Citrus Sinensis ID: 001985
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 986 | ||||||
| 255544824 | 968 | copper-transporting atpase p-type, putat | 0.978 | 0.996 | 0.808 | 0.0 | |
| 224057465 | 974 | heavy metal ATPase [Populus trichocarpa] | 0.980 | 0.992 | 0.797 | 0.0 | |
| 225435482 | 976 | PREDICTED: putative copper-transporting | 0.980 | 0.990 | 0.774 | 0.0 | |
| 147865599 | 985 | hypothetical protein VITISV_016015 [Viti | 0.972 | 0.973 | 0.760 | 0.0 | |
| 391225619 | 963 | heavy metal ATPase 5 [Silene vulgaris] | 0.968 | 0.991 | 0.723 | 0.0 | |
| 391225617 | 959 | heavy metal ATPase 5 [Silene vulgaris] | 0.968 | 0.995 | 0.720 | 0.0 | |
| 356504410 | 954 | PREDICTED: putative copper-transporting | 0.963 | 0.995 | 0.739 | 0.0 | |
| 357513319 | 957 | Heavy metal ATPase [Medicago truncatula] | 0.966 | 0.995 | 0.719 | 0.0 | |
| 413936201 | 974 | hypothetical protein ZEAMMB73_147775 [Ze | 0.978 | 0.990 | 0.708 | 0.0 | |
| 242060864 | 974 | hypothetical protein SORBIDRAFT_04g00660 | 0.975 | 0.987 | 0.707 | 0.0 |
| >gi|255544824|ref|XP_002513473.1| copper-transporting atpase p-type, putative [Ricinus communis] gi|223547381|gb|EEF48876.1| copper-transporting atpase p-type, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 1613 bits (4177), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 786/972 (80%), Positives = 884/972 (90%), Gaps = 7/972 (0%)
Query: 10 MEGERGDDGLKEPLLLQHVNGVAIDIPPQQQFSYDG--SKKLRTVKFKIREIKCASCATS 67
M G DGLK PLL Q + VAI +P + DG + K++T+K KI EIKC SCATS
Sbjct: 1 MNQANGKDGLKAPLL-QPPDNVAISVPKHK----DGRDNNKVKTIKLKIGEIKCTSCATS 55
Query: 68 IESVLSNLNGVESAVVSPLEGQAVVKFIPGLITAKRIKETVEEAGFPVDDFPEQDIAVCR 127
+ESVL LNGV+ VVSPL+G A + ++P L+TA+ IKE++E AGFPVD+FPEQ+I+VCR
Sbjct: 56 VESVLQELNGVDRVVVSPLDGHAAISYVPDLVTAQNIKESIEAAGFPVDEFPEQEISVCR 115
Query: 128 LRIKGMMCTSCSESVERAIEMVDGVKKAVVGVALEEAKVHFDPNLTDTDHIVEAIEDAGF 187
LRIKGM CTSCSESVERA+ M +GVKKAVVG+ALEEAKVHFDPNLTDTDHI+EA+EDAGF
Sbjct: 116 LRIKGMACTSCSESVERALLMANGVKKAVVGLALEEAKVHFDPNLTDTDHIIEAVEDAGF 175
Query: 188 GADLISSGKDVNKVHLKLEGLNSSEDATFVQNFLESTQGVSQVEIDLSEHKVTVSYDPNL 247
GA+LISSG DVNKVHLKLEG+NS EDAT VQ+ LES +GV+ VE+DL+EHK+TVSYDP L
Sbjct: 176 GAELISSGHDVNKVHLKLEGINSVEDATIVQSSLESARGVNHVEMDLAEHKITVSYDPEL 235
Query: 248 TGPRSIIQYLEEASHGPNIYHASLYTPPKRRETERLKETQMYRNRFFISCLFSVPVLLFS 307
GPRSII+ +EEAS GPN+Y A+LY PP+RRETE+L+ET+ YRN+FF+SCLFS+PV LFS
Sbjct: 236 IGPRSIIKCIEEASAGPNVYCANLYVPPRRRETEQLQETRTYRNQFFLSCLFSIPVFLFS 295
Query: 308 MVLPMIPTYGNWLDYKVHNMLTIGMLLRWILCTPVQFIVGQRFYVGAYHALRRRSANMDV 367
MVLPM+ +YGNWL+Y++ NMLT GMLLRWILCTPVQFIVG+RFY+GAYHALRR+SANMDV
Sbjct: 296 MVLPMLHSYGNWLEYRIQNMLTFGMLLRWILCTPVQFIVGRRFYMGAYHALRRKSANMDV 355
Query: 368 LVALGTNAAYFYSVYIAVKALTSNTFEGQDFFETSAMLISFILLGKYLEVVAKGKTSDAL 427
LVALGTNAAYFYSVYI +KA+TS+ FEGQDFFETSAMLISFILLGKYLEV+AKGKTSDAL
Sbjct: 356 LVALGTNAAYFYSVYIVIKAITSDKFEGQDFFETSAMLISFILLGKYLEVLAKGKTSDAL 415
Query: 428 AKLTDLAPDTAHLLTLDGEGNVISEMDINTQLMQKNDIIKILPGEKVPVDGVVTDGQSYV 487
AKLT+L+PDTAHLLTLD +GNV+SEMDI+T+L+++NDIIKI+PGEKVPVDG+V DGQS+V
Sbjct: 416 AKLTELSPDTAHLLTLDTDGNVVSEMDISTELIERNDIIKIVPGEKVPVDGIVADGQSHV 475
Query: 488 NESMITGEAKPIAKGPGDKVIGGTMNENGCLQVKATHVGSETALSQIVQLVEAAQLARAP 547
NESMITGEA+P+AK PGDKVIGGTMNENGCL VKATHVGSETALSQIVQLVEAAQLARAP
Sbjct: 476 NESMITGEARPVAKKPGDKVIGGTMNENGCLLVKATHVGSETALSQIVQLVEAAQLARAP 535
Query: 548 VQKLADQISRFFVPMVVAAAFITWLGWFIPGVAGLYPKHWIPKVMDEFELALQFGISVLV 607
VQKLADQIS+FFVP VV AAFITWLGWFIPG AGLYP+HWIPK MD FELALQFGISVLV
Sbjct: 536 VQKLADQISKFFVPAVVIAAFITWLGWFIPGEAGLYPRHWIPKAMDSFELALQFGISVLV 595
Query: 608 VACPCALGLATPTAVMVATGKGASLGVLIKGGNALEKAHKVKTVVFDKTGTLTVGKPEVV 667
VACPCALGLATPTAVMVATGKGAS GVLIKGGNALEKAHKVKTVVFDKTGTLT+GKP VV
Sbjct: 596 VACPCALGLATPTAVMVATGKGASQGVLIKGGNALEKAHKVKTVVFDKTGTLTIGKPVVV 655
Query: 668 SAVLFSHFSMEEFCDMATAAEANSEHPIAKAVVEHAKKLRQKLGSPTEHASEAKDFEVHT 727
SAVLFS FSMEEFCDM TAAEANSEHPIAKAVVEH K+LRQK+G TEH +EAKDFEVHT
Sbjct: 656 SAVLFSSFSMEEFCDMVTAAEANSEHPIAKAVVEHVKRLRQKIGFNTEHIAEAKDFEVHT 715
Query: 728 GAGVSGKVGDRTVLVGNKRLMMAFHVPVGPEVDDYMMKNEQLARTCVLVAIDGRVAGAFA 787
G GVSGKVGDRTVLVGNKRLM A++V VG EV++Y+ +NEQLARTCVL AIDG++AGAFA
Sbjct: 716 GTGVSGKVGDRTVLVGNKRLMQAWNVIVGHEVENYISENEQLARTCVLAAIDGKIAGAFA 775
Query: 788 VTDPVKPEAQIVVSSLRSMEISSIMVTGDNWATANAIAKEVGIGKVFAETDPVGKANKIK 847
VTDPVKPEA+ V+S L SM IS+IMVTGDNWATA AIAKEVGI KVFAETDP+GKA++IK
Sbjct: 776 VTDPVKPEAKRVISFLHSMGISAIMVTGDNWATAAAIAKEVGIEKVFAETDPLGKADRIK 835
Query: 848 ELQLKGMTVAMVGDGINDSPALVAADVGMAIGAGTDVAIEAADIVLIKSSLEDVVTAIDL 907
+LQ KGMTVAMVGDGINDSPALVAADVG+AIGAGTDVAIEAADIVLIKS+LEDVVTAIDL
Sbjct: 836 DLQGKGMTVAMVGDGINDSPALVAADVGLAIGAGTDVAIEAADIVLIKSNLEDVVTAIDL 895
Query: 908 SRKTISRIRLNYVWALGYNVLAVPIAAGILYPFTGIRLPPWLAGACMAASSLSVLCSSLL 967
SRKTI RIRLNYVWALGYN+L +PIAAGILYPFTGIRLPPWLAG CMAASSLSV+CSSLL
Sbjct: 896 SRKTIQRIRLNYVWALGYNILGMPIAAGILYPFTGIRLPPWLAGGCMAASSLSVVCSSLL 955
Query: 968 LQSYKKPLHIKD 979
LQSYKKPLH++D
Sbjct: 956 LQSYKKPLHVRD 967
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224057465|ref|XP_002299234.1| heavy metal ATPase [Populus trichocarpa] gi|222846492|gb|EEE84039.1| heavy metal ATPase [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225435482|ref|XP_002282923.1| PREDICTED: putative copper-transporting ATPase 3-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147865599|emb|CAN79386.1| hypothetical protein VITISV_016015 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|391225619|gb|AFM38008.1| heavy metal ATPase 5 [Silene vulgaris] | Back alignment and taxonomy information |
|---|
| >gi|391225617|gb|AFM38007.1| heavy metal ATPase 5 [Silene vulgaris] | Back alignment and taxonomy information |
|---|
| >gi|356504410|ref|XP_003520989.1| PREDICTED: putative copper-transporting ATPase 3-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357513319|ref|XP_003626948.1| Heavy metal ATPase [Medicago truncatula] gi|355520970|gb|AET01424.1| Heavy metal ATPase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|413936201|gb|AFW70752.1| hypothetical protein ZEAMMB73_147775 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|242060864|ref|XP_002451721.1| hypothetical protein SORBIDRAFT_04g006600 [Sorghum bicolor] gi|241931552|gb|EES04697.1| hypothetical protein SORBIDRAFT_04g006600 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 986 | |||
| COG2217 | 713 | COG2217, ZntA, Cation transport ATPase [Inorganic | 0.0 | |
| TIGR01511 | 572 | TIGR01511, ATPase-IB1_Cu, copper-(or silver)-trans | 0.0 | |
| TIGR01525 | 556 | TIGR01525, ATPase-IB_hvy, heavy metal translocatin | 0.0 | |
| PRK10671 | 834 | PRK10671, copA, copper exporting ATPase; Provision | 1e-180 | |
| TIGR01512 | 536 | TIGR01512, ATPase-IB2_Cd, heavy metal-(Cd/Co/Hg/Pb | 1e-137 | |
| TIGR01494 | 543 | TIGR01494, ATPase_P-type, ATPase, P-type (transpor | 1e-108 | |
| PRK11033 | 741 | PRK11033, zntA, zinc/cadmium/mercury/lead-transpor | 1e-91 | |
| pfam00122 | 222 | pfam00122, E1-E2_ATPase, E1-E2 ATPase | 1e-64 | |
| COG0474 | 917 | COG0474, MgtA, Cation transport ATPase [Inorganic | 7e-54 | |
| COG2216 | 681 | COG2216, KdpB, High-affinity K+ transport system, | 2e-52 | |
| TIGR01497 | 675 | TIGR01497, kdpB, K+-transporting ATPase, B subunit | 6e-50 | |
| PRK14010 | 673 | PRK14010, PRK14010, potassium-transporting ATPase | 3e-47 | |
| PRK01122 | 679 | PRK01122, PRK01122, potassium-transporting ATPase | 2e-46 | |
| TIGR01647 | 754 | TIGR01647, ATPase-IIIA_H, plasma-membrane proton-e | 4e-30 | |
| TIGR01116 | 917 | TIGR01116, ATPase-IIA1_Ca, sarco/endoplasmic retic | 3e-22 | |
| TIGR01522 | 884 | TIGR01522, ATPase-IIA2_Ca, golgi membrane calcium- | 6e-22 | |
| TIGR01524 | 867 | TIGR01524, ATPase-IIIB_Mg, magnesium-translocating | 1e-20 | |
| TIGR01517 | 944 | TIGR01517, ATPase-IIB_Ca, plasma-membrane calcium- | 8e-20 | |
| pfam00702 | 187 | pfam00702, Hydrolase, haloacid dehalogenase-like h | 1e-19 | |
| PRK15122 | 903 | PRK15122, PRK15122, magnesium-transporting ATPase; | 3e-17 | |
| TIGR01106 | 997 | TIGR01106, ATPase-IIC_X-K, sodium or proton efflux | 1e-16 | |
| TIGR01517 | 944 | TIGR01517, ATPase-IIB_Ca, plasma-membrane calcium- | 4e-16 | |
| PRK10517 | 902 | PRK10517, PRK10517, magnesium-transporting ATPase | 7e-15 | |
| TIGR01523 | 1053 | TIGR01523, ATPase-IID_K-Na, potassium and/or sodiu | 1e-14 | |
| cd00371 | 63 | cd00371, HMA, Heavy-metal-associated domain (HMA) | 4e-14 | |
| COG2608 | 71 | COG2608, CopZ, Copper chaperone [Inorganic ion tra | 4e-12 | |
| cd00371 | 63 | cd00371, HMA, Heavy-metal-associated domain (HMA) | 2e-11 | |
| pfam00403 | 62 | pfam00403, HMA, Heavy-metal-associated domain | 7e-11 | |
| COG2608 | 71 | COG2608, CopZ, Copper chaperone [Inorganic ion tra | 1e-10 | |
| COG4087 | 152 | COG4087, COG4087, Soluble P-type ATPase [General f | 2e-10 | |
| pfam00403 | 62 | pfam00403, HMA, Heavy-metal-associated domain | 1e-09 | |
| PRK10671 | 834 | PRK10671, copA, copper exporting ATPase; Provision | 2e-08 | |
| COG2217 | 713 | COG2217, ZntA, Cation transport ATPase [Inorganic | 2e-07 | |
| TIGR01106 | 997 | TIGR01106, ATPase-IIC_X-K, sodium or proton efflux | 3e-07 | |
| TIGR02052 | 92 | TIGR02052, MerP, mercuric transport protein peripl | 3e-07 | |
| TIGR01657 | 1054 | TIGR01657, P-ATPase-V, P-type ATPase of unknown pu | 5e-07 | |
| TIGR00003 | 66 | TIGR00003, TIGR00003, copper ion binding protein | 1e-06 | |
| PRK13748 | 561 | PRK13748, PRK13748, putative mercuric reductase; P | 1e-06 | |
| TIGR01116 | 917 | TIGR01116, ATPase-IIA1_Ca, sarco/endoplasmic retic | 3e-06 | |
| TIGR01657 | 1054 | TIGR01657, P-ATPase-V, P-type ATPase of unknown pu | 3e-06 | |
| COG2608 | 71 | COG2608, CopZ, Copper chaperone [Inorganic ion tra | 5e-06 | |
| COG2217 | 713 | COG2217, ZntA, Cation transport ATPase [Inorganic | 7e-05 | |
| TIGR01657 | 1054 | TIGR01657, P-ATPase-V, P-type ATPase of unknown pu | 7e-05 | |
| pfam00403 | 62 | pfam00403, HMA, Heavy-metal-associated domain | 2e-04 | |
| TIGR01487 | 215 | TIGR01487, Pglycolate_arch, phosphoglycolate phosp | 2e-04 | |
| TIGR00003 | 66 | TIGR00003, TIGR00003, copper ion binding protein | 4e-04 | |
| PRK11033 | 741 | PRK11033, zntA, zinc/cadmium/mercury/lead-transpor | 6e-04 | |
| pfam12710 | 122 | pfam12710, HAD, haloacid dehalogenase-like hydrola | 6e-04 | |
| TIGR01522 | 884 | TIGR01522, ATPase-IIA2_Ca, golgi membrane calcium- | 0.001 | |
| TIGR02052 | 92 | TIGR02052, MerP, mercuric transport protein peripl | 0.001 | |
| cd00371 | 63 | cd00371, HMA, Heavy-metal-associated domain (HMA) | 0.002 | |
| PRK01158 | 230 | PRK01158, PRK01158, phosphoglycolate phosphatase; | 0.002 |
| >gnl|CDD|225127 COG2217, ZntA, Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
Score = 778 bits (2012), Expect = 0.0
Identities = 317/755 (41%), Positives = 448/755 (59%), Gaps = 65/755 (8%)
Query: 221 LESTQGVSQVEIDLSEHKVTVSYDPNLTGPRS-IIQYLEEASHGPNIYHASLYTPPKRRE 279
L GV + ++L+ + TV YDP + I+ +E+A Y A L
Sbjct: 23 LNKLPGVEEARVNLATERATVVYDPEEVDLPADIVAAVEKAG-----YSARLTAALADPA 77
Query: 280 TERLKETQMYRNRFFISCLFSVPVLLFSMVLPMIPTYGNWLDYKVHNMLTIGMLLRWILC 339
+ + R I+ L ++P+LL S+ L + W+ ++L
Sbjct: 78 EAEARLLRELLRRLIIAGLLTLPLLLLSLGLLLGAFLLPWV--------------SFLLA 123
Query: 340 TPVQFIVGQRFYVGAYHALRRRSANMDVLVALGTNAAYFYSVYIAVKALTSNTFEGQDFF 399
TPV F G FY GA+ ALRR NMD LVAL T AY YS+Y + + +F
Sbjct: 124 TPVLFYGGWPFYRGAWRALRRGRLNMDTLVALATIGAYAYSLYATLFPV---------YF 174
Query: 400 ETSAMLISFILLGKYLEVVAKGKTSDALAKLTDLAPDTAHLLTLDGEGNVISEMDINTQL 459
E +AMLI LLG+YLE AKG+ A+ L DLAP TA ++ DGE E ++ +
Sbjct: 175 EEAAMLIFLFLLGRYLEARAKGRARRAIRALLDLAPKTATVVRGDGE-----EEEVPVEE 229
Query: 460 MQKNDIIKILPGEKVPVDGVVTDGQSYVNESMITGEAKPIAKGPGDKVIGGTMNENGCLQ 519
+Q DI+ + PGE++PVDGVV G S V+ESM+TGE+ P+ K PGD+V GT+N +G L
Sbjct: 230 VQVGDIVLVRPGERIPVDGVVVSGSSSVDESMLTGESLPVEKKPGDEVFAGTVNLDGSLT 289
Query: 520 VKATHVGSETALSQIVQLVEAAQLARAPVQKLADQISRFFVPMVVAAAFITWLGWFIPGV 579
++ T VG++T L++I++LVE AQ ++AP+Q+LAD+++ +FVP+V+ A +T+ W + G
Sbjct: 290 IRVTRVGADTTLARIIRLVEEAQSSKAPIQRLADRVASYFVPVVLVIAALTFALWPLFGG 349
Query: 580 AGLYPKHWIPKVMDEFELALQFGISVLVVACPCALGLATPTAVMVATGKGASLGVLIKGG 639
+E AL ++VLV+ACPCALGLATPTA++V G+ A G+LIKGG
Sbjct: 350 GD-------------WETALYRALAVLVIACPCALGLATPTAILVGIGRAARRGILIKGG 396
Query: 640 NALEKAHKVKTVVFDKTGTLTVGKPEVVSAVLFSHFSMEEFCDMATAAEANSEHPIAKAV 699
ALE+ KV TVVFDKTGTLT GKPEV V +E +A A E +SEHP+AKA+
Sbjct: 397 EALERLAKVDTVVFDKTGTLTEGKPEVTDVVALDG-DEDELLALAAALEQHSEHPLAKAI 455
Query: 700 VEHAKKLRQKLGSPTEHASEAKDFEVHTGAGVSGKVGDRTVLVGNKRLMMAFHVPVGPEV 759
V+ A + + +DFE G GV +V VLVGN RL+ + + P +
Sbjct: 456 VKAAAERGL---------PDVEDFEEIPGRGVEAEVDGERVLVGNARLLGEEGIDL-PLL 505
Query: 760 DDYMMKNEQLARTCVLVAIDGRVAGAFAVTDPVKPEAQIVVSSLRSMEISSIMVTGDNWA 819
+ + E +T V VA+DG++ G A+ D ++P+A+ +++L+++ I +M+TGDN
Sbjct: 506 SERIEALESEGKTVVFVAVDGKLVGVIALADELRPDAKEAIAALKALGIKVVMLTGDNRR 565
Query: 820 TANAIAKEVGIGKVFAETDPVGKANKIKELQLKGMTVAMVGDGINDSPALVAADVGMAIG 879
TA AIAKE+GI +V AE P KA ++ELQ +G VAMVGDGIND+PAL AADVG+A+G
Sbjct: 566 TAEAIAKELGIDEVRAELLPEDKAEIVRELQAEGRKVAMVGDGINDAPALAAADVGIAMG 625
Query: 880 AGTDVAIEAADIVLIKSSLEDVVTAIDLSRKTISRIRLNYVWALGYNVLAVPIAAGILYP 939
+GTDVAIEAAD+VL++ L V AIDLSR T I+ N WA GYN +A+P+AAG L
Sbjct: 626 SGTDVAIEAADVVLMRDDLSAVPEAIDLSRATRRIIKQNLFWAFGYNAIAIPLAAGGL-- 683
Query: 940 FTGIRLPPWLAGACMAASSLSVLCSSLLLQSYKKP 974
L PW+A M+ SS+ V+ ++L L KP
Sbjct: 684 -----LTPWIAALAMSGSSVLVVLNALRLLRSFKP 713
|
Length = 713 |
| >gnl|CDD|233445 TIGR01511, ATPase-IB1_Cu, copper-(or silver)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|233447 TIGR01525, ATPase-IB_hvy, heavy metal translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|182635 PRK10671, copA, copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|211664 TIGR01512, ATPase-IB2_Cd, heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|233438 TIGR01494, ATPase_P-type, ATPase, P-type (transporting), HAD superfamily, subfamily IC | Back alignment and domain information |
|---|
