKEVSSLSHHMQLEMDSLGPSLSQEQLFSIRDFSPDWAYSGAETKVLIIGMFLGTKKLSSDTKWGCMFGEIEVPAEVLTDNVIRCQAPSHAAGRVPFYITGSNRLACSEVREFEYREKPSKAGYPVASKIAPEDEVRLQTRLAKFLYLDPERKWFDCTIEDCNKCKLKNTIYSMRGDSEKDWGRVDESPMAIEGDCPNSRDKLIQNLLRNRLCEWLVWKIHEGGKGPNVIDDGGQGVVHLAAALGYEWAMRPIIATGVSPNFRDARGRTALHWASYFGREETVIMLVKLGAAPGAVEDPTPAFPGGQTAADLASSRGHKGIAGYLAEADLSSHLSSLTVNENGMDNVAAALAAEKANETAAQIGVQSDGPAAEQLSLRGSLAAVRKSAHAAALIQQAFRVRSFRHRQSIQSSDDVSEVSVDLVALGSLNKVSKMIHFEDYLHFAAIKIQQKYRGWKGRKDFLKIRNHIVKLQAHVRGHQVRKQYKKVVWSVSIVEKAILRWRRRGSGLRGFRVGNSTANVASENEKTDEYEFLRIGRKQKFAGVEKALERVKSMVRNPEARDQYMRMVAKFENFKMCDDGSGLLSQGEDSLNGPTKDNLHAYVADQ
ccccccccccccccHHHHHHHHHHHcccHHHHHHHHHcccccccccccccccccccEEEEEHHHHHHHccccccCEEccccccHHHHHHHcccccEEEEEEEEEccccccccccEEEEEcccccccEEEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccEEEEEEEcccccccccccccEEEEEccccccEEEEcccccEEEccccccccccEEEEEcccEEEEEEEEEEECcccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccccHHHHHHHcccHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHccccHccccccccHHHHHHHHHHHHcccccHHHHHHHHHccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHcc
*********NQQLDLEQILQEAQYRWLRPTEICEILRNYQKFHLTPDPPVRPPAGSLFLFDRKALRYFRKDGHRWRKKKD****KEAHEKLKAGSIDVLHCYYAHGEDNENFQRRSYWMLDGQLEHIVLVHYREVK********************************************************************************************************************************************************************************************************************************************************************************LFSIRDFSPDWAYSGAETKVLIIGMFLGTKKLSSDTKWGCMFGEIEVPAEVLTDNVIRCQAPSHAAGRVPFYITGSNRLACSEVREFEYRE********V***IAPEDEVRLQTRLAKFLYLDPERKWFDC*********************EKDWGRVDESPMA*****PNSRDKLIQNLLRNRLCEWLVWKIHEGGKGPNVIDDGGQGVVHLAAALGYEWAMRPIIATGVSPNFRDARGRTALHWASYFGREETVIMLVKLGAAPGAVEDPTPAFPGGQTAADLASSRGHKGIAGYLAEADL**************DNVAAALAAEKANETAAQIGVQSDGPAAEQLSLRGSLAAVRKSAHAAALIQQAFRVRSFRHRQSIQSSDDVSEVSVDLVALGSLNKVSKMIHFEDYLHFAAIKIQQKYRGWKGRKDFLKIRNHIVKLQAHVRGHQVRKQYKKVVWSVSIVEKAILRWRRRGSGL**F******************YEFLRIGRKQKFAGVEKALERVKSMVRN*EA*DQYMRMVAKFENFKMC******************KDNLHAYVA**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQTRRYVPNQQLDLEQILQEAQYRWLRPTEICEILRNYQKFHLTPDPPVRPPAGSLFLFDRKALRYFRKDGHRWRKKKDGKTVKEAHEKLKAGSIDVLHCYYAHGEDNENFQRRSYWMLDGQLEHIVLVHYREVKEGYKSGRSAADPGSQIESSQTSSARSLAQANSSAPAAQTSHASIPNKIDWNGQAVSSEFEDVDSGHGSGTPSVAQSIYGSMSQNASLVAASIAGLPELSRHPQWFAGSKINHGSGSSMWPQIDNSSRNATSVLDQHGHQNFYVGQPSGADFITHKLTDARLASDSTIANIGTCGERLITDIDVHAVTTSSQGASQAGIKPKEELGELKKLDSFGRWMDQEIGGDCDDSLMASDSGNYWNTLDAENDDKEVSSLSHHMQLEMDSLGPSLSQEQLFSIRDFSPDWAYSGAETKVLIIGMFLGTKKLSSDTKWGCMFGEIEVPAEVLTDNVIRCQAPSHAAGRVPFYITGSNRLACSEVREFEYREKPSKAGYPVASKIAPEDEVRLQTRLAKFLYLDPERKWFDCTIEDCNKCKLKNTIYSMRGDSEKDWGRVDESPMAIEGDCPNSRDKLIQNLLRNRLCEWLVWKIHEGGKGPNVIDDGGQGVVHLAAALGYEWAMRPIIATGVSPNFRDARGRTALHWASYFGREETVIMLVKLGAAPGAVEDPTPAFPGGQTAADLASSRGHKGIAGYLAEADLSSHLSSLTVNENGMDNVAAALAAEKANETAAQIGVQSDGPAAEQLSLRGSLAAVRKSAHAAALIQQAFRVRSFRHRQSIQSSDDVSEVSVDLVALGSLNKVSKMIHFEDYLHFAAIKIQQKYRGWKGRKDFLKIRNHIVKLQAHVRGHQVRKQYKKVVWSVSIVEKAILRWRRRGSGLRGFRVGNSTANVASENEKTDEYEFLRIGRKQKFAGVEKALERVKSMVRNPEARDQYMRMVAKFENFKMCDDGSGLLSQGEDSLNGPTKDNLHAYVADQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Calmodulin-binding transcription activator 3 Regulates transcriptional activity in response to calcium signals. Binds to the consensus sequence 5'-[ACG]CGCG[GTC]-3'.probableQ8GSA7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1N11, chain A
Confidence level:very confident
Coverage over the Query: 583-747
View the alignment between query and template
View the model in PyMOL
Template: 1N11, chain A
Confidence level:very confident
Coverage over the Query: 582-770
View the alignment between query and template
View the model in PyMOL
Template: 2DFS, chain A
Confidence level:very confident
Coverage over the Query: 770-890,925-949
View the alignment between query and template
View the model in PyMOL
Template: 2CXK, chain A
Confidence level:very confident
Coverage over the Query: 408-500
View the alignment between query and template
View the model in PyMOL
Template: 2JEE, chain A
Confidence level:probable
Coverage over the Query: 919-985
View the alignment between query and template
View the model in PyMOL