| >gnl|CDD|236827 PRK11033, zntA, zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215733 pfam00122, E1-E2_ATPase, E1-E2 ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|225126 COG2216, KdpB, High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|130561 TIGR01497, kdpB, K+-transporting ATPase, B subunit | Back alignment and domain information |
|---|
| >gnl|CDD|184448 PRK14010, PRK14010, potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234905 PRK01122, PRK01122, potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233506 TIGR01647, ATPase-IIIA_H, plasma-membrane proton-efflux P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|233277 TIGR01116, ATPase-IIA1_Ca, sarco/endoplasmic reticulum calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|130585 TIGR01522, ATPase-IIA2_Ca, golgi membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|130587 TIGR01524, ATPase-IIIB_Mg, magnesium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|188151 TIGR01517, ATPase-IIB_Ca, plasma-membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|216069 pfam00702, Hydrolase, haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|237914 PRK15122, PRK15122, magnesium-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130176 TIGR01106, ATPase-IIC_X-K, sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|188151 TIGR01517, ATPase-IIB_Ca, plasma-membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|236705 PRK10517, PRK10517, magnesium-transporting ATPase MgtA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130586 TIGR01523, ATPase-IID_K-Na, potassium and/or sodium efflux P-type ATPase, fungal-type | Back alignment and domain information |
|---|
| >gnl|CDD|238219 cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones | Back alignment and domain information |
|---|
| >gnl|CDD|225328 COG2608, CopZ, Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|238219 cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones | Back alignment and domain information |
|---|
| >gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain | Back alignment and domain information |
|---|
| >gnl|CDD|225328 COG2608, CopZ, Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226572 COG4087, COG4087, Soluble P-type ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain | Back alignment and domain information |
|---|
| >gnl|CDD|182635 PRK10671, copA, copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225127 COG2217, ZntA, Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|130176 TIGR01106, ATPase-IIC_X-K, sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|131107 TIGR02052, MerP, mercuric transport protein periplasmic component | Back alignment and domain information |
|---|
| >gnl|CDD|233513 TIGR01657, P-ATPase-V, P-type ATPase of unknown pump specificity (type V) | Back alignment and domain information |
|---|
| >gnl|CDD|188014 TIGR00003, TIGR00003, copper ion binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|184298 PRK13748, PRK13748, putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233277 TIGR01116, ATPase-IIA1_Ca, sarco/endoplasmic reticulum calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|233513 TIGR01657, P-ATPase-V, P-type ATPase of unknown pump specificity (type V) | Back alignment and domain information |
|---|
| >gnl|CDD|225328 COG2608, CopZ, Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|225127 COG2217, ZntA, Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233513 TIGR01657, P-ATPase-V, P-type ATPase of unknown pump specificity (type V) | Back alignment and domain information |
|---|
| >gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain | Back alignment and domain information |
|---|
| >gnl|CDD|213628 TIGR01487, Pglycolate_arch, phosphoglycolate phosphatase, TA0175-type | Back alignment and domain information |
|---|
| >gnl|CDD|188014 TIGR00003, TIGR00003, copper ion binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|236827 PRK11033, zntA, zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221729 pfam12710, HAD, haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|130585 TIGR01522, ATPase-IIA2_Ca, golgi membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|131107 TIGR02052, MerP, mercuric transport protein periplasmic component | Back alignment and domain information |
|---|
| >gnl|CDD|238219 cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones | Back alignment and domain information |
|---|
| >gnl|CDD|234910 PRK01158, PRK01158, phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 986 | |||
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 100.0 | |
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 100.0 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 100.0 | |
| PRK11033 | 741 | zntA zinc/cadmium/mercury/lead-transporting ATPase | 100.0 | |
| TIGR01511 | 562 | ATPase-IB1_Cu copper-(or silver)-translocating P-t | 100.0 | |
| TIGR01525 | 556 | ATPase-IB_hvy heavy metal translocating P-type ATP | 100.0 | |
| TIGR01512 | 536 | ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo | 100.0 | |
| TIGR01647 | 755 | ATPase-IIIA_H plasma-membrane proton-efflux P-type | 100.0 | |
| PRK01122 | 679 | potassium-transporting ATPase subunit B; Provision | 100.0 | |
| PRK14010 | 673 | potassium-transporting ATPase subunit B; Provision | 100.0 | |
| TIGR01497 | 675 | kdpB K+-transporting ATPase, B subunit. One sequen | 100.0 | |
| PRK10517 | 902 | magnesium-transporting ATPase MgtA; Provisional | 100.0 | |
| TIGR01524 | 867 | ATPase-IIIB_Mg magnesium-translocating P-type ATPa | 100.0 | |
| PRK15122 | 903 | magnesium-transporting ATPase; Provisional | 100.0 | |
| TIGR01517 | 941 | ATPase-IIB_Ca plasma-membrane calcium-translocatin | 100.0 | |
| TIGR01522 | 884 | ATPase-IIA2_Ca golgi membrane calcium-translocatin | 100.0 | |
| TIGR01494 | 499 | ATPase_P-type ATPase, P-type (transporting), HAD s | 100.0 | |
| TIGR01106 | 997 | ATPase-IIC_X-K sodium or proton efflux -- potassiu | 100.0 | |
| KOG0202 | 972 | consensus Ca2+ transporting ATPase [Inorganic ion | 100.0 | |
| TIGR01116 | 917 | ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium | 100.0 | |
| TIGR01523 | 1053 | ATPase-IID_K-Na potassium and/or sodium efflux P-t | 100.0 | |
| COG0474 | 917 | MgtA Cation transport ATPase [Inorganic ion transp | 100.0 | |
| KOG0204 | 1034 | consensus Calcium transporting ATPase [Inorganic i | 100.0 | |
| TIGR01657 | 1054 | P-ATPase-V P-type ATPase of unknown pump specifici | 100.0 | |
| COG2216 | 681 | KdpB High-affinity K+ transport system, ATPase cha | 100.0 | |
| KOG0203 | 1019 | consensus Na+/K+ ATPase, alpha subunit [Inorganic | 100.0 | |
| KOG0205 | 942 | consensus Plasma membrane H+-transporting ATPase [ | 100.0 | |
| KOG0208 | 1140 | consensus Cation transport ATPase [Inorganic ion t | 100.0 | |
| TIGR01652 | 1057 | ATPase-Plipid phospholipid-translocating P-type AT | 100.0 | |
| PLN03190 | 1178 | aminophospholipid translocase; Provisional | 100.0 | |
| KOG0209 | 1160 | consensus P-type ATPase [Inorganic ion transport a | 100.0 | |
| KOG0210 | 1051 | consensus P-type ATPase [Inorganic ion transport a | 100.0 | |
| KOG0206 | 1151 | consensus P-type ATPase [General function predicti | 100.0 | |
| PF00122 | 230 | E1-E2_ATPase: E1-E2 ATPase p-type cation-transport | 100.0 | |
| PF00702 | 215 | Hydrolase: haloacid dehalogenase-like hydrolase; I | 99.95 | |
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 99.63 | |
| COG4087 | 152 | Soluble P-type ATPase [General function prediction | 99.62 | |
| COG1778 | 170 | Low specificity phosphatase (HAD superfamily) [Gen | 99.31 | |
| PF00403 | 62 | HMA: Heavy-metal-associated domain; InterPro: IPR0 | 99.23 | |
| TIGR02726 | 169 | phenyl_P_delta phenylphosphate carboxylase, delta | 99.21 | |
| TIGR02137 | 203 | HSK-PSP phosphoserine phosphatase/homoserine phosp | 99.16 | |
| PRK11133 | 322 | serB phosphoserine phosphatase; Provisional | 99.15 | |
| PF00403 | 62 | HMA: Heavy-metal-associated domain; InterPro: IPR0 | 99.15 | |
| TIGR01670 | 154 | YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho | 99.11 | |
| PRK10513 | 270 | sugar phosphate phosphatase; Provisional | 99.09 | |
| PRK01158 | 230 | phosphoglycolate phosphatase; Provisional | 99.07 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 99.06 | |
| TIGR01487 | 215 | SPP-like sucrose-phosphate phosphatase-like hydrol | 99.05 | |
| PRK15126 | 272 | thiamin pyrimidine pyrophosphate hydrolase; Provis | 99.04 | |
| PRK10976 | 266 | putative hydrolase; Provisional | 99.04 | |
| COG0561 | 264 | Cof Predicted hydrolases of the HAD superfamily [G | 99.04 | |
| COG2608 | 71 | CopZ Copper chaperone [Inorganic ion transport and | 99.02 | |
| COG2608 | 71 | CopZ Copper chaperone [Inorganic ion transport and | 99.0 | |
| TIGR01482 | 225 | SPP-subfamily Sucrose-phosphate phosphatase subfam | 98.94 | |
| PRK09484 | 183 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 98.94 | |
| TIGR00338 | 219 | serB phosphoserine phosphatase SerB. Phosphoserine | 98.93 | |
| PRK10530 | 272 | pyridoxal phosphate (PLP) phosphatase; Provisional | 98.92 | |
| COG0546 | 220 | Gph Predicted phosphatases [General function predi | 98.91 | |
| PLN02887 | 580 | hydrolase family protein | 98.89 | |
| PF08282 | 254 | Hydrolase_3: haloacid dehalogenase-like hydrolase; | 98.89 | |
| COG0560 | 212 | SerB Phosphoserine phosphatase [Amino acid transpo | 98.85 | |
| TIGR00099 | 256 | Cof-subfamily Cof subfamily of IIB subfamily of ha | 98.77 | |
| PRK13582 | 205 | thrH phosphoserine phosphatase; Provisional | 98.76 | |
| PRK13222 | 226 | phosphoglycolate phosphatase; Provisional | 98.66 | |
| PRK03669 | 271 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 98.61 | |
| TIGR01491 | 201 | HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa | 98.6 | |
| KOG1615 | 227 | consensus Phosphoserine phosphatase [Amino acid tr | 98.58 | |
| PRK00192 | 273 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 98.56 | |
| PLN02954 | 224 | phosphoserine phosphatase | 98.53 | |
| TIGR01486 | 256 | HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph | 98.48 | |
| TIGR01454 | 205 | AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes | 98.41 | |
| TIGR02471 | 236 | sucr_syn_bact_C sucrose phosphate synthase, sucros | 98.36 | |
| TIGR03333 | 214 | salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl | 98.33 | |
| PRK09552 | 219 | mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp | 98.33 | |
| TIGR01489 | 188 | DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent | 98.3 | |
| PRK13288 | 214 | pyrophosphatase PpaX; Provisional | 98.29 | |
| TIGR01488 | 177 | HAD-SF-IB Haloacid Dehalogenase superfamily, subfa | 98.25 | |
| TIGR01490 | 202 | HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol | 98.23 | |
| TIGR01485 | 249 | SPP_plant-cyano sucrose-6F-phosphate phosphohydrol | 98.22 | |
| PF12710 | 192 | HAD: haloacid dehalogenase-like hydrolase; PDB: 3P | 98.18 | |
| PRK06769 | 173 | hypothetical protein; Validated | 98.17 | |
| PRK13225 | 273 | phosphoglycolate phosphatase; Provisional | 98.16 | |
| TIGR01449 | 213 | PGP_bact 2-phosphoglycolate phosphatase, prokaryot | 98.14 | |
| PRK10187 | 266 | trehalose-6-phosphate phosphatase; Provisional | 98.14 | |
| PRK13223 | 272 | phosphoglycolate phosphatase; Provisional | 98.12 | |
| PRK13226 | 229 | phosphoglycolate phosphatase; Provisional | 98.06 | |
| TIGR01422 | 253 | phosphonatase phosphonoacetaldehyde hydrolase. Thi | 98.02 | |
| PLN02382 | 413 | probable sucrose-phosphatase | 98.0 | |
| PRK08238 | 479 | hypothetical protein; Validated | 97.98 | |
| PLN02770 | 248 | haloacid dehalogenase-like hydrolase family protei | 97.97 | |
| PRK10826 | 222 | 2-deoxyglucose-6-phosphatase; Provisional | 97.95 | |
| PLN03243 | 260 | haloacid dehalogenase-like hydrolase; Provisional | 97.89 | |
| PRK13478 | 267 | phosphonoacetaldehyde hydrolase; Provisional | 97.87 | |
| cd01427 | 139 | HAD_like Haloacid dehalogenase-like hydrolases. Th | 97.86 | |
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 97.85 | |
| PRK06698 | 459 | bifunctional 5'-methylthioadenosine/S-adenosylhomo | 97.84 | |
| TIGR03351 | 220 | PhnX-like phosphonatase-like hydrolase. This clade | 97.78 | |
| TIGR01672 | 237 | AphA HAD superfamily (subfamily IIIB) phosphatase, | 97.71 | |
| PLN02575 | 381 | haloacid dehalogenase-like hydrolase | 97.71 | |
| COG2179 | 175 | Predicted hydrolase of the HAD superfamily [Genera | 97.69 | |
| TIGR01544 | 277 | HAD-SF-IE haloacid dehalogenase superfamily, subfa | 97.69 | |
| PRK12702 | 302 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 97.67 | |
| TIGR02461 | 225 | osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat | 97.62 | |
| TIGR01662 | 132 | HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I | 97.61 | |
| TIGR01668 | 170 | YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph | 97.6 | |
| PRK14988 | 224 | GMP/IMP nucleotidase; Provisional | 97.6 | |
| PRK14501 | 726 | putative bifunctional trehalose-6-phosphate syntha | 97.59 | |
| TIGR02253 | 221 | CTE7 HAD superfamily (subfamily IA) hydrolase, TIG | 97.58 | |
| PRK14502 | 694 | bifunctional mannosyl-3-phosphoglycerate synthase/ | 97.58 | |
| TIGR01548 | 197 | HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, | 97.55 | |
| PRK11009 | 237 | aphA acid phosphatase/phosphotransferase; Provisio | 97.55 | |
| PTZ00174 | 247 | phosphomannomutase; Provisional | 97.55 | |
| TIGR01484 | 204 | HAD-SF-IIB HAD-superfamily hydrolase, subfamily II | 97.51 | |
| PRK11590 | 211 | hypothetical protein; Provisional | 97.51 | |
| PRK08942 | 181 | D,D-heptose 1,7-bisphosphate phosphatase; Validate | 97.51 | |
| TIGR01545 | 210 | YfhB_g-proteo haloacid dehalogenase superfamily, s | 97.45 | |
| TIGR00003 | 68 | copper ion binding protein. This model describes a | 97.42 | |
| PRK11587 | 218 | putative phosphatase; Provisional | 97.41 | |
| PLN02779 | 286 | haloacid dehalogenase-like hydrolase family protei | 97.41 | |
| TIGR01428 | 198 | HAD_type_II 2-haloalkanoic acid dehalogenase, type | 97.4 | |
| PLN02940 | 382 | riboflavin kinase | 97.4 | |
| TIGR02254 | 224 | YjjG/YfnB HAD superfamily (subfamily IA) hydrolase | 97.37 | |
| PRK09449 | 224 | dUMP phosphatase; Provisional | 97.36 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 97.34 | |
| COG4030 | 315 | Uncharacterized protein conserved in archaea [Func | 97.33 | |
| TIGR01685 | 174 | MDP-1 magnesium-dependent phosphatase-1. This mode | 97.3 | |
| PRK11033 | 741 | zntA zinc/cadmium/mercury/lead-transporting ATPase | 97.29 | |
| TIGR00213 | 176 | GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | 97.27 | |
| TIGR01990 | 185 | bPGM beta-phosphoglucomutase. The enzyme from L. l | 97.24 | |
| TIGR00003 | 68 | copper ion binding protein. This model describes a | 97.22 | |
| KOG4656 | 247 | consensus Copper chaperone for superoxide dismutas | 97.17 | |
| PLN02580 | 384 | trehalose-phosphatase | 97.17 | |
| KOG4656 | 247 | consensus Copper chaperone for superoxide dismutas | 97.16 | |
| TIGR02009 | 185 | PGMB-YQAB-SF beta-phosphoglucomutase family hydrol | 97.1 | |
| TIGR01664 | 166 | DNA-3'-Pase DNA 3'-phosphatase. The central phosph | 97.09 | |
| TIGR01509 | 183 | HAD-SF-IA-v3 haloacid dehalogenase superfamily, su | 97.07 | |
| TIGR01656 | 147 | Histidinol-ppas histidinol-phosphate phosphatase f | 97.06 | |
| PF13419 | 176 | HAD_2: Haloacid dehalogenase-like hydrolase; PDB: | 97.06 | |
| COG4359 | 220 | Uncharacterized conserved protein [Function unknow | 97.01 | |
| PLN02811 | 220 | hydrolase | 96.99 | |
| TIGR02252 | 203 | DREG-2 REG-2-like, HAD superfamily (subfamily IA) | 96.95 | |
| TIGR01681 | 128 | HAD-SF-IIIC HAD-superfamily phosphatase, subfamily | 96.9 | |
| TIGR00685 | 244 | T6PP trehalose-phosphatase. At least 18 distinct s | 96.85 | |
| PF05116 | 247 | S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter | 96.8 | |
| PLN02957 | 238 | copper, zinc superoxide dismutase | 96.79 | |
| TIGR01686 | 320 | FkbH FkbH-like domain. The C-terminal portion of t | 96.79 | |
| TIGR01691 | 220 | enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen | 96.75 | |
| TIGR01261 | 161 | hisB_Nterm histidinol-phosphatase. This model desc | 96.74 | |
| PLN02957 | 238 | copper, zinc superoxide dismutase | 96.71 | |
| PLN03017 | 366 | trehalose-phosphatase | 96.71 | |
| PRK05446 | 354 | imidazole glycerol-phosphate dehydratase/histidino | 96.69 | |
| TIGR01549 | 154 | HAD-SF-IA-v1 haloacid dehalogenase superfamily, su | 96.68 | |
| PLN02205 | 854 | alpha,alpha-trehalose-phosphate synthase [UDP-form | 96.65 | |
| TIGR01459 | 242 | HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas | 96.61 | |
| TIGR02463 | 221 | MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r | 96.41 | |
| KOG4383 | 1354 | consensus Uncharacterized conserved protein [Funct | 96.4 | |
| smart00577 | 148 | CPDc catalytic domain of ctd-like phosphatases. | 96.39 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 96.31 | |
| smart00775 | 157 | LNS2 LNS2 domain. This domain is found in Saccharo | 96.23 | |
| PF06888 | 234 | Put_Phosphatase: Putative Phosphatase; InterPro: I | 96.22 | |
| COG3769 | 274 | Predicted hydrolase (HAD superfamily) [General fun | 96.2 | |
| KOG1603 | 73 | consensus Copper chaperone [Inorganic ion transpor | 96.19 | |
| TIGR01533 | 266 | lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil | 96.18 | |
| PRK09456 | 199 | ?-D-glucose-1-phosphatase; Provisional | 96.1 | |
| PF09419 | 168 | PGP_phosphatase: Mitochondrial PGP phosphatase; In | 96.09 | |
| PRK10444 | 248 | UMP phosphatase; Provisional | 96.08 | |
| KOG1603 | 73 | consensus Copper chaperone [Inorganic ion transpor | 96.01 | |
| TIGR02247 | 211 | HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li | 96.0 | |
| PRK10725 | 188 | fructose-1-P/6-phosphogluconate phosphatase; Provi | 95.85 | |
| TIGR01458 | 257 | HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr | 95.8 | |
| PRK10563 | 221 | 6-phosphogluconate phosphatase; Provisional | 95.77 | |
| TIGR01993 | 184 | Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These | 95.51 | |
| TIGR01675 | 229 | plant-AP plant acid phosphatase. This model explic | 95.43 | |
| PLN02151 | 354 | trehalose-phosphatase | 95.28 | |
| PRK10748 | 238 | flavin mononucleotide phosphatase; Provisional | 95.22 | |
| TIGR01457 | 249 | HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr | 95.2 | |
| PHA02597 | 197 | 30.2 hypothetical protein; Provisional | 95.03 | |
| COG1011 | 229 | Predicted hydrolase (HAD superfamily) [General fun | 94.85 | |
| COG0637 | 221 | Predicted phosphatase/phosphohexomutase [General f | 94.62 | |
| PF13344 | 101 | Hydrolase_6: Haloacid dehalogenase-like hydrolase; | 94.56 | |
| KOG3120 | 256 | consensus Predicted haloacid dehalogenase-like hyd | 94.36 | |
| PLN02645 | 311 | phosphoglycolate phosphatase | 94.31 | |
| PLN02423 | 245 | phosphomannomutase | 93.85 | |
| TIGR01684 | 301 | viral_ppase viral phosphatase. These proteins also | 91.84 | |
| KOG3040 | 262 | consensus Predicted sugar phosphatase (HAD superfa | 91.4 | |
| PLN02177 | 497 | glycerol-3-phosphate acyltransferase | 91.07 | |
| TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 91.06 | |
| TIGR01493 | 175 | HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su | 90.78 | |
| PF03767 | 229 | Acid_phosphat_B: HAD superfamily, subfamily IIIB ( | 90.52 | |
| KOG3085 | 237 | consensus Predicted hydrolase (HAD superfamily) [G | 89.72 | |
| TIGR01452 | 279 | PGP_euk phosphoglycolate/pyridoxal phosphate phosp | 89.24 | |
| TIGR02052 | 92 | MerP mercuric transport protein periplasmic compon | 89.17 | |
| PF12689 | 169 | Acid_PPase: Acid Phosphatase; InterPro: IPR010036 | 89.14 | |
| TIGR02251 | 162 | HIF-SF_euk Dullard-like phosphatase domain. This d | 89.05 | |
| TIGR02052 | 92 | MerP mercuric transport protein periplasmic compon | 89.03 | |
| PHA03398 | 303 | viral phosphatase superfamily protein; Provisional | 89.02 | |
| TIGR01680 | 275 | Veg_Stor_Prot vegetative storage protein. The prot | 88.93 | |
| PRK14054 | 172 | methionine sulfoxide reductase A; Provisional | 88.75 | |
| PF02358 | 235 | Trehalose_PPase: Trehalose-phosphatase; InterPro: | 88.34 | |
| COG1877 | 266 | OtsB Trehalose-6-phosphatase [Carbohydrate transpo | 88.03 | |
| COG0647 | 269 | NagD Predicted sugar phosphatases of the HAD super | 87.64 | |
| PF08235 | 157 | LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 | 87.54 | |
| COG0241 | 181 | HisB Histidinol phosphatase and related phosphatas | 87.49 | |
| TIGR02244 | 343 | HAD-IG-Ncltidse HAD superfamily (subfamily IG) hyd | 87.29 | |
| COG0841 | 1009 | AcrB Cation/multidrug efflux pump [Defense mechani | 86.45 | |
| PRK05528 | 156 | methionine sulfoxide reductase A; Provisional | 86.37 | |
| TIGR01452 | 279 | PGP_euk phosphoglycolate/pyridoxal phosphate phosp | 86.26 | |
| TIGR02463 | 221 | MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r | 85.41 | |
| PF13242 | 75 | Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OY | 84.58 | |
| PRK13014 | 186 | methionine sulfoxide reductase A; Provisional | 84.3 | |
| PRK00058 | 213 | methionine sulfoxide reductase A; Provisional | 84.02 | |
| COG0225 | 174 | MsrA Peptide methionine sulfoxide reductase [Postt | 83.61 | |
| PF00873 | 1021 | ACR_tran: AcrB/AcrD/AcrF family; InterPro: IPR0010 | 82.51 | |
| PTZ00445 | 219 | p36-lilke protein; Provisional | 81.86 | |
| TIGR00401 | 149 | msrA methionine-S-sulfoxide reductase. This model | 81.79 | |
| KOG4383 | 1354 | consensus Uncharacterized conserved protein [Funct | 80.84 | |
| COG3700 | 237 | AphA Acid phosphatase (class B) [General function | 80.36 |
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.6e-160 Score=1361.51 Aligned_cols=899 Identities=48% Similarity=0.760 Sum_probs=824.5
Q ss_pred cCCCChhHHHHHHHHHhCCCCceEEEeeccCceEEEEeCCCCCCHHHHHHHHHHcCCCCCCCC--cccceEEEEeecCcc
Q 001985 57 REIKCASCATSIESVLSNLNGVESAVVSPLEGQAVVKFIPGLITAKRIKETVEEAGFPVDDFP--EQDIAVCRLRIKGMM 134 (986)
Q Consensus 57 ~gm~C~~C~~~I~~~l~~~~gv~~~~v~~~~~~~~v~~~~~~~~~~~i~~~v~~~G~~~~~~~--~~~~~~~~~~i~gm~ 134 (986)
.||||..|.+.+++++++.+|+.++.+++.++.+++.|+ +..+++.+.+.++++||++.... .....+..+++.||+
T Consensus 1 ~gmtc~ac~~si~~~~~~~~g~~~i~vsl~~~~~~v~~~-~~~~~~~i~~~ied~gf~~~~~~~~~~~~~~~~l~v~Gmt 79 (951)
T KOG0207|consen 1 KGMTCSACSNSIEKAISRKPGVQKIEVSLAQKRANVSYD-NIVSPESIKETIEDMGFEASLLSDSEITASKCYLSVNGMT 79 (951)
T ss_pred CCccHHHHhhhHHHHHhcCCCceeEEEEeccccceEEEe-eccCHHHHHHHhhcccceeeecccCccccceeEEEecCce
Confidence 489999999999999999999999999999999999999 77999999999999999986332 223346789999999
Q ss_pred ChhhHHHHHHHhhccCCEEEEEeecCCCeEEEEeCCCCCChhHHHHHHHhcCCCcccccCCccc--cceeeeecCCCCch
Q 001985 135 CTSCSESVERAIEMVDGVKKAVVGVALEEAKVHFDPNLTDTDHIVEAIEDAGFGADLISSGKDV--NKVHLKLEGLNSSE 212 (986)
Q Consensus 135 C~~C~~~ie~~l~~~~gV~~~~v~~~~~~~~v~~~~~~~~~~~i~~~i~~~Gy~~~~~~~~~~~--~~~~~~v~Gm~c~~ 212 (986)
|.+|++.+|+.+++.+|+.++.+.+..+++.+.|||..++.+.+.+.++++||++...+..+.. ..+.|.|.||+|.+
T Consensus 80 C~scv~~i~~~l~~~~gv~~~~val~~~~~~v~~dp~v~s~~~~~e~ie~~gf~a~~i~~~~~~~~~~i~L~v~g~~c~s 159 (951)
T KOG0207|consen 80 CASCVATIERNLRKIEGVESAVVALSASKAEVIYDPAVTSPDSIAESIEDLGFSAELIESVNGNSNQKIYLDVLGMTCAS 159 (951)
T ss_pred eHHHHHHHHHHhhccCCcceEEEEeeccceeEEECCcccCchhHHHHHHhcCccceehhcccCCCCCcEEEEeecccccc
Confidence 9999999999999999999999999999999999999999999999999999999876654332 58999999999999
Q ss_pred hHHHHHHhhcCCCCeEEEEEecCCCEEEEEeCCCCCChHHHHHHHHHhcCCCccccccccCCcchhhhHHHHHHHHHHHH
Q 001985 213 DATFVQNFLESTQGVSQVEIDLSEHKVTVSYDPNLTGPRSIIQYLEEASHGPNIYHASLYTPPKRRETERLKETQMYRNR 292 (986)
Q Consensus 213 c~~~ie~~l~~~~gV~~~~vn~~~~~~~v~~~~~~~~~~~i~~~i~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 292 (986)
|+..||+.+.+++||.++++++.++++.|.|||..++++++.+.+++.||.+...... +...........+.+.|++.
T Consensus 160 ~~~~ie~~l~~l~gV~~~sv~~~t~~~~V~~~~~~~~pr~i~k~ie~~~~~~~~~~~~--~~~~~~~l~~~~ei~~w~~~ 237 (951)
T KOG0207|consen 160 CVSKIESILERLRGVKSFSVSLATDTAIVVYDPEITGPRDIIKAIEETGFEASVRPYG--DTTFKNSLKHKEEIRKWKRP 237 (951)
T ss_pred hhhhhHHHHhhccCeeEEEEeccCCceEEEecccccChHHHHHHHHhhcccceeeecc--ccchhhhhhhhhHHHhcchH
Confidence 9999999999999999999999999999999999999999999999999875422100 00111112234566888888
Q ss_pred HHHHHHHHHHHHHHHhccccccccccchhhhhhhhhhHHHHHHHhhccceeEEecHHHHHHHHHHHhcCCCCcchhHhHH
Q 001985 293 FFISCLFSVPVLLFSMVLPMIPTYGNWLDYKVHNMLTIGMLLRWILCTPVQFIVGQRFYVGAYHALRRRSANMDVLVALG 372 (986)
Q Consensus 293 l~~~l~lal~l~l~~~~l~~~~~~~~~~~~~~~~~~~~~~~l~~~la~~v~~~~g~~~~~~a~~~l~~~~~~md~Lv~l~ 372 (986)
+...+.+++|+++..++.++.......+. .+.++.++..++.+.|++|+||..||+||..||++|++++.|||+|++++
T Consensus 238 fl~s~~~~~~v~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~l~~~L~~~vqf~~G~~fy~~A~ksL~~g~~nMdvLv~L~ 316 (951)
T KOG0207|consen 238 FLISLGFSLPVSFAMIICPPLAWILALLV-PFLPGLSYGNSLSFVLATPVQFVGGRPFYLAAYKSLKRGSANMDVLVVLG 316 (951)
T ss_pred HHHHHHHHHHHHHHHHHhccchhhhhhhc-cccccchhhhHHHhhhheeeEEecceeeHHHHHHHHhcCCCCceeehhhH
Confidence 88899999999888777655432122222 33445677789999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHhhccCCCCCcchhhhHHHHHHHHHHHHHHHHHHhhhHHHHHHHHhccCCCeEEEEEecCCCCeeeE
Q 001985 373 TNAAYFYSVYIAVKALTSNTFEGQDFFETSAMLISFILLGKYLEVVAKGKTSDALAKLTDLAPDTAHLLTLDGEGNVISE 452 (986)
Q Consensus 373 ~~~a~~~s~~~~l~~~~~~~~~~~~~~~~~~~l~~~~~~g~~le~~~~~k~~~~l~~l~~~~p~~~~v~~~~r~g~~~~~ 452 (986)
+.++|+||.+..+..... +. +..|||++.|++.|+++|+|+|.+++.|+..++.+|+++.|.++.++ .+|+ .+
T Consensus 317 t~aay~~S~~~~~~~~~~-~~-~~tfFdt~~MLi~fi~lgr~LE~~Ak~kts~alskLmsl~p~~a~ii---~~g~--~e 389 (951)
T KOG0207|consen 317 TTAAYFYSIFSLLAAVVF-DS-PPTFFDTSPMLITFITLGRWLESLAKGKTSEALSKLMSLAPSKATII---EDGS--EE 389 (951)
T ss_pred HHHHHHHHHHHHHHHHHc-cC-cchhccccHHHHHHHHHHHHHHHHhhccchHHHHHHhhcCcccceEe---ecCC--cc
Confidence 999999999998877665 33 78999999999999999999999999999999999999999999999 5662 37
Q ss_pred EEeeCCCcCCCcEEEEcCCCcccccEEEEeccceeeccccccCCcceecCCCCceeeeeeecCceEEEEEEEeCCchHHH
Q 001985 453 MDINTQLMQKNDIIKILPGEKVPVDGVVTDGQSYVNESMITGEAKPIAKGPGDKVIGGTMNENGCLQVKATHVGSETALS 532 (986)
Q Consensus 453 ~~i~~~~l~~GDii~v~~Ge~IPaDg~vl~G~~~Vdes~lTGEs~pv~k~~g~~v~aGs~~~~g~~~~~v~~~g~~t~~~ 532 (986)
++|+.+.|++||+|.|.||++||+||+|++|+++||||++|||+.||.|++|+.|.+||+|.+|.+.++++++|.||.++
T Consensus 390 ~eI~v~lvq~gdivkV~pG~kiPvDG~Vv~Gss~VDEs~iTGEs~PV~Kk~gs~ViaGsiN~nG~l~VkaT~~g~dttla 469 (951)
T KOG0207|consen 390 KEIPVDLVQVGDIVKVKPGEKIPVDGVVVDGSSEVDESLITGESMPVPKKKGSTVIAGSINLNGTLLVKATKVGGDTTLA 469 (951)
T ss_pred eEeeeeeeccCCEEEECCCCccccccEEEeCceeechhhccCCceecccCCCCeeeeeeecCCceEEEEEEeccccchHH
Confidence 89999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHhhcCChHHHHHHHHHhhHHHHHHHHHHHHHHHHHHhhc-cCCCCCcccccchhhHHHHHHHHhhhhhhhcc
Q 001985 533 QIVQLVEAAQLARAPVQKLADQISRFFVPMVVAAAFITWLGWFIPGV-AGLYPKHWIPKVMDEFELALQFGISVLVVACP 611 (986)
Q Consensus 533 ~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~i~vlv~~~P 611 (986)
||+++++++|.+|+|+|+++|+++.||+|.++++++.+|++|++.+. ...++..|. ..+..+++++++|++++||
T Consensus 470 ~IvkLVEEAQ~sKapiQq~aDkia~yFvP~Vi~lS~~t~~~w~~~g~~~~~~~~~~~----~~~~~a~~~aisVlviACP 545 (951)
T KOG0207|consen 470 QIVKLVEEAQLSKAPIQQLADKIAGYFVPVVIVLSLATFVVWILIGKIVFKYPRSFF----DAFSHAFQLAISVLVIACP 545 (951)
T ss_pred HHHHHHHHHHcccchHHHHHHHhhhcCCchhhHHHHHHHHHHHHHccccccCcchhh----HHHHHHHHhhheEEEEECc
Confidence 99999999999999999999999999999999999999999999875 233344443 5788999999999999999
Q ss_pred cchhhhHHHHHHHHHHHHhhcCeEecCchHHhhhcCCcEEEecCCCccccCccEEEEEEecCC-CCHHHHHHHHHHHHhc
Q 001985 612 CALGLATPTAVMVATGKGASLGVLIKGGNALEKAHKVKTVVFDKTGTLTVGKPEVVSAVLFSH-FSMEEFCDMATAAEAN 690 (986)
Q Consensus 612 ~al~la~~~a~~~~~~~~~~~gilvk~~~~le~lg~i~~i~fDKTGTLT~g~~~v~~~~~~~~-~~~~~~~~~~~~~e~~ 690 (986)
|+|+||+|+|++.+++.++++|+|+|+++++|.+.++++|+||||||||+|+|.|.++..+.+ .+..+++.++++.|..
T Consensus 546 CaLgLATPtAvmvatgvgA~nGvLIKGge~LE~~hkv~tVvFDKTGTLT~G~~~V~~~~~~~~~~~~~e~l~~v~a~Es~ 625 (951)
T KOG0207|consen 546 CALGLATPTAVMVATGVGATNGVLIKGGEALEKAHKVKTVVFDKTGTLTEGKPTVVDFKSLSNPISLKEALALVAAMESG 625 (951)
T ss_pred hhhhcCCceEEEEEechhhhcceEEcCcHHHHHHhcCCEEEEcCCCceecceEEEEEEEecCCcccHHHHHHHHHHHhcC
Confidence 999999999999999999999999999999999999999999999999999999999999876 8899999999999999
Q ss_pred CCChHHHHHHHHHHHhhhhcCCCCCCCccccceeeeeCCe--eEEEECCEEEEEecHHHHHhcCCCCChhhHHHHHHHHh
Q 001985 691 SEHPIAKAVVEHAKKLRQKLGSPTEHASEAKDFEVHTGAG--VSGKVGDRTVLVGNKRLMMAFHVPVGPEVDDYMMKNEQ 768 (986)
Q Consensus 691 s~hp~~~ai~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~g--~~~~~~~~~~~vg~~~~~~~~~~~~~~~~~~~~~~~~~ 768 (986)
++||+++||++|+++..... ....+.+|+..+|.| +.+.++++.+.+||++++..++...++++.+.+.+.+.
T Consensus 626 SeHPig~AIv~yak~~~~~~-----~~~~~~~~~~~pg~g~~~~~~~~~~~i~iGN~~~~~r~~~~~~~~i~~~~~~~e~ 700 (951)
T KOG0207|consen 626 SEHPIGKAIVDYAKEKLVEP-----NPEGVLSFEYFPGEGIYVTVTVDGNEVLIGNKEWMSRNGCSIPDDILDALTESER 700 (951)
T ss_pred CcCchHHHHHHHHHhccccc-----CccccceeecccCCCcccceEEeeeEEeechHHHHHhcCCCCchhHHHhhhhHhh
Confidence 99999999999999876321 234567889999999 77888999999999999999999999999999999999
Q ss_pred ccCcEEEEEECCEEEEEEEecCCCChhHHHHHHHHHHCCCeEEEEcCCCHHHHHHHHHHcCCceEEEecCcccHHHHHHH
Q 001985 769 LARTCVLVAIDGRVAGAFAVTDPVKPEAQIVVSSLRSMEISSIMVTGDNWATANAIAKEVGIGKVFAETDPVGKANKIKE 848 (986)
Q Consensus 769 ~g~~~i~va~~~~~~G~i~~~d~~~~~~~~~i~~l~~~gi~~~~~Tgd~~~~a~~~a~~~gi~~~~~~~~p~~K~~~v~~ 848 (986)
.|+++++++.|+++.|++.++|++|+++.++|..||++|++++|+|||+..+|+++|+++||+++|+++.|++|.++|+.
T Consensus 701 ~g~tvv~v~vn~~l~gv~~l~D~vr~~a~~av~~Lk~~Gi~v~mLTGDn~~aA~svA~~VGi~~V~aev~P~~K~~~Ik~ 780 (951)
T KOG0207|consen 701 KGQTVVYVAVNGQLVGVFALEDQVRPDAALAVAELKSMGIKVVMLTGDNDAAARSVAQQVGIDNVYAEVLPEQKAEKIKE 780 (951)
T ss_pred cCceEEEEEECCEEEEEEEeccccchhHHHHHHHHHhcCceEEEEcCCCHHHHHHHHHhhCcceEEeccCchhhHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HhHcCCEEEEEcCCcccHHHHHhCCceEEecCCcHHHHHhcCEEEeCCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 001985 849 LQLKGMTVAMVGDGINDSPALVAADVGMAIGAGTDVAIEAADIVLIKSSLEDVVTAIDLSRKTISRIRLNYVWALGYNVL 928 (986)
Q Consensus 849 l~~~g~~v~~vGDg~nD~~al~~A~vgia~~~~~~~~~~~ad~vl~~~~~~~l~~~i~~~r~~~~~i~~n~~~~~~~n~~ 928 (986)
+|+++..|+|||||+||+|||.+|||||++|.|++++.++||+||++||+.+++.++++||+++++||+|++|++.||++
T Consensus 781 lq~~~~~VaMVGDGINDaPALA~AdVGIaig~gs~vAieaADIVLmrn~L~~v~~ai~LSrkt~~rIk~N~~~A~~yn~~ 860 (951)
T KOG0207|consen 781 IQKNGGPVAMVGDGINDAPALAQADVGIAIGAGSDVAIEAADIVLMRNDLRDVPFAIDLSRKTVKRIKLNFVWALIYNLV 860 (951)
T ss_pred HHhcCCcEEEEeCCCCccHHHHhhccceeeccccHHHHhhCCEEEEccchhhhHHHHHHHHHHHhhHHHHHHHHHHHHHh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHhhhccccCCCCCcHHHHHHHhhchhHhHhhhhhhcccCCCCCc
Q 001985 929 AVPIAAGILYPFTGIRLPPWLAGACMAASSLSVLCSSLLLQSYKKPLH 976 (986)
Q Consensus 929 ~i~la~g~~~~~~g~~l~p~~a~~~m~~ss~~v~~~s~~l~~~~~~~~ 976 (986)
+||+|+|.|.|+ |+.|+||+|+++|++||+.|++|||.|++||+|..
T Consensus 861 ~IpIAagvF~P~-~~~L~Pw~A~lama~SSvsVv~sSllLk~~k~p~~ 907 (951)
T KOG0207|consen 861 GIPIAAGVFAPF-GIVLPPWMASLAMAASSVSVVLSSLLLKRYKKPTI 907 (951)
T ss_pred hhhhheecccCC-ccccCchHHHHHHHhhhHHHhhhHHHHhhcccccc
Confidence 999999999998 59999999999999999999999999999999864
|
|
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase | Back alignment and domain information |
|---|
| >PRK01122 potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK14010 potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR01497 kdpB K+-transporting ATPase, B subunit | Back alignment and domain information |
|---|
| >PRK10517 magnesium-transporting ATPase MgtA; Provisional | Back alignment and domain information |
|---|
| >TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PRK15122 magnesium-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01494 ATPase_P-type ATPase, P-type (transporting), HAD superfamily, subfamily IC | Back alignment and domain information |
|---|
| >TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit | Back alignment and domain information |
|---|
| >KOG0202 consensus Ca2+ transporting ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type | Back alignment and domain information |
|---|
| >COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0204 consensus Calcium transporting ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01657 P-ATPase-V P-type ATPase of unknown pump specificity (type V) | Back alignment and domain information |
|---|
| >COG2216 KdpB High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0203 consensus Na+/K+ ATPase, alpha subunit [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0205 consensus Plasma membrane H+-transporting ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0208 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01652 ATPase-Plipid phospholipid-translocating P-type ATPase, flippase | Back alignment and domain information |
|---|
| >PLN03190 aminophospholipid translocase; Provisional | Back alignment and domain information |
|---|
| >KOG0209 consensus P-type ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0210 consensus P-type ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0206 consensus P-type ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF00122 E1-E2_ATPase: E1-E2 ATPase p-type cation-transporting ATPase superfamily signature H+-transporting ATPase (proton pump) signature sodium/potassium-transporting ATPase signature; InterPro: IPR008250 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) | Back alignment and domain information |
|---|
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4087 Soluble P-type ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures | Back alignment and domain information |
|---|
| >TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit | Back alignment and domain information |
|---|
| >TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein | Back alignment and domain information |
|---|
| >PRK11133 serB phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures | Back alignment and domain information |
|---|
| >TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family | Back alignment and domain information |
|---|
| >PRK10513 sugar phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK01158 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal | Back alignment and domain information |
|---|
| >PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK10976 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily | Back alignment and domain information |
|---|
| >PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR00338 serB phosphoserine phosphatase SerB | Back alignment and domain information |
|---|
| >PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG0546 Gph Predicted phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02887 hydrolase family protein | Back alignment and domain information |
|---|
| >PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] | Back alignment and domain information |
|---|
| >COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily | Back alignment and domain information |
|---|
| >PRK13582 thrH phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13222 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal | Back alignment and domain information |
|---|
| >KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PLN02954 phosphoserine phosphatase | Back alignment and domain information |
|---|
| >TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family | Back alignment and domain information |
|---|
| >TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein | Back alignment and domain information |
|---|
| >TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial | Back alignment and domain information |
|---|
| >TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase | Back alignment and domain information |
|---|
| >PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >PRK13288 pyrophosphatase PpaX; Provisional | Back alignment and domain information |
|---|
| >TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like | Back alignment and domain information |
|---|
| >TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 | Back alignment and domain information |
|---|
| >TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase | Back alignment and domain information |
|---|
| >PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B | Back alignment and domain information |
|---|
| >PRK06769 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK13225 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic | Back alignment and domain information |
|---|
| >PRK10187 trehalose-6-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13223 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13226 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase | Back alignment and domain information |
|---|
| >PLN02382 probable sucrose-phosphatase | Back alignment and domain information |
|---|
| >PRK08238 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PLN02770 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PRK10826 2-deoxyglucose-6-phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN03243 haloacid dehalogenase-like hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK13478 phosphonoacetaldehyde hydrolase; Provisional | Back alignment and domain information |
|---|
| >cd01427 HAD_like Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated | Back alignment and domain information |
|---|
| >TIGR03351 PhnX-like phosphonatase-like hydrolase | Back alignment and domain information |
|---|
| >TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 | Back alignment and domain information |
|---|
| >PLN02575 haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 | Back alignment and domain information |
|---|
| >PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase | Back alignment and domain information |
|---|
| >TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA | Back alignment and domain information |
|---|
| >TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 | Back alignment and domain information |
|---|
| >PRK14988 GMP/IMP nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional | Back alignment and domain information |
|---|
| >TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 | Back alignment and domain information |
|---|
| >PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 | Back alignment and domain information |
|---|
| >PRK11009 aphA acid phosphatase/phosphotransferase; Provisional | Back alignment and domain information |
|---|
| >PTZ00174 phosphomannomutase; Provisional | Back alignment and domain information |
|---|
| >TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB | Back alignment and domain information |
|---|
| >PRK11590 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated | Back alignment and domain information |
|---|
| >TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB | Back alignment and domain information |
|---|
| >TIGR00003 copper ion binding protein | Back alignment and domain information |
|---|
| >PRK11587 putative phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02779 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II | Back alignment and domain information |
|---|
| >PLN02940 riboflavin kinase | Back alignment and domain information |
|---|
| >TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 | Back alignment and domain information |
|---|
| >PRK09449 dUMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >COG4030 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01685 MDP-1 magnesium-dependent phosphatase-1 | Back alignment and domain information |
|---|
| >PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | Back alignment and domain information |
|---|
| >TIGR01990 bPGM beta-phosphoglucomutase | Back alignment and domain information |
|---|
| >TIGR00003 copper ion binding protein | Back alignment and domain information |
|---|
| >KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02580 trehalose-phosphatase | Back alignment and domain information |
|---|
| >KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase | Back alignment and domain information |
|---|
| >TIGR01664 DNA-3'-Pase DNA 3'-phosphatase | Back alignment and domain information |
|---|
| >TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED | Back alignment and domain information |
|---|
| >TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain | Back alignment and domain information |
|---|
| >PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A | Back alignment and domain information |
|---|
| >COG4359 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN02811 hydrolase | Back alignment and domain information |
|---|
| >TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase | Back alignment and domain information |
|---|
| >TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC | Back alignment and domain information |
|---|
| >TIGR00685 T6PP trehalose-phosphatase | Back alignment and domain information |
|---|
| >PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria [] | Back alignment and domain information |
|---|
| >PLN02957 copper, zinc superoxide dismutase | Back alignment and domain information |
|---|
| >TIGR01686 FkbH FkbH-like domain | Back alignment and domain information |
|---|
| >TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >TIGR01261 hisB_Nterm histidinol-phosphatase | Back alignment and domain information |
|---|
| >PLN02957 copper, zinc superoxide dismutase | Back alignment and domain information |
|---|
| >PLN03017 trehalose-phosphatase | Back alignment and domain information |
|---|
| >PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E | Back alignment and domain information |
|---|
| >PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] | Back alignment and domain information |
|---|
| >TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 | Back alignment and domain information |
|---|
| >TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein | Back alignment and domain information |
|---|
| >KOG4383 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00577 CPDc catalytic domain of ctd-like phosphatases | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >smart00775 LNS2 LNS2 domain | Back alignment and domain information |
|---|
| >PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] | Back alignment and domain information |
|---|
| >COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family | Back alignment and domain information |
|---|
| >PRK09456 ?-D-glucose-1-phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases | Back alignment and domain information |
|---|
| >PRK10444 UMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase | Back alignment and domain information |
|---|
| >PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 | Back alignment and domain information |
|---|
| >PRK10563 6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase | Back alignment and domain information |
|---|
| >TIGR01675 plant-AP plant acid phosphatase | Back alignment and domain information |
|---|
| >PLN02151 trehalose-phosphatase | Back alignment and domain information |
|---|
| >PRK10748 flavin mononucleotide phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 | Back alignment and domain information |
|---|
| >PHA02597 30 | Back alignment and domain information |
|---|
| >COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] | Back alignment and domain information |
|---|
| >PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A | Back alignment and domain information |
|---|
| >KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02645 phosphoglycolate phosphatase | Back alignment and domain information |
|---|
| >PLN02423 phosphomannomutase | Back alignment and domain information |
|---|
| >TIGR01684 viral_ppase viral phosphatase | Back alignment and domain information |
|---|
| >KOG3040 consensus Predicted sugar phosphatase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02177 glycerol-3-phosphate acyltransferase | Back alignment and domain information |
|---|
| >TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase | Back alignment and domain information |
|---|
| >PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) | Back alignment and domain information |
|---|
| >KOG3085 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family | Back alignment and domain information |
|---|
| >TIGR02052 MerP mercuric transport protein periplasmic component | Back alignment and domain information |
|---|
| >PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea | Back alignment and domain information |
|---|
| >TIGR02251 HIF-SF_euk Dullard-like phosphatase domain | Back alignment and domain information |
|---|
| >TIGR02052 MerP mercuric transport protein periplasmic component | Back alignment and domain information |
|---|
| >PHA03398 viral phosphatase superfamily protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01680 Veg_Stor_Prot vegetative storage protein | Back alignment and domain information |
|---|
| >PRK14054 methionine sulfoxide reductase A; Provisional | Back alignment and domain information |
|---|
| >PF02358 Trehalose_PPase: Trehalose-phosphatase; InterPro: IPR003337 Trehalose-phosphatases 3 | Back alignment and domain information |
|---|
| >COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins [] | Back alignment and domain information |
|---|
| >COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase | Back alignment and domain information |
|---|
| >COG0841 AcrB Cation/multidrug efflux pump [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK05528 methionine sulfoxide reductase A; Provisional | Back alignment and domain information |
|---|
| >TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family | Back alignment and domain information |
|---|
| >TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein | Back alignment and domain information |
|---|
| >PF13242 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A 2HX1_D 2X4D_A 3HLT_C 3L1U_B | Back alignment and domain information |
|---|
| >PRK13014 methionine sulfoxide reductase A; Provisional | Back alignment and domain information |
|---|
| >PRK00058 methionine sulfoxide reductase A; Provisional | Back alignment and domain information |
|---|
| >COG0225 MsrA Peptide methionine sulfoxide reductase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00873 ACR_tran: AcrB/AcrD/AcrF family; InterPro: IPR001036 The Escherichia coli acrA and acrB genes encode a multi-drug efflux system that is believed to protect the bacterium against hydrophobic inhibitors [] | Back alignment and domain information |
|---|
| >PTZ00445 p36-lilke protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00401 msrA methionine-S-sulfoxide reductase | Back alignment and domain information |
|---|
| >KOG4383 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG3700 AphA Acid phosphatase (class B) [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 986 | ||||
| 3j09_A | 723 | High Resolution Helical Reconstruction Of The Bacte | 1e-138 | ||
| 3j08_A | 645 | High Resolution Helical Reconstruction Of The Bacte | 1e-136 | ||
| 3rfu_A | 736 | Crystal Structure Of A Copper-Transporting Pib-Type | 1e-126 | ||
| 3a1c_A | 287 | Crystal Structure Of The P- And N-Domains Of Copa, | 1e-62 | ||
| 3a1e_A | 287 | Crystal Structure Of The P- And N-Domains Of His462 | 5e-62 | ||
| 2b8e_A | 273 | Copa Atp Binding Domain Length = 273 | 4e-55 | ||
| 3skx_A | 280 | Crystal Structure Of The Atp Binding Domain Of Arch | 1e-51 | ||
| 3sky_A | 274 | 2.1a Crystal Structure Of The Phosphate Bound Atp B | 3e-51 | ||
| 2kij_A | 124 | Solution Structure Of The Actuator Domain Of The Co | 3e-30 | ||
| 2iye_A | 263 | Structure Of Catalytic Cpx-atpase Domain Copb-b Len | 1e-26 | ||
| 2yj4_A | 263 | Conformational Changes In The Catalytic Domain Of T | 4e-26 | ||
| 2yj3_A | 263 | Conformational Changes In The Catalytic Domain Of T | 4e-26 | ||
| 1mhs_A | 920 | Model Of Neurospora Crassa Proton Atpase Length = 9 | 2e-25 | ||
| 2hc8_A | 113 | Structure Of The A. Fulgidus Copa A-Domain Length = | 2e-21 | ||
| 2voy_I | 128 | Cryoem Model Of Copa, The Copper Transporting Atpas | 2e-17 | ||
| 2zxe_A | 1028 | Crystal Structure Of The Sodium - Potassium Pump In | 2e-14 | ||
| 2dqs_A | 995 | Crystal Structure Of The Calcium Pump With Amppcp I | 1e-13 | ||
| 1kju_A | 994 | Ca2+-Atpase In The E2 State Length = 994 | 1e-13 | ||
| 3ba6_A | 994 | Structure Of The Ca2e1p Phosphoenzyme Intermediate | 1e-13 | ||
| 3tlm_A | 992 | Crystal Structure Of Endoplasmic Reticulum Ca2+-Atp | 1e-13 | ||
| 2ew9_A | 149 | Solution Structure Of Apowln5-6 Length = 149 | 3e-13 | ||
| 2voy_J | 118 | Cryoem Model Of Copa, The Copper Transporting Atpas | 7e-13 | ||
| 3ixz_A | 1034 | Pig Gastric H+K+-Atpase Complexed With Aluminium Fl | 8e-13 | ||
| 3b8c_A | 885 | Crystal Structure Of A Plasma Membrane Proton Pump | 2e-12 | ||
| 3n23_A | 992 | Crystal Structure Of The High Affinity Complex Betw | 7e-12 | ||
| 3b8e_A | 998 | Crystal Structure Of The Sodium-Potassium Pump Leng | 7e-12 | ||
| 2koy_A | 141 | Structure Of The E1064a Mutant Of The N-Domain Of W | 9e-08 | ||
| 2rop_A | 202 | Solution Structure Of Domains 3 And 4 Of Human Atp7 | 1e-05 | ||
| 2rop_A | 202 | Solution Structure Of Domains 3 And 4 Of Human Atp7 | 8e-05 | ||
| 2arf_A | 165 | Solution Structure Of The Wilson Atpase N-Domain In | 2e-05 | ||
| 3dxs_X | 74 | Crystal Structure Of A Copper Binding Domain From H | 5e-05 | ||
| 1q8l_A | 84 | Second Metal Binding Domain Of The Menkes Atpase Le | 2e-04 | ||
| 2kmv_A | 185 | Solution Structure Of The Nucleotide Binding Domain | 2e-04 | ||
| 1s6o_A | 76 | Solution Structure And Backbone Dynamics Of The Apo | 2e-04 | ||
| 1kvi_A | 79 | Solution Structure Of The Reduced Form Of The First | 3e-04 | ||
| 2rml_A | 147 | Solution Structure Of The N-Terminal Soluble Domain | 4e-04 | ||
| 1p6t_A | 151 | Structure Characterization Of The Water Soluble Reg | 5e-04 | ||
| 2ldi_A | 71 | Nmr Solution Structure Of Ziaan Sub Mutant Length = | 6e-04 |
| >pdb|3J09|A Chain A, High Resolution Helical Reconstruction Of The Bacterial P-Type Atpase Copper Transporter Copa Length = 723 | Back alignment and structure |
|
| >pdb|3J08|A Chain A, High Resolution Helical Reconstruction Of The Bacterial P-Type Atpase Copper Transporter Copa Length = 645 | Back alignment and structure |
| >pdb|3RFU|A Chain A, Crystal Structure Of A Copper-Transporting Pib-Type Atpase Length = 736 | Back alignment and structure |
| >pdb|3A1C|A Chain A, Crystal Structure Of The P- And N-Domains Of Copa, A Copper- Transporting P-Type Atpase, Bound With Amppcp-Mg Length = 287 | Back alignment and structure |
| >pdb|3A1E|A Chain A, Crystal Structure Of The P- And N-Domains Of His462gln Mutant Copa, A Copper-Transporting P-Type Atpase, Bound With Amppcp-Mg Length = 287 | Back alignment and structure |
| >pdb|2B8E|A Chain A, Copa Atp Binding Domain Length = 273 | Back alignment and structure |
| >pdb|3SKX|A Chain A, Crystal Structure Of The Atp Binding Domain Of Archaeoglobus Fulgidus Copb Length = 280 | Back alignment and structure |
| >pdb|3SKY|A Chain A, 2.1a Crystal Structure Of The Phosphate Bound Atp Binding Domain Of Archaeoglobus Fulgidus Copb Length = 274 | Back alignment and structure |
| >pdb|2KIJ|A Chain A, Solution Structure Of The Actuator Domain Of The Copper- Transporting Atpase Atp7a Length = 124 | Back alignment and structure |
| >pdb|2IYE|A Chain A, Structure Of Catalytic Cpx-atpase Domain Copb-b Length = 263 | Back alignment and structure |
| >pdb|2YJ4|A Chain A, Conformational Changes In The Catalytic Domain Of The Cpx- Atpase Copb-B Upon Nucleotide Binding Length = 263 | Back alignment and structure |
| >pdb|2YJ3|A Chain A, Conformational Changes In The Catalytic Domain Of The Cpx- Atpase Copb-B Upon Nucleotide Binding Length = 263 | Back alignment and structure |
| >pdb|1MHS|A Chain A, Model Of Neurospora Crassa Proton Atpase Length = 920 | Back alignment and structure |
| >pdb|2HC8|A Chain A, Structure Of The A. Fulgidus Copa A-Domain Length = 113 | Back alignment and structure |
| >pdb|2VOY|I Chain I, Cryoem Model Of Copa, The Copper Transporting Atpase From Archaeoglobus Fulgidus Length = 128 | Back alignment and structure |
| >pdb|2ZXE|A Chain A, Crystal Structure Of The Sodium - Potassium Pump In The E2.2k+.Pi State Length = 1028 | Back alignment and structure |
| >pdb|2DQS|A Chain A, Crystal Structure Of The Calcium Pump With Amppcp In The Absence Of Calcium Length = 995 | Back alignment and structure |
| >pdb|1KJU|A Chain A, Ca2+-Atpase In The E2 State Length = 994 | Back alignment and structure |
| >pdb|3BA6|A Chain A, Structure Of The Ca2e1p Phosphoenzyme Intermediate Of The Serca Ca2+-Atpase Length = 994 | Back alignment and structure |
| >pdb|3TLM|A Chain A, Crystal Structure Of Endoplasmic Reticulum Ca2+-Atpase (Serca) From Bovine Muscle Length = 992 | Back alignment and structure |
| >pdb|2EW9|A Chain A, Solution Structure Of Apowln5-6 Length = 149 | Back alignment and structure |
| >pdb|2VOY|J Chain J, Cryoem Model Of Copa, The Copper Transporting Atpase From Archaeoglobus Fulgidus Length = 118 | Back alignment and structure |
| >pdb|3IXZ|A Chain A, Pig Gastric H+K+-Atpase Complexed With Aluminium Fluoride Length = 1034 | Back alignment and structure |
| >pdb|3B8C|A Chain A, Crystal Structure Of A Plasma Membrane Proton Pump Length = 885 | Back alignment and structure |
| >pdb|3N23|A Chain A, Crystal Structure Of The High Affinity Complex Between Ouabain And The E2p Form Of The Sodium-Potassium Pump Length = 992 | Back alignment and structure |
| >pdb|3B8E|A Chain A, Crystal Structure Of The Sodium-Potassium Pump Length = 998 | Back alignment and structure |
| >pdb|2KOY|A Chain A, Structure Of The E1064a Mutant Of The N-Domain Of Wilson Disease Associated Protein Length = 141 | Back alignment and structure |
| >pdb|2ROP|A Chain A, Solution Structure Of Domains 3 And 4 Of Human Atp7b Length = 202 | Back alignment and structure |
| >pdb|2ROP|A Chain A, Solution Structure Of Domains 3 And 4 Of Human Atp7b Length = 202 | Back alignment and structure |
| >pdb|2ARF|A Chain A, Solution Structure Of The Wilson Atpase N-Domain In The Presence Of Atp Length = 165 | Back alignment and structure |
| >pdb|3DXS|X Chain X, Crystal Structure Of A Copper Binding Domain From Hma7, A P- Type Atpase Length = 74 | Back alignment and structure |
| >pdb|1Q8L|A Chain A, Second Metal Binding Domain Of The Menkes Atpase Length = 84 | Back alignment and structure |
| >pdb|2KMV|A Chain A, Solution Structure Of The Nucleotide Binding Domain Of The Human Menkes Protein In The Atp-Free Form Length = 185 | Back alignment and structure |
| >pdb|1S6O|A Chain A, Solution Structure And Backbone Dynamics Of The Apo-Form Of The Second Metal-Binding Domain Of The Menkes Protein Atp7a Length = 76 | Back alignment and structure |
| >pdb|1KVI|A Chain A, Solution Structure Of The Reduced Form Of The First Heavy Metal Binding Motif Of The Menkes Protein Length = 79 | Back alignment and structure |
| >pdb|2RML|A Chain A, Solution Structure Of The N-Terminal Soluble Domains Of Bacillus Subtilis Copa Length = 147 | Back alignment and structure |
| >pdb|1P6T|A Chain A, Structure Characterization Of The Water Soluble Region Of P- Type Atpase Copa From Bacillus Subtilis Length = 151 | Back alignment and structure |
| >pdb|2LDI|A Chain A, Nmr Solution Structure Of Ziaan Sub Mutant Length = 71 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 986 | |||
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 0.0 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 6e-15 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 5e-11 | |
| 3rfu_A | 736 | Copper efflux ATPase; alpha helical, CPC, CXXC, AT | 0.0 | |
| 3j08_A | 645 | COPA, copper-exporting P-type ATPase A; copper tra | 0.0 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 1e-123 | |
| 3skx_A | 280 | Copper-exporting P-type ATPase B; P1B-ATPase, ATP | 1e-119 | |
| 2yj3_A | 263 | Copper-transporting ATPase; hydrolase, P-type ATPa | 1e-118 | |
| 2kij_A | 124 | Copper-transporting ATPase 1; actuator, menkes dis | 1e-61 | |
| 1mhs_A | 920 | Proton pump, plasma membrane ATPase; ION transport | 7e-55 | |
| 3b8c_A | 885 | ATPase 2, plasma membrane-type; P-type ATPase, pro | 3e-53 | |
| 2hc8_A | 113 | PACS, cation-transporting ATPase, P-type; copper, | 5e-47 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 5e-45 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 7e-33 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 2e-15 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 2e-42 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 5e-32 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 2e-40 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 1e-26 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 7e-15 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 4e-08 | |
| 2arf_A | 165 | Wilson disease ATPase; P-type ATPase,ATP7B, copper | 4e-28 | |
| 1y3j_A | 77 | Copper-transporting ATPase 1; ferrodoxin-like fold | 4e-25 | |
| 1y3j_A | 77 | Copper-transporting ATPase 1; ferrodoxin-like fold | 1e-14 | |
| 1y3j_A | 77 | Copper-transporting ATPase 1; ferrodoxin-like fold | 9e-04 | |
| 2kmv_A | 185 | Copper-transporting ATPase 1; menkes, nucleotide b | 2e-24 | |
| 2kkh_A | 95 | Putative heavy metal transporter; zinc transport, | 1e-23 | |
| 2kkh_A | 95 | Putative heavy metal transporter; zinc transport, | 6e-15 | |
| 2kkh_A | 95 | Putative heavy metal transporter; zinc transport, | 3e-05 | |
| 1q8l_A | 84 | Copper-transporting ATPase 1; metal binding protei | 3e-23 | |
| 1q8l_A | 84 | Copper-transporting ATPase 1; metal binding protei | 3e-16 | |
| 1q8l_A | 84 | Copper-transporting ATPase 1; metal binding protei | 3e-04 | |
| 3ar4_A | 995 | Sarcoplasmic/endoplasmic reticulum calcium ATPase; | 3e-23 | |
| 3ar4_A | 995 | Sarcoplasmic/endoplasmic reticulum calcium ATPase; | 3e-08 | |
| 1kvi_A | 79 | Copper-transporting ATPase 1; menkes, Cu-protein, | 3e-23 | |
| 1kvi_A | 79 | Copper-transporting ATPase 1; menkes, Cu-protein, | 2e-16 | |
| 1kvi_A | 79 | Copper-transporting ATPase 1; menkes, Cu-protein, | 3e-05 | |
| 1cpz_A | 68 | Protein (COPZ); copper chaperone, metal transport, | 1e-22 | |
| 1cpz_A | 68 | Protein (COPZ); copper chaperone, metal transport, | 2e-14 | |
| 3dxs_X | 74 | Copper-transporting ATPase RAN1; CXXC motif, ferre | 2e-22 | |
| 3dxs_X | 74 | Copper-transporting ATPase RAN1; CXXC motif, ferre | 3e-16 | |
| 3dxs_X | 74 | Copper-transporting ATPase RAN1; CXXC motif, ferre | 4e-05 | |
| 1yjr_A | 75 | Copper-transporting ATPase 1; metallochaperone, pr | 2e-22 | |
| 1yjr_A | 75 | Copper-transporting ATPase 1; metallochaperone, pr | 2e-14 | |
| 1yjr_A | 75 | Copper-transporting ATPase 1; metallochaperone, pr | 8e-04 | |
| 1fvq_A | 72 | Copper-transporting ATPase; APO-CCC2A, hydrolase; | 6e-22 | |
| 1fvq_A | 72 | Copper-transporting ATPase; APO-CCC2A, hydrolase; | 2e-13 | |
| 1aw0_A | 72 | Menkes copper-transporting ATPase; copper-binding | 1e-21 | |
| 1aw0_A | 72 | Menkes copper-transporting ATPase; copper-binding | 2e-15 | |
| 1aw0_A | 72 | Menkes copper-transporting ATPase; copper-binding | 3e-04 | |
| 3cjk_B | 75 | Copper-transporting ATPase 1; HAH1, ATP7B, menkes | 2e-21 | |
| 3cjk_B | 75 | Copper-transporting ATPase 1; HAH1, ATP7B, menkes | 7e-16 | |
| 3cjk_B | 75 | Copper-transporting ATPase 1; HAH1, ATP7B, menkes | 2e-05 | |
| 1svj_A | 156 | Potassium-transporting ATPase B chain; alpha-beta | 3e-21 | |
| 2ldi_A | 71 | Zinc-transporting ATPase; metal homeostasis, metal | 3e-20 | |
| 2ldi_A | 71 | Zinc-transporting ATPase; metal homeostasis, metal | 1e-15 | |
| 2ldi_A | 71 | Zinc-transporting ATPase; metal homeostasis, metal | 4e-04 | |
| 2ofg_X | 111 | Zinc-transporting ATPase; ferredoxin-like fold, be | 4e-20 | |
| 2ofg_X | 111 | Zinc-transporting ATPase; ferredoxin-like fold, be | 8e-15 | |
| 2zxe_A | 1028 | Na, K-ATPase alpha subunit; membrane protein, ION | 4e-20 | |
| 2zxe_A | 1028 | Na, K-ATPase alpha subunit; membrane protein, ION | 6e-08 | |
| 3ixz_A | 1034 | Potassium-transporting ATPase alpha; ION pump, H+, | 4e-20 | |
| 3ixz_A | 1034 | Potassium-transporting ATPase alpha; ION pump, H+, | 1e-08 | |
| 1osd_A | 72 | MERP, hypothetical protein MERP; mercury resistanc | 4e-20 | |
| 1osd_A | 72 | MERP, hypothetical protein MERP; mercury resistanc | 4e-14 | |
| 1osd_A | 72 | MERP, hypothetical protein MERP; mercury resistanc | 1e-04 | |
| 2l3m_A | 71 | Copper-ION-binding protein; structural genomics, c | 6e-20 | |
| 2l3m_A | 71 | Copper-ION-binding protein; structural genomics, c | 2e-16 | |
| 2l3m_A | 71 | Copper-ION-binding protein; structural genomics, c | 5e-05 | |
| 1opz_A | 76 | Potential copper-transporting ATPase; mutation, fo | 8e-20 | |
| 1opz_A | 76 | Potential copper-transporting ATPase; mutation, fo | 1e-13 | |
| 1opz_A | 76 | Potential copper-transporting ATPase; mutation, fo | 8e-04 | |
| 1jww_A | 80 | Potential copper-transporting ATPase; beta-alpha-b | 1e-19 | |
| 1jww_A | 80 | Potential copper-transporting ATPase; beta-alpha-b | 3e-13 | |
| 2g9o_A | 90 | Copper-transporting ATPase 1; menkes disease, solu | 1e-19 | |
| 2g9o_A | 90 | Copper-transporting ATPase 1; menkes disease, solu | 2e-15 | |
| 2g9o_A | 90 | Copper-transporting ATPase 1; menkes disease, solu | 9e-07 | |
| 2qif_A | 69 | Copper chaperone COPZ; tetranuclear Cu(I) cluster; | 2e-19 | |
| 2qif_A | 69 | Copper chaperone COPZ; tetranuclear Cu(I) cluster; | 7e-15 | |
| 2qif_A | 69 | Copper chaperone COPZ; tetranuclear Cu(I) cluster; | 4e-05 | |
| 2kt2_A | 69 | Mercuric reductase; nmera, MERA, HMA domain, mercu | 3e-18 | |
| 2kt2_A | 69 | Mercuric reductase; nmera, MERA, HMA domain, mercu | 8e-10 | |
| 2xmw_A | 71 | PACS-N, cation-transporting ATPase PACS; hydrolase | 4e-17 | |
| 2xmw_A | 71 | PACS-N, cation-transporting ATPase PACS; hydrolase | 2e-10 | |
| 2roe_A | 66 | Heavy metal binding protein; NMR {Thermus thermoph | 1e-16 | |
| 2roe_A | 66 | Heavy metal binding protein; NMR {Thermus thermoph | 3e-08 | |
| 1mwy_A | 73 | ZNTA; open-faced beta-sandwich fold, beta-alpha-be | 1e-15 | |
| 1mwy_A | 73 | ZNTA; open-faced beta-sandwich fold, beta-alpha-be | 7e-10 | |
| 1yg0_A | 66 | COP associated protein; open-faced beta-sandwich, | 6e-14 | |
| 1yg0_A | 66 | COP associated protein; open-faced beta-sandwich, | 8e-11 | |
| 3fry_A | 73 | Probable copper-exporting P-type ATPase A; transpo | 6e-13 | |
| 3fry_A | 73 | Probable copper-exporting P-type ATPase A; transpo | 9e-05 | |
| 2xmm_A | 64 | SSR2857 protein, ATX1; metal transport, copper hom | 8e-11 | |
| 2xmm_A | 64 | SSR2857 protein, ATX1; metal transport, copper hom | 1e-07 | |
| 2k2p_A | 85 | Uncharacterized protein ATU1203; putative metal-bi | 2e-10 | |
| 2k2p_A | 85 | Uncharacterized protein ATU1203; putative metal-bi | 1e-07 | |
| 2aj0_A | 71 | Probable cadmium-transporting ATPase; ferrodoxin-l | 4e-10 | |
| 2aj0_A | 71 | Probable cadmium-transporting ATPase; ferrodoxin-l | 5e-07 | |
| 2kyz_A | 67 | Heavy metal binding protein; structural genomics, | 9e-09 | |
| 2kyz_A | 67 | Heavy metal binding protein; structural genomics, | 5e-06 | |
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 1e-08 | |
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 2e-07 | |
| 3iwl_A | 68 | Copper transport protein ATOX1; beta-alpha-beta-BE | 2e-08 | |
| 3iwl_A | 68 | Copper transport protein ATOX1; beta-alpha-beta-BE | 2e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-07 | |
| 1cc8_A | 73 | Protein (metallochaperone ATX1); copper transport, | 4e-06 | |
| 1cc8_A | 73 | Protein (metallochaperone ATX1); copper transport, | 1e-05 | |
| 1qup_A | 222 | Superoxide dismutase 1 copper chaperone; two domai | 3e-05 | |
| 3m1y_A | 217 | Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, | 4e-05 | |
| 3n28_A | 335 | Phosphoserine phosphatase; HAD family hydrolase, s | 7e-05 | |
| 1jk9_B | 249 | CCS, copper chaperone for superoxide dismutase; pr | 8e-05 | |
| 1rku_A | 206 | Homoserine kinase; phosphoserine phosphatase, phos | 9e-05 | |
| 4eze_A | 317 | Haloacid dehalogenase-like hydrolase; magnesium bi | 1e-04 | |
| 2fea_A | 236 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 3e-04 | |
| 1nnl_A | 225 | L-3-phosphoserine phosphatase; PSP, HPSP, phospho- | 4e-04 |
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Length = 723 | Back alignment and structure |
|---|
Score = 888 bits (2296), Expect = 0.0
Identities = 303/776 (39%), Positives = 450/776 (57%), Gaps = 60/776 (7%)
Query: 200 KVHLKLEGLNSSEDATFVQNFLESTQGVSQVEIDLSEHKVTVSYDPNLTGPRSIIQYLEE 259
+ +++ G+ + ++ + S +GV +V ++L+ + +D +I + +E+
Sbjct: 3 ERTVRVTGMTCAMCVKSIETAVGSLEGVEEVRVNLATETAFIRFDEKRIDFETIKRVIED 62
Query: 260 ASHGPNIYHASLYTPPKRRETERLKETQMYRNRFFISCLFSVPVLLFSMVLPMIPTYGNW 319
G Y + + ++ + + +++ V +L + + + Y ++
Sbjct: 63 L--G---YGVV---DEQAAVSAEVEHLSRMKRKLYVAAFAGVLLLFLAHFISL--PYEDF 112
Query: 320 LDYKVHNMLTIGMLLRWILCTPVQFIVGQRFYVGAYHALRRRSANMDVLVALGTNAAYFY 379
+ + ++ P F G + A+ ALRRR+ NMDV+ ++G AA+
Sbjct: 113 V--------------QLLIALPAIFYSGSSIFKAAFSALRRRTLNMDVMYSMGVGAAFLA 158
Query: 380 SVYIAVKALTSNTFEGQDFFETSAMLISFILLGKYLEVVAKGKTSDALAKLTDLAPDTAH 439
SV L F+ETS +L++F+LLG+ LE AK +T +A+ KL L TA
Sbjct: 159 SVLSTAGVLPREYS----FYETSVLLLAFLLLGRTLEARAKSRTGEAIKKLVGLQAKTAV 214
Query: 440 LLTLDGEGNVISEMDINTQLMQKNDIIKILPGEKVPVDGVVTDGQSYVNESMITGEAKPI 499
++ DG+ E+ + + + DI+ + PGEK+PVDGVV +G+SYV+ESMI+GE P+
Sbjct: 215 VIR-DGK-----EIAVPVEEVAVGDIVIVRPGEKIPVDGVVVEGESYVDESMISGEPVPV 268
Query: 500 AKGPGDKVIGGTMNENGCLQVKATHVGSETALSQIVQLVEAAQLARAPVQKLADQISRFF 559
K GD+V G T+N G L+++AT VG ET L+QIV+LVE A ++ P+Q+LAD++ +F
Sbjct: 269 LKSKGDEVFGATINNTGVLKIRATRVGGETLLAQIVKLVEDAMGSKPPIQRLADKVVAYF 328
Query: 560 VPMVVAAAFITWLGWFIPGVAGLYPKHWIPKVMDEFELALQFGISVLVVACPCALGLATP 619
+P V+ A ++ W+ A A I+VLVVACPCA GLATP
Sbjct: 329 IPTVLLVAISAFIYWYFIAHAP-------------LLFAFTTLIAVLVVACPCAFGLATP 375
Query: 620 TAVMVATGKGASLGVLIKGGNALEKAHKVKTVVFDKTGTLTVGKPEVVSAVLFSHFSMEE 679
TA+ V GKGA LG+LIK +ALE A KV V+FDKTGTLT GKPEV ++ + E
Sbjct: 376 TALTVGMGKGAELGILIKNADALEVAEKVTAVIFDKTGTLTKGKPEVT-DLVPLNGDERE 434
Query: 680 FCDMATAAEANSEHPIAKAVVEHAKKLRQKLGSPTEHASEAKDFEVHTGAGVSGKVGDRT 739
+A AE SEHPIA+A+V+ A + +L E + EV G GV
Sbjct: 435 LLRLAAIAERRSEHPIAEAIVKKALEHGIEL-------GEPEKVEVIAGEGVVA----DG 483
Query: 740 VLVGNKRLMMAFHVPVGPEVDDYMMKNEQLARTCVLVAIDGRVAGAFAVTDPVKPEAQIV 799
+LVGNKRLM F V V EV+ + K E+ A+T V+VA +GRV G AV+D +K A+
Sbjct: 484 ILVGNKRLMEDFGVAVSNEVELALEKLEREAKTAVIVARNGRVEGIIAVSDTLKESAKPA 543
Query: 800 VSSLRSMEISSIMVTGDNWATANAIAKEVGIGKVFAETDPVGKANKIKELQLKGMTVAMV 859
V L+ M I M+TGDNW +A AI++E+ + V AE P K+ ++K+LQ K VA V
Sbjct: 544 VQELKRMGIKVGMITGDNWRSAEAISRELNLDLVIAEVLPHQKSEEVKKLQAKE-VVAFV 602
Query: 860 GDGINDSPALVAADVGMAIGAGTDVAIEAADIVLIKSSLEDVVTAIDLSRKTISRIRLNY 919
GDGIND+PAL AD+G+A+G+G+DVA+E+ DIVLI+ L DVV AI LSRKT+S+I+ N
Sbjct: 603 GDGINDAPALAQADLGIAVGSGSDVAVESGDIVLIRDDLRDVVAAIQLSRKTMSKIKQNI 662
Query: 920 VWALGYNVLAVPIAAGILYPFTGIRLPPWLAGACMAASSLSVLCSSLLLQSYKKPL 975
WAL YNV+ +P AAG+LYP G+ P AG MA SS+SV+ +SLLL++Y P+
Sbjct: 663 FWALIYNVILIPAAAGLLYPIFGVVFRPEFAGLAMAMSSVSVVANSLLLRNYVPPI 718
|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Length = 723 | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Length = 723 | Back alignment and structure |
|---|
| >3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} Length = 736 | Back alignment and structure |
|---|
| >3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Length = 645 | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Length = 287 | Back alignment and structure |
|---|
| >3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Length = 280 | Back alignment and structure |
|---|
| >2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Length = 263 | Back alignment and structure |
|---|
| >2kij_A Copper-transporting ATPase 1; actuator, menkes disease, alternative splicing, ATP-binding, cell membrane, cytoplasm, disease mutation; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 Length = 920 | Back alignment and structure |
|---|
| >3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} Length = 885 | Back alignment and structure |
|---|
| >2hc8_A PACS, cation-transporting ATPase, P-type; copper, COPA, COPB, actuator, transport protein; 1.65A {Archaeoglobus fulgidus} PDB: 2voy_F Length = 113 | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Length = 151 | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Length = 151 | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Length = 202 | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Length = 202 | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Length = 202 | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Length = 202 | Back alignment and structure |
|---|
| >2arf_A Wilson disease ATPase; P-type ATPase,ATP7B, copper transport, nucleotide binding, ATP binding, hydrolase; NMR {Homo sapiens} PDB: 2koy_A Length = 165 | Back alignment and structure |
|---|
| >1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Length = 77 | Back alignment and structure |
|---|
| >1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Length = 77 | Back alignment and structure |
|---|
| >1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Length = 77 | Back alignment and structure |
|---|
| >2kmv_A Copper-transporting ATPase 1; menkes, nucleotide binding protein, alternative splicing, ATP-binding, cell membrane, cytoplasm, disease mutation; NMR {Homo sapiens} PDB: 2kmx_A* Length = 185 | Back alignment and structure |
|---|
| >2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Length = 95 | Back alignment and structure |
|---|
| >2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Length = 95 | Back alignment and structure |
|---|
| >2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Length = 95 | Back alignment and structure |
|---|
| >1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Length = 84 | Back alignment and structure |
|---|
| >1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Length = 84 | Back alignment and structure |
|---|
| >1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Length = 84 | Back alignment and structure |
|---|
| >3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... Length = 995 | Back alignment and structure |
|---|
| >3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... Length = 995 | Back alignment and structure |
|---|
| >1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Length = 79 | Back alignment and structure |
|---|
| >1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Length = 79 | Back alignment and structure |
|---|
| >1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Length = 79 | Back alignment and structure |
|---|
| >1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Length = 68 | Back alignment and structure |
|---|
| >1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Length = 68 | Back alignment and structure |
|---|
| >3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} Length = 74 | Back alignment and structure |
|---|
| >3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} Length = 74 | Back alignment and structure |
|---|
| >3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} Length = 74 | Back alignment and structure |
|---|
| >1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Length = 75 | Back alignment and structure |
|---|
| >1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Length = 75 | Back alignment and structure |
|---|
| >1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Length = 75 | Back alignment and structure |
|---|
| >1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Length = 72 | Back alignment and structure |
|---|
| >1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Length = 72 | Back alignment and structure |
|---|
| >1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Length = 72 | Back alignment and structure |
|---|
| >1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Length = 72 | Back alignment and structure |
|---|
| >1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Length = 72 | Back alignment and structure |
|---|
| >3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Length = 75 | Back alignment and structure |
|---|
| >3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Length = 75 | Back alignment and structure |
|---|
| >3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Length = 75 | Back alignment and structure |
|---|
| >1svj_A Potassium-transporting ATPase B chain; alpha-beta sandwich, hydrolase; NMR {Escherichia coli} SCOP: d.220.1.1 PDB: 1u7q_A 2a00_A* 2a29_A* Length = 156 | Back alignment and structure |
|---|
| >2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Length = 71 | Back alignment and structure |
|---|
| >2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Length = 71 | Back alignment and structure |
|---|
| >2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Length = 71 | Back alignment and structure |
|---|
| >2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A Length = 1028 | Back alignment and structure |
|---|
| >2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A Length = 1028 | Back alignment and structure |
|---|
| >3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2xzb_A 1iwc_A 1iwf_A Length = 1034 | Back alignment and structure |
|---|
| >3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2xzb_A 1iwc_A 1iwf_A Length = 1034 | Back alignment and structure |
|---|
| >1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Length = 72 | Back alignment and structure |
|---|
| >1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Length = 72 | Back alignment and structure |
|---|
| >1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Length = 72 | Back alignment and structure |
|---|
| >2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Length = 71 | Back alignment and structure |
|---|
| >2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Length = 71 | Back alignment and structure |
|---|
| >2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Length = 71 | Back alignment and structure |
|---|
| >1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Length = 76 | Back alignment and structure |
|---|
| >1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Length = 76 | Back alignment and structure |
|---|
| >1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Length = 76 | Back alignment and structure |
|---|
| >1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Length = 80 | Back alignment and structure |
|---|
| >1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Length = 80 | Back alignment and structure |
|---|
| >2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Length = 90 | Back alignment and structure |
|---|
| >2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Length = 90 | Back alignment and structure |
|---|
| >2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Length = 90 | Back alignment and structure |
|---|
| >2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Length = 69 | Back alignment and structure |
|---|
| >2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Length = 69 | Back alignment and structure |
|---|
| >2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Length = 69 | Back alignment and structure |
|---|
| >2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Length = 69 | Back alignment and structure |
|---|
| >2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Length = 69 | Back alignment and structure |
|---|
| >2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Length = 71 | Back alignment and structure |
|---|
| >2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Length = 71 | Back alignment and structure |
|---|
| >2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Length = 66 | Back alignment and structure |
|---|
| >2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Length = 66 | Back alignment and structure |
|---|
| >1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Length = 73 | Back alignment and structure |
|---|
| >1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Length = 73 | Back alignment and structure |
|---|
| >1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Length = 66 | Back alignment and structure |
|---|
| >1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Length = 66 | Back alignment and structure |
|---|
| >3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Length = 73 | Back alignment and structure |
|---|
| >3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Length = 73 | Back alignment and structure |
|---|
| >2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Length = 64 | Back alignment and structure |
|---|
| >2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Length = 64 | Back alignment and structure |
|---|
| >2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Length = 85 | Back alignment and structure |
|---|
| >2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Length = 85 | Back alignment and structure |
|---|
| >2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Length = 71 | Back alignment and structure |
|---|
| >2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Length = 71 | Back alignment and structure |
|---|
| >2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Length = 67 | Back alignment and structure |
|---|
| >2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Length = 67 | Back alignment and structure |
|---|
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 | Back alignment and structure |
|---|
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 | Back alignment and structure |
|---|
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Length = 68 | Back alignment and structure |
|---|
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Length = 68 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Length = 73 | Back alignment and structure |
|---|
| >1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Length = 73 | Back alignment and structure |
|---|
| >1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 222 | Back alignment and structure |
|---|
| >3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} Length = 217 | Back alignment and structure |
|---|
| >3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Length = 335 | Back alignment and structure |
|---|
| >1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 249 | Back alignment and structure |
|---|
| >1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Length = 206 | Back alignment and structure |
|---|
| >4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Length = 317 | Back alignment and structure |
|---|
| >2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Length = 236 | Back alignment and structure |
|---|
| >1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Length = 225 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 986 | |||
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 100.0 | |
| 3rfu_A | 736 | Copper efflux ATPase; alpha helical, CPC, CXXC, AT | 100.0 | |
| 3j08_A | 645 | COPA, copper-exporting P-type ATPase A; copper tra | 100.0 | |
| 1mhs_A | 920 | Proton pump, plasma membrane ATPase; ION transport | 100.0 | |
| 3b8c_A | 885 | ATPase 2, plasma membrane-type; P-type ATPase, pro | 100.0 | |
| 2zxe_A | 1028 | Na, K-ATPase alpha subunit; membrane protein, ION | 100.0 | |
| 3ar4_A | 995 | Sarcoplasmic/endoplasmic reticulum calcium ATPase; | 100.0 | |
| 3ixz_A | 1034 | Potassium-transporting ATPase alpha; ION pump, H+, | 100.0 | |
| 2yj3_A | 263 | Copper-transporting ATPase; hydrolase, P-type ATPa | 100.0 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 100.0 | |
| 3skx_A | 280 | Copper-exporting P-type ATPase B; P1B-ATPase, ATP | 100.0 | |
| 2hc8_A | 113 | PACS, cation-transporting ATPase, P-type; copper, | 99.94 | |
| 2kij_A | 124 | Copper-transporting ATPase 1; actuator, menkes dis | 99.93 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 99.82 | |
| 4fe3_A | 297 | Cytosolic 5'-nucleotidase 3; substrate complex, HA | 99.81 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 99.8 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 99.8 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 99.77 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 99.76 | |
| 2kmv_A | 185 | Copper-transporting ATPase 1; menkes, nucleotide b | 99.73 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 99.73 | |
| 1svj_A | 156 | Potassium-transporting ATPase B chain; alpha-beta | 99.72 | |
| 3mn1_A | 189 | Probable YRBI family phosphatase; structural genom | 99.69 | |
| 2arf_A | 165 | Wilson disease ATPase; P-type ATPase,ATP7B, copper | 99.64 | |
| 3n28_A | 335 | Phosphoserine phosphatase; HAD family hydrolase, s | 99.43 | |
| 3ewi_A | 168 | N-acylneuraminate cytidylyltransferase; beta barre | 99.42 | |
| 3mmz_A | 176 | Putative HAD family hydrolase; structural genomics | 99.41 | |
| 3ij5_A | 211 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 99.38 | |
| 1k1e_A | 180 | Deoxy-D-mannose-octulosonate 8-phosphate phosphat; | 99.38 | |
| 3n1u_A | 191 | Hydrolase, HAD superfamily, subfamily III A; struc | 99.33 | |
| 3n07_A | 195 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 99.31 | |
| 1l6r_A | 227 | Hypothetical protein TA0175; structural genomics, | 99.18 | |
| 3dxs_X | 74 | Copper-transporting ATPase RAN1; CXXC motif, ferre | 99.12 | |
| 3dxs_X | 74 | Copper-transporting ATPase RAN1; CXXC motif, ferre | 99.1 | |
| 2ofg_X | 111 | Zinc-transporting ATPase; ferredoxin-like fold, be | 99.08 | |
| 4a4j_A | 69 | Pacszia, cation-transporting ATPase PACS; hydrolas | 99.07 | |
| 3e8m_A | 164 | Acylneuraminate cytidylyltransferase; 2-keto-3-deo | 99.05 | |
| 4a4j_A | 69 | Pacszia, cation-transporting ATPase PACS; hydrolas | 99.04 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 99.03 | |
| 3m1y_A | 217 | Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, | 98.98 | |
| 2r8e_A | 188 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 98.96 | |
| 4dw8_A | 279 | Haloacid dehalogenase-like hydrolase; HAD, putativ | 98.95 | |
| 2ofg_X | 111 | Zinc-transporting ATPase; ferredoxin-like fold, be | 98.94 | |
| 1l7m_A | 211 | Phosphoserine phosphatase; rossmann fold, four-hel | 98.93 | |
| 1osd_A | 72 | MERP, hypothetical protein MERP; mercury resistanc | 98.93 | |
| 2l3m_A | 71 | Copper-ION-binding protein; structural genomics, c | 98.93 | |
| 4eze_A | 317 | Haloacid dehalogenase-like hydrolase; magnesium bi | 98.92 | |
| 1cpz_A | 68 | Protein (COPZ); copper chaperone, metal transport, | 98.92 | |
| 2p9j_A | 162 | Hypothetical protein AQ2171; secsg, riken, PSI, st | 98.91 | |
| 3cjk_B | 75 | Copper-transporting ATPase 1; HAH1, ATP7B, menkes | 98.91 | |
| 2g9o_A | 90 | Copper-transporting ATPase 1; menkes disease, solu | 98.91 | |
| 1yg0_A | 66 | COP associated protein; open-faced beta-sandwich, | 98.91 | |
| 3fry_A | 73 | Probable copper-exporting P-type ATPase A; transpo | 98.89 | |
| 3iwl_A | 68 | Copper transport protein ATOX1; beta-alpha-beta-BE | 98.89 | |
| 3fry_A | 73 | Probable copper-exporting P-type ATPase A; transpo | 98.89 | |
| 3pgv_A | 285 | Haloacid dehalogenase-like hydrolase; structural g | 98.89 | |
| 3iwl_A | 68 | Copper transport protein ATOX1; beta-alpha-beta-BE | 98.88 | |
| 1kvi_A | 79 | Copper-transporting ATPase 1; menkes, Cu-protein, | 98.88 | |
| 3dnp_A | 290 | Stress response protein YHAX; structural PSI-2, pr | 98.88 | |
| 1q8l_A | 84 | Copper-transporting ATPase 1; metal binding protei | 98.87 | |
| 1osd_A | 72 | MERP, hypothetical protein MERP; mercury resistanc | 98.87 | |
| 2g9o_A | 90 | Copper-transporting ATPase 1; menkes disease, solu | 98.87 | |
| 1y3j_A | 77 | Copper-transporting ATPase 1; ferrodoxin-like fold | 98.87 | |
| 2l3m_A | 71 | Copper-ION-binding protein; structural genomics, c | 98.87 | |
| 2xmw_A | 71 | PACS-N, cation-transporting ATPase PACS; hydrolase | 98.87 | |
| 2qif_A | 69 | Copper chaperone COPZ; tetranuclear Cu(I) cluster; | 98.86 | |
| 3dao_A | 283 | Putative phosphatse; structural genomics, joint ce | 98.86 | |
| 2ldi_A | 71 | Zinc-transporting ATPase; metal homeostasis, metal | 98.86 | |
| 1kvi_A | 79 | Copper-transporting ATPase 1; menkes, Cu-protein, | 98.85 | |
| 1aw0_A | 72 | Menkes copper-transporting ATPase; copper-binding | 98.85 | |
| 3cjk_B | 75 | Copper-transporting ATPase 1; HAH1, ATP7B, menkes | 98.85 | |
| 1yjr_A | 75 | Copper-transporting ATPase 1; metallochaperone, pr | 98.85 | |
| 2kt2_A | 69 | Mercuric reductase; nmera, MERA, HMA domain, mercu | 98.85 | |
| 1q8l_A | 84 | Copper-transporting ATPase 1; metal binding protei | 98.83 | |
| 1cpz_A | 68 | Protein (COPZ); copper chaperone, metal transport, | 98.81 | |
| 1opz_A | 76 | Potential copper-transporting ATPase; mutation, fo | 98.81 | |
| 1mwy_A | 73 | ZNTA; open-faced beta-sandwich fold, beta-alpha-be | 98.81 | |
| 1aw0_A | 72 | Menkes copper-transporting ATPase; copper-binding | 98.79 | |
| 2xmw_A | 71 | PACS-N, cation-transporting ATPase PACS; hydrolase | 98.79 | |
| 1yg0_A | 66 | COP associated protein; open-faced beta-sandwich, | 98.79 | |
| 3mpo_A | 279 | Predicted hydrolase of the HAD superfamily; SGX, P | 98.79 | |
| 4ap9_A | 201 | Phosphoserine phosphatase; hydrolase, haloacid deh | 98.79 | |
| 1y3j_A | 77 | Copper-transporting ATPase 1; ferrodoxin-like fold | 98.78 | |
| 2qif_A | 69 | Copper chaperone COPZ; tetranuclear Cu(I) cluster; | 98.78 | |
| 2kt2_A | 69 | Mercuric reductase; nmera, MERA, HMA domain, mercu | 98.78 | |
| 1fvq_A | 72 | Copper-transporting ATPase; APO-CCC2A, hydrolase; | 98.77 | |
| 1opz_A | 76 | Potential copper-transporting ATPase; mutation, fo | 98.75 | |
| 1mwy_A | 73 | ZNTA; open-faced beta-sandwich fold, beta-alpha-be | 98.75 | |
| 2ldi_A | 71 | Zinc-transporting ATPase; metal homeostasis, metal | 98.74 | |
| 1jww_A | 80 | Potential copper-transporting ATPase; beta-alpha-b | 98.74 | |
| 3fzq_A | 274 | Putative hydrolase; YP_001086940.1, putative haloa | 98.73 | |
| 2pq0_A | 258 | Hypothetical conserved protein GK1056; hyopthetica | 98.72 | |
| 1yjr_A | 75 | Copper-transporting ATPase 1; metallochaperone, pr | 98.72 | |
| 1y8a_A | 332 | Hypothetical protein AF1437; structural genomics, | 98.72 | |
| 1fvq_A | 72 | Copper-transporting ATPase; APO-CCC2A, hydrolase; | 98.7 | |
| 2roe_A | 66 | Heavy metal binding protein; NMR {Thermus thermoph | 98.68 | |
| 1rku_A | 206 | Homoserine kinase; phosphoserine phosphatase, phos | 98.68 | |
| 1jww_A | 80 | Potential copper-transporting ATPase; beta-alpha-b | 98.67 | |
| 2kkh_A | 95 | Putative heavy metal transporter; zinc transport, | 98.66 | |
| 3kd3_A | 219 | Phosphoserine phosphohydrolase-like protein; csgid | 98.66 | |
| 4ex6_A | 237 | ALNB; modified rossman fold, phosphatase, magnesiu | 98.66 | |
| 3m9l_A | 205 | Hydrolase, haloacid dehalogenase-like family; HAD | 98.66 | |
| 2kyz_A | 67 | Heavy metal binding protein; structural genomics, | 98.65 | |
| 2k2p_A | 85 | Uncharacterized protein ATU1203; putative metal-bi | 98.64 | |
| 1wr8_A | 231 | Phosphoglycolate phosphatase; alpha / beta core do | 98.64 | |
| 1cc8_A | 73 | Protein (metallochaperone ATX1); copper transport, | 98.63 | |
| 2xmm_A | 64 | SSR2857 protein, ATX1; metal transport, copper hom | 98.63 | |
| 2kyz_A | 67 | Heavy metal binding protein; structural genomics, | 98.63 | |
| 3l7y_A | 304 | Putative uncharacterized protein SMU.1108C; hydrol | 98.63 | |
| 1rkq_A | 282 | Hypothetical protein YIDA; two domain structure wi | 98.62 | |
| 3r4c_A | 268 | Hydrolase, haloacid dehalogenase-like hydrolase; h | 98.61 | |
| 1cc8_A | 73 | Protein (metallochaperone ATX1); copper transport, | 98.61 | |
| 2roe_A | 66 | Heavy metal binding protein; NMR {Thermus thermoph | 98.61 | |
| 2kkh_A | 95 | Putative heavy metal transporter; zinc transport, | 98.59 | |
| 3mc1_A | 226 | Predicted phosphatase, HAD family; PSI2, NYSGXRC, | 98.59 | |
| 2k2p_A | 85 | Uncharacterized protein ATU1203; putative metal-bi | 98.57 | |
| 2xmm_A | 64 | SSR2857 protein, ATX1; metal transport, copper hom | 98.56 | |
| 1nnl_A | 225 | L-3-phosphoserine phosphatase; PSP, HPSP, phospho- | 98.53 | |
| 1rlm_A | 271 | Phosphatase; HAD family, rossman fold, hydrolase; | 98.53 | |
| 2pib_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 98.51 | |
| 3l8h_A | 179 | Putative haloacid dehalogenase-like hydrolase; HAD | 98.49 | |
| 1swv_A | 267 | Phosphonoacetaldehyde hydrolase; HAD enzyme superf | 98.49 | |
| 3fvv_A | 232 | Uncharacterized protein; unknown function, structu | 98.48 | |
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 98.47 | |
| 1nf2_A | 268 | Phosphatase; structural proteomics, HAD NEW fold, | 98.45 | |
| 3s6j_A | 233 | Hydrolase, haloacid dehalogenase-like family; stru | 98.4 | |
| 2aj0_A | 71 | Probable cadmium-transporting ATPase; ferrodoxin-l | 98.4 | |
| 3nas_A | 233 | Beta-PGM, beta-phosphoglucomutase; PSI, structural | 98.39 | |
| 1te2_A | 226 | Putative phosphatase; structural genomics, phospha | 98.38 | |
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 98.37 | |
| 2wf7_A | 221 | Beta-PGM, beta-phosphoglucomutase; transition stat | 98.37 | |
| 3sd7_A | 240 | Putative phosphatase; structural genomics, haloaci | 98.36 | |
| 3umb_A | 233 | Dehalogenase-like hydrolase; 2.20A {Ralstonia sola | 98.35 | |
| 3gyg_A | 289 | NTD biosynthesis operon putative hydrolase NTDB; P | 98.35 | |
| 1nrw_A | 288 | Hypothetical protein, haloacid dehalogenase-like h | 98.35 | |
| 3um9_A | 230 | Haloacid dehalogenase, type II; haloacid dehalogen | 98.33 | |
| 2go7_A | 207 | Hydrolase, haloacid dehalogenase-like family; stru | 98.32 | |
| 1u02_A | 239 | Trehalose-6-phosphate phosphatase related protein; | 98.32 | |
| 2hsz_A | 243 | Novel predicted phosphatase; structural genomics, | 98.32 | |
| 3u26_A | 234 | PF00702 domain protein; structural genomics, PSI-b | 98.32 | |
| 3kzx_A | 231 | HAD-superfamily hydrolase, subfamily IA, variant; | 98.32 | |
| 2nyv_A | 222 | Pgpase, PGP, phosphoglycolate phosphatase; structu | 98.31 | |
| 2aj0_A | 71 | Probable cadmium-transporting ATPase; ferrodoxin-l | 98.3 | |
| 3d6j_A | 225 | Putative haloacid dehalogenase-like hydrolase; str | 98.3 | |
| 3iru_A | 277 | Phoshonoacetaldehyde hydrolase like protein; phosp | 98.3 | |
| 2om6_A | 235 | Probable phosphoserine phosphatase; rossmann fold, | 98.28 | |
| 3e58_A | 214 | Putative beta-phosphoglucomutase; structu genomics | 98.28 | |
| 3nuq_A | 282 | Protein SSM1, putative nucleotide phosphatase; sup | 98.26 | |
| 1s2o_A | 244 | SPP, sucrose-phosphatase; phosphohydrolase, HAD su | 98.25 | |
| 2no4_A | 240 | (S)-2-haloacid dehalogenase IVA; HAD superfamily, | 98.24 | |
| 2hcf_A | 234 | Hydrolase, haloacid dehalogenase-like family; NP_6 | 98.23 | |
| 2hoq_A | 241 | Putative HAD-hydrolase PH1655; haloacid dehalogena | 98.22 | |
| 4eek_A | 259 | Beta-phosphoglucomutase-related protein; hydrolase | 98.22 | |
| 1zrn_A | 232 | L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud | 98.21 | |
| 2gmw_A | 211 | D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi | 98.21 | |
| 3dv9_A | 247 | Beta-phosphoglucomutase; structural genomics, APC6 | 98.19 | |
| 1xvi_A | 275 | MPGP, YEDP, putative mannosyl-3-phosphoglycerate p | 98.19 | |
| 3qxg_A | 243 | Inorganic pyrophosphatase; hydrolase, magnesium bi | 98.18 | |
| 2ah5_A | 210 | COG0546: predicted phosphatases; MCSG, structural | 98.16 | |
| 2fea_A | 236 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 98.15 | |
| 3ib6_A | 189 | Uncharacterized protein; structural genomics, unkn | 98.15 | |
| 2hi0_A | 240 | Putative phosphoglycolate phosphatase; YP_619066.1 | 98.12 | |
| 2wm8_A | 187 | MDP-1, magnesium-dependent phosphatase 1; haloacid | 98.11 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 98.1 | |
| 1qup_A | 222 | Superoxide dismutase 1 copper chaperone; two domai | 98.1 | |
| 2hdo_A | 209 | Phosphoglycolate phosphatase; NP_784602.1, structu | 98.09 | |
| 3qnm_A | 240 | Haloacid dehalogenase-like hydrolase; structural g | 98.09 | |
| 2w43_A | 201 | Hypothetical 2-haloalkanoic acid dehalogenase; hyd | 98.09 | |
| 1qup_A | 222 | Superoxide dismutase 1 copper chaperone; two domai | 98.08 | |
| 3ddh_A | 234 | Putative haloacid dehalogenase-like family hydrol; | 98.08 | |
| 4gxt_A | 385 | A conserved functionally unknown protein; structur | 98.07 | |
| 1qq5_A | 253 | Protein (L-2-haloacid dehalogenase); hydrolase; 1. | 98.06 | |
| 3ed5_A | 238 | YFNB; APC60080, bacillus subtilis subsp. subtilis | 98.05 | |
| 1jk9_B | 249 | CCS, copper chaperone for superoxide dismutase; pr | 97.97 | |
| 3umc_A | 254 | Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru | 97.96 | |
| 2fi1_A | 190 | Hydrolase, haloacid dehalogenase-like family; stru | 97.96 | |
| 3kbb_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 97.95 | |
| 3k1z_A | 263 | Haloacid dehalogenase-like hydrolase domain-conta | 97.94 | |
| 1jk9_B | 249 | CCS, copper chaperone for superoxide dismutase; pr | 97.93 | |
| 2fdr_A | 229 | Conserved hypothetical protein; SAD, structural ge | 97.91 | |
| 3umg_A | 254 | Haloacid dehalogenase; defluorinase, hydrolase; 2. | 97.91 | |
| 3l5k_A | 250 | Protein GS1, haloacid dehalogenase-like hydrolase | 97.91 | |
| 2rbk_A | 261 | Putative uncharacterized protein; HAD-like phospha | 97.89 | |
| 3smv_A | 240 | S-(-)-azetidine-2-carboxylate hydrolase; haloacid | 97.82 | |
| 2pr7_A | 137 | Haloacid dehalogenase/epoxide hydrolase family; NP | 97.81 | |
| 3qgm_A | 268 | P-nitrophenyl phosphatase (PHO2); structural genom | 97.8 | |
| 2gfh_A | 260 | Haloacid dehalogenase-like hydrolase domain conta; | 97.77 | |
| 2qlt_A | 275 | (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac | 97.77 | |
| 2pke_A | 251 | Haloacid delahogenase-like family hydrolase; NP_63 | 97.74 | |
| 3cnh_A | 200 | Hydrolase family protein; NP_295428.1, predicted h | 97.74 | |
| 3zx4_A | 259 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd | 97.71 | |
| 2oda_A | 196 | Hypothetical protein pspto_2114; haloacid dehaloge | 97.71 | |
| 2b30_A | 301 | Pvivax hypothetical protein; SGPP, structural geno | 97.7 | |
| 2i6x_A | 211 | Hydrolase, haloacid dehalogenase-like family; HAD | 97.65 | |
| 1qyi_A | 384 | ZR25, hypothetical protein; structural genomics, P | 97.65 | |
| 3nvb_A | 387 | Uncharacterized protein; protein FKBH, protein fkb | 97.6 | |
| 2o2x_A | 218 | Hypothetical protein; structural genomics, joint c | 97.51 | |
| 3pdw_A | 266 | Uncharacterized hydrolase YUTF; structural genomic | 97.49 | |
| 4gib_A | 250 | Beta-phosphoglucomutase; rossmann fold, HAD-like, | 97.49 | |
| 3vay_A | 230 | HAD-superfamily hydrolase; rossmann fold, haloacid | 97.49 | |
| 2b0c_A | 206 | Putative phosphatase; alpha-D-glucose-1-phosphate, | 97.45 | |
| 4dcc_A | 229 | Putative haloacid dehalogenase-like hydrolase; mag | 97.39 | |
| 2p11_A | 231 | Hypothetical protein; putative haloacid dehalogena | 97.35 | |
| 2fpr_A | 176 | Histidine biosynthesis bifunctional protein HISB; | 97.19 | |
| 3f9r_A | 246 | Phosphomannomutase; trypanosome glycobiology struc | 97.19 | |
| 3pct_A | 260 | Class C acid phosphatase; hydrolase, outer membran | 97.06 | |
| 2zos_A | 249 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hal | 97.05 | |
| 1vjr_A | 271 | 4-nitrophenylphosphatase; TM1742, structural genom | 96.99 | |
| 3epr_A | 264 | Hydrolase, haloacid dehalogenase-like family; stru | 96.97 | |
| 3ocu_A | 262 | Lipoprotein E; hydrolase, outer membrane; HET: NMN | 96.96 | |
| 4g9b_A | 243 | Beta-PGM, beta-phosphoglucomutase; HAD, putative p | 96.84 | |
| 1yns_A | 261 | E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo | 96.71 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 96.61 | |
| 2zg6_A | 220 | Putative uncharacterized protein ST2620, probable | 96.56 | |
| 2fue_A | 262 | PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ | 96.5 | |
| 2x4d_A | 271 | HLHPP, phospholysine phosphohistidine inorganic py | 96.4 | |
| 2i33_A | 258 | Acid phosphatase; HAD superfamily, hydrolase; 1.57 | 96.23 | |
| 2c4n_A | 250 | Protein NAGD; nucleotide phosphatase, HAD superfam | 96.05 | |
| 2amy_A | 246 | PMM 2, phosphomannomutase 2; HS.459855, HS.313504, | 95.97 | |
| 4as2_A | 327 | Phosphorylcholine phosphatase; hydrolase, HAD supe | 95.89 | |
| 3gwi_A | 170 | Magnesium-transporting ATPase, P-type 1; P-type AT | 95.86 | |
| 2g80_A | 253 | Protein UTR4; YEL038W, UTR4 protein (unknown trans | 95.71 | |
| 2b82_A | 211 | APHA, class B acid phosphatase; DDDD acid phosphat | 95.47 | |
| 2ho4_A | 259 | Haloacid dehalogenase-like hydrolase domain contai | 94.77 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 94.68 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 94.68 | |
| 2i7d_A | 193 | 5'(3')-deoxyribonucleotidase, cytosolic type; hydr | 94.46 | |
| 1q92_A | 197 | 5(3)-deoxyribonucleotidase; alpha-beta rossman fol | 93.79 | |
| 2oyc_A | 306 | PLP phosphatase, pyridoxal phosphate phosphatase; | 93.75 | |
| 3bwv_A | 180 | Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 | 92.8 | |
| 1zjj_A | 263 | Hypothetical protein PH1952; alpha/beta hydrolase | 92.47 | |
| 1yv9_A | 264 | Hydrolase, haloacid dehalogenase family; hypotheti | 92.46 | |
| 2hhl_A | 195 | CTD small phosphatase-like protein; CTD phosphatas | 91.28 | |
| 2ght_A | 181 | Carboxy-terminal domain RNA polymerase II polypept | 89.84 | |
| 4dw8_A | 279 | Haloacid dehalogenase-like hydrolase; HAD, putativ | 89.63 | |
| 4gwb_A | 168 | Peptide methionine sulfoxide reductase MSRA 3; str | 88.94 | |
| 2zos_A | 249 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hal | 88.83 | |
| 2obb_A | 142 | Hypothetical protein; structural genomics, PSI-2, | 88.02 | |
| 1fvg_A | 199 | Peptide methionine sulfoxide reductase; oxidoreduc | 85.66 | |
| 2b30_A | 301 | Pvivax hypothetical protein; SGPP, structural geno | 85.44 | |
| 3kc2_A | 352 | Uncharacterized protein YKR070W; HAD-like, mitocho | 85.25 | |
| 1nwa_A | 203 | Peptide methionine sulfoxide reductase MSRA; oxido | 85.1 | |
| 1ff3_A | 211 | Peptide methionine sulfoxide reductase; alpha beta | 84.38 | |
| 3bqh_A | 193 | PILB, peptide methionine sulfoxide reductase MSRA/ | 83.91 | |
| 2j89_A | 261 | Methionine sulfoxide reductase A; MSRA, poplar, ox | 83.28 | |
| 2q5c_A | 196 | NTRC family transcriptional regulator; structural | 82.77 | |
| 2hx1_A | 284 | Predicted sugar phosphatases of the HAD superfamil | 82.57 | |
| 2jc9_A | 555 | Cytosolic purine 5'-nucleotidase; cytosolic 5-prim | 81.21 | |
| 1zjj_A | 263 | Hypothetical protein PH1952; alpha/beta hydrolase | 80.67 | |
| 3fzq_A | 274 | Putative hydrolase; YP_001086940.1, putative haloa | 80.61 | |
| 2hx1_A | 284 | Predicted sugar phosphatases of the HAD superfamil | 80.04 |
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
Probab=100.00 E-value=4.2e-124 Score=1140.45 Aligned_cols=716 Identities=42% Similarity=0.680 Sum_probs=649.5
Q ss_pred ceeeeecCCCCchhHHHHHHhhcCCCCeEEEEEecCCCEEEEEeCCCCCChHHHHHHHHHhcCCCccccccccCCcchhh
Q 001985 200 KVHLKLEGLNSSEDATFVQNFLESTQGVSQVEIDLSEHKVTVSYDPNLTGPRSIIQYLEEASHGPNIYHASLYTPPKRRE 279 (986)
Q Consensus 200 ~~~~~v~Gm~c~~c~~~ie~~l~~~~gV~~~~vn~~~~~~~v~~~~~~~~~~~i~~~i~~~g~~~~~~~~~~~~~~~~~~ 279 (986)
+.+|.|+||+|++|+++||+.|+++|||.+++||+.++++.|+||+..++.+++.++++++||....... ....
T Consensus 3 ~~~l~V~GM~Ca~Ca~~Ie~~L~~~~GV~~v~Vnl~~~~~~V~~d~~~~~~~~i~~ai~~~Gy~~~~~~~-----~~~~- 76 (723)
T 3j09_A 3 ERTVRVTGMTCAMCVKSIETAVGSLEGVEEVRVNLATETAFIRFDEKRIDFETIKRVIEDLGYGVVDEQA-----AVSA- 76 (723)
T ss_dssp CEEEEEETCCSHHHHHHHHHHHHTSTTEEEEEEETTTTEEEEEECTTTCCHHHHHHHHHHHCCEESSCCC-----CCCC-
T ss_pred eEEEEeCCCCchHHHHHHHHHHhcCCCceEEEEEcCCCEEEEEeCCCcCCHHHHHHHHHhcCCccccccc-----ccch-
Confidence 4689999999999999999999999999999999999999999999999999999999999987432111 1000
Q ss_pred hHHHHHHHHHHHHHHHHHHHHHHHHHHHhccccccccccchhhhhhhhhhHHHHHHHhhccceeEEecHHHHHHHHHHHh
Q 001985 280 TERLKETQMYRNRFFISCLFSVPVLLFSMVLPMIPTYGNWLDYKVHNMLTIGMLLRWILCTPVQFIVGQRFYVGAYHALR 359 (986)
Q Consensus 280 ~~~~~~~~~~~~~l~~~l~lal~l~l~~~~l~~~~~~~~~~~~~~~~~~~~~~~l~~~la~~v~~~~g~~~~~~a~~~l~ 359 (986)
..++.+.+.++++.++++++|+++++++ .+.+. ..|+.+++++|++||.|+|||++||+++|
T Consensus 77 --~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~---------------~~~~~~~l~~~~~~~~g~~~~~~a~~~l~ 138 (723)
T 3j09_A 77 --EVEHLSRMKRKLYVAAFAGVLLLFLAHF-ISLPY---------------EDFVQLLIALPAIFYSGSSIFKAAFSALR 138 (723)
T ss_dssp --CCCCCCCSCCCSSSTTTTHHHHHHHTTS-SCSSS---------------SCCSCCSTHHHHHHHHHHHHHHHTCCTTT
T ss_pred --hhHHHHHHHHHHHHHHHHHHHHHHHHHH-hccch---------------HHHHHHHHHHHHHHHhHHHHHHHHHHHHH
Confidence 0011222334455666677776655441 11111 11345678899999999999999999999
Q ss_pred cCCCCcchhHhHHHHHHHHHHHHHHHHhhccCCCCCcchhhhHHHHHHHHHHHHHHHHHHhhhHHHHHHHHhccCCCeEE
Q 001985 360 RRSANMDVLVALGTNAAYFYSVYIAVKALTSNTFEGQDFFETSAMLISFILLGKYLEVVAKGKTSDALAKLTDLAPDTAH 439 (986)
Q Consensus 360 ~~~~~md~Lv~l~~~~a~~~s~~~~l~~~~~~~~~~~~~~~~~~~l~~~~~~g~~le~~~~~k~~~~l~~l~~~~p~~~~ 439 (986)
++++|||+|+++|+.++|+||++.++... . ....||++++++++++++|+++|.++++|+++.+++|.++.|++++
T Consensus 139 ~~~~~md~l~~l~~~~a~~~s~~~~~~~~-~---~~~~~~~~~~~i~~~~~ig~~le~~~~~~~~~~i~~l~~l~~~~a~ 214 (723)
T 3j09_A 139 RRTLNMDVMYSMGVGAAFLASVLSTAGVL-P---REYSFYETSVLLLAFLLLGRTLEARAKSRTGEAIKKLVGLQAKTAV 214 (723)
T ss_dssp TCSTTSCSSCSCHHHHHHHHHHHHHHTTT-T---CCCCCCTTHHHHHHHHHHHHHHHHHHHTTCCCTTHHHHHTSCSEEE
T ss_pred cCCCChHHHHHHHHHHHHHHHHHHHHhhc-c---cchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCeeE
Confidence 99999999999999999999999887531 1 1123999999999999999999999999999999999999999999
Q ss_pred EEEecCCCCeeeEEEeeCCCcCCCcEEEEcCCCcccccEEEEeccceeeccccccCCcceecCCCCceeeeeeecCceEE
Q 001985 440 LLTLDGEGNVISEMDINTQLMQKNDIIKILPGEKVPVDGVVTDGQSYVNESMITGEAKPIAKGPGDKVIGGTMNENGCLQ 519 (986)
Q Consensus 440 v~~~~r~g~~~~~~~i~~~~l~~GDii~v~~Ge~IPaDg~vl~G~~~Vdes~lTGEs~pv~k~~g~~v~aGs~~~~g~~~ 519 (986)
|+ ||| ++++|++++|+|||+|+|++||+|||||+|++|++.||||+|||||.|+.|++||.||+||++.+|.++
T Consensus 215 v~---r~g---~~~~i~~~~l~~GDiv~v~~Ge~IPaDg~vl~G~~~VdeS~LTGES~pv~K~~g~~v~~Gt~~~~g~~~ 288 (723)
T 3j09_A 215 VI---RDG---KEIAVPVEEVAVGDIVIVRPGEKIPVDGVVVEGESYVDESMISGEPVPVLKSKGDEVFGATINNTGVLK 288 (723)
T ss_dssp EE---ETT---EEEEEEGGGCCTTCEEEECTTCBCCSEEEEEECCEEEECHHHHCCSSCEEECTTCEECTTCEECSSCEE
T ss_pred EE---ECC---EEEEEEHHHCCCCCEEEECCCCEEeeEEEEEECCeEEecccccCCCcceeecCCCeeccceEEecCcEE
Confidence 99 789 899999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EEEEEeCCchHHHHHHHHHHHHhhcCChHHHHHHHHHhhHHHHHHHHHHHHHHHHHHhhccCCCCCcccccchhhHHHHH
Q 001985 520 VKATHVGSETALSQIVQLVEAAQLARAPVQKLADQISRFFVPMVVAAAFITWLGWFIPGVAGLYPKHWIPKVMDEFELAL 599 (986)
Q Consensus 520 ~~v~~~g~~t~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 599 (986)
++|+++|.+|.+++|.+++++++.+++|+|+.+|+++.+|+|++++++++++++|++... .++..++
T Consensus 289 ~~v~~~g~~T~l~~i~~lv~~a~~~k~~~~~~~d~~~~~~~~~vl~~a~~~~~~~~~~~~-------------~~~~~~~ 355 (723)
T 3j09_A 289 IRATRVGGETLLAQIVKLVEDAMGSKPPIQRLADKVVAYFIPTVLLVAISAFIYWYFIAH-------------APLLFAF 355 (723)
T ss_dssp EEEEECGGGSHHHHHHHHHSSSCCSCCHHHHHHHHHHHHHHHHHHHHHHHHHTTSCSSTT-------------CTTCCSH
T ss_pred EEEEEecCccHHHHHHHHHHHhhccCChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcC-------------CcHHHHH
Confidence 999999999999999999999999999999999999999999999999999988765421 1233467
Q ss_pred HHHhhhhhhhcccchhhhHHHHHHHHHHHHhhcCeEecCchHHhhhcCCcEEEecCCCccccCccEEEEEEecCCCCHHH
Q 001985 600 QFGISVLVVACPCALGLATPTAVMVATGKGASLGVLIKGGNALEKAHKVKTVVFDKTGTLTVGKPEVVSAVLFSHFSMEE 679 (986)
Q Consensus 600 ~~~i~vlv~~~P~al~la~~~a~~~~~~~~~~~gilvk~~~~le~lg~i~~i~fDKTGTLT~g~~~v~~~~~~~~~~~~~ 679 (986)
.+++++++++|||+|++++|+++..++.+++++|+++|+++++|.+|++|+||||||||||+|+|++.++...+ .+.++
T Consensus 356 ~~~i~vlvia~P~aL~la~p~a~~~~~~~~a~~gilvk~~~~lE~lg~v~~i~fDKTGTLT~g~~~v~~~~~~~-~~~~~ 434 (723)
T 3j09_A 356 TTLIAVLVVACPCAFGLATPTALTVGMGKGAELGILIKNADALEVAEKVTAVIFDKTGTLTKGKPEVTDLVPLN-GDERE 434 (723)
T ss_dssp HHHHHHHHHHSCTTHHHHHHHHHHHHHHHHHTTTCEESSTTHHHHGGGCCEEEEEHHHHTSCSCCEEEEEEESS-SCHHH
T ss_pred HHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHCCeEEeChHHHHHhhcCCEEEEcCCCccccCceEEEEEEeCC-CCHHH
Confidence 78999999999999999999999999999999999999999999999999999999999999999999998874 57899
Q ss_pred HHHHHHHHHhcCCChHHHHHHHHHHHhhhhcCCCCCCCccccceeeeeCCeeEEEECCEEEEEecHHHHHhcCCCCChhh
Q 001985 680 FCDMATAAEANSEHPIAKAVVEHAKKLRQKLGSPTEHASEAKDFEVHTGAGVSGKVGDRTVLVGNKRLMMAFHVPVGPEV 759 (986)
Q Consensus 680 ~~~~~~~~e~~s~hp~~~ai~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~g~~~~~~~~~~~vg~~~~~~~~~~~~~~~~ 759 (986)
++.+++++|..++||+++|+++++++.+. ......+++.++|+|+.+ ..+.+|+++++.+.+.+.++++
T Consensus 435 ~l~~aa~~e~~s~hP~~~Ai~~~a~~~~~-------~~~~~~~~~~~~g~g~~~----~~~~~g~~~~~~~~~~~~~~~~ 503 (723)
T 3j09_A 435 LLRLAAIAERRSEHPIAEAIVKKALEHGI-------ELGEPEKVEVIAGEGVVA----DGILVGNKRLMEDFGVAVSNEV 503 (723)
T ss_dssp HHHHHHHHHTTCCSHHHHHHHHHHHHTTC-------CCCSCCCCEEETTTEEEE----TTEEEECHHHHHHTTCCCCHHH
T ss_pred HHHHHHHHhccCCCchhHHHHHHHHhcCC-------CcCCccceEEecCCceEE----EEEEECCHHHHHhcCCCccHHH
Confidence 99999999999999999999999988765 234567889999999987 6789999999999998888888
Q ss_pred HHHHHHHHhccCcEEEEEECCEEEEEEEecCCCChhHHHHHHHHHHCCCeEEEEcCCCHHHHHHHHHHcCCceEEEecCc
Q 001985 760 DDYMMKNEQLARTCVLVAIDGRVAGAFAVTDPVKPEAQIVVSSLRSMEISSIMVTGDNWATANAIAKEVGIGKVFAETDP 839 (986)
Q Consensus 760 ~~~~~~~~~~g~~~i~va~~~~~~G~i~~~d~~~~~~~~~i~~l~~~gi~~~~~Tgd~~~~a~~~a~~~gi~~~~~~~~p 839 (986)
.+..+++..+|++++++++|++++|+++++|++|++++++|++|+++|++++|+|||+..+++.+++++|++.++++++|
T Consensus 504 ~~~~~~~~~~g~~~~~va~~~~~~G~i~i~D~~~~~~~~~i~~l~~~Gi~v~~~TGd~~~~a~~ia~~lgi~~~~~~~~P 583 (723)
T 3j09_A 504 ELALEKLEREAKTAVIVARNGRVEGIIAVSDTLKESAKPAVQELKRMGIKVGMITGDNWRSAEAISRELNLDLVIAEVLP 583 (723)
T ss_dssp HHHHHHHHTTTCEEEEEEETTEEEEEEEEECCSCTTHHHHHHHHHHTTCEEEEECSSCHHHHHHHHHHHTCSEEECSCCT
T ss_pred HHHHHHHHhcCCeEEEEEECCEEEEEEeecCCcchhHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHcCCcEEEccCCH
Confidence 88888899999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccHHHHHHHHhHcCCEEEEEcCCcccHHHHHhCCceEEecCCcHHHHHhcCEEEeCCChhHHHHHHHHHHHHHHHHHHHH
Q 001985 840 VGKANKIKELQLKGMTVAMVGDGINDSPALVAADVGMAIGAGTDVAIEAADIVLIKSSLEDVVTAIDLSRKTISRIRLNY 919 (986)
Q Consensus 840 ~~K~~~v~~l~~~g~~v~~vGDg~nD~~al~~A~vgia~~~~~~~~~~~ad~vl~~~~~~~l~~~i~~~r~~~~~i~~n~ 919 (986)
++|.++++.++++ +.|+|+|||.||+|||++||+||+||++++.++++||++++++++.++++++++||+++++|+||+
T Consensus 584 ~~K~~~v~~l~~~-~~v~~vGDg~ND~~al~~A~vgiamg~g~~~a~~~AD~vl~~~~~~~i~~~i~~~r~~~~~i~~nl 662 (723)
T 3j09_A 584 HQKSEEVKKLQAK-EVVAFVGDGINDAPALAQADLGIAVGSGSDVAVESGDIVLIRDDLRDVVAAIQLSRKTMSKIKQNI 662 (723)
T ss_dssp TCHHHHHHHHTTT-CCEEEEECSSTTHHHHHHSSEEEECCCCSCCSSCCSSEECSSCCTTHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHhcC-CeEEEEECChhhHHHHhhCCEEEEeCCCcHHHHHhCCEEEeCCCHHHHHHHHHHHHHHHHHHHHHH
Confidence 9999999999988 889999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHhhhccccCCCCCcHHHHHHHhhchhHhHhhhhhhcccCCCCC
Q 001985 920 VWALGYNVLAVPIAAGILYPFTGIRLPPWLAGACMAASSLSVLCSSLLLQSYKKPL 975 (986)
Q Consensus 920 ~~~~~~n~~~i~la~g~~~~~~g~~l~p~~a~~~m~~ss~~v~~~s~~l~~~~~~~ 975 (986)
+|+++||++++|+|+++++|++|+.++||+|+++|.+||++|++||+||++++++.
T Consensus 663 ~~a~~~n~~~i~~a~~~~~~~~g~~l~p~~a~~~m~~ss~~vv~nslrl~~~~~~~ 718 (723)
T 3j09_A 663 FWALIYNVILIPAAAGLLYPIFGVVFRPEFAGLAMAMSSVSVVANSLLLRNYVPPI 718 (723)
T ss_dssp HHHHHHHHHHHHHHHHTTSSCCCCSCCHHHHHHHHHTHHHHHHHHTTSCCCCSCST
T ss_pred HHHHHHHHHHHHHHHHhhhhccccccCHHHHHHHHhccHHHHHHHHHHhccCCCch
Confidence 99999999999999999999999999999999999999999999999999887654
|
| >3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 | Back alignment and structure |
|---|
| >3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A | Back alignment and structure |
|---|
| >3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... | Back alignment and structure |
|---|
| >3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A | Back alignment and structure |
|---|
| >2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I | Back alignment and structure |
|---|
| >3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* | Back alignment and structure |
|---|
| >2hc8_A PACS, cation-transporting ATPase, P-type; copper, COPA, COPB, actuator, transport protein; 1.65A {Archaeoglobus fulgidus} PDB: 2voy_F | Back alignment and structure |
|---|
| >2kij_A Copper-transporting ATPase 1; actuator, menkes disease, alternative splicing, ATP-binding, cell membrane, cytoplasm, disease mutation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kmv_A Copper-transporting ATPase 1; menkes, nucleotide binding protein, alternative splicing, ATP-binding, cell membrane, cytoplasm, disease mutation; NMR {Homo sapiens} PDB: 2kmx_A* | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1svj_A Potassium-transporting ATPase B chain; alpha-beta sandwich, hydrolase; NMR {Escherichia coli} SCOP: d.220.1.1 PDB: 1u7q_A 2a00_A* 2a29_A* | Back alignment and structure |
|---|
| >3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A | Back alignment and structure |
|---|
| >2arf_A Wilson disease ATPase; P-type ATPase,ATP7B, copper transport, nucleotide binding, ATP binding, hydrolase; NMR {Homo sapiens} PDB: 2koy_A | Back alignment and structure |
|---|
| >3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} | Back alignment and structure |
|---|
| >1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* | Back alignment and structure |
|---|
| >3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A | Back alignment and structure |
|---|
| >3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 | Back alignment and structure |
|---|
| >3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 | Back alignment and structure |
|---|
| >4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A | Back alignment and structure |
|---|
| >3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* | Back alignment and structure |
|---|
| >4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* | Back alignment and structure |
|---|
| >4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A | Back alignment and structure |
|---|
| >1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* | Back alignment and structure |
|---|
| >1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A | Back alignment and structure |
|---|
| >2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} | Back alignment and structure |
|---|
| >4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 | Back alignment and structure |
|---|
| >2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A | Back alignment and structure |
|---|
| >2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A | Back alignment and structure |
|---|
| >1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A | Back alignment and structure |
|---|
| >3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A | Back alignment and structure |
|---|
| >1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A | Back alignment and structure |
|---|
| >3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A | Back alignment and structure |
|---|
| >1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A | Back alignment and structure |
|---|
| >2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A | Back alignment and structure |
|---|
| >1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A | Back alignment and structure |
|---|
| >2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} | Back alignment and structure |
|---|
| >2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A | Back alignment and structure |
|---|
| >2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A | Back alignment and structure |
|---|
| >3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} | Back alignment and structure |
|---|
| >2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} | Back alignment and structure |
|---|
| >1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A | Back alignment and structure |
|---|
| >1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A | Back alignment and structure |
|---|
| >3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A | Back alignment and structure |
|---|
| >1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A | Back alignment and structure |
|---|
| >2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A | Back alignment and structure |
|---|
| >1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A | Back alignment and structure |
|---|
| >1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 | Back alignment and structure |
|---|
| >1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A | Back alignment and structure |
|---|
| >1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A | Back alignment and structure |
|---|
| >1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A | Back alignment and structure |
|---|
| >2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A | Back alignment and structure |
|---|
| >1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A | Back alignment and structure |
|---|
| >1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A | Back alignment and structure |
|---|
| >2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A | Back alignment and structure |
|---|
| >2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A | Back alignment and structure |
|---|
| >1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B | Back alignment and structure |
|---|
| >1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A | Back alignment and structure |
|---|
| >1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A | Back alignment and structure |
|---|
| >2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} | Back alignment and structure |
|---|
| >1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A | Back alignment and structure |
|---|
| >3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A | Back alignment and structure |
|---|
| >1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A | Back alignment and structure |
|---|
| >1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 | Back alignment and structure |
|---|
| >1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B | Back alignment and structure |
|---|
| >2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A | Back alignment and structure |
|---|
| >1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A | Back alignment and structure |
|---|
| >1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A | Back alignment and structure |
|---|
| >2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A | Back alignment and structure |
|---|
| >3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* | Back alignment and structure |
|---|
| >2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} | Back alignment and structure |
|---|
| >2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A | Back alignment and structure |
|---|
| >2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A | Back alignment and structure |
|---|
| >2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} | Back alignment and structure |
|---|
| >3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A | Back alignment and structure |
|---|
| >2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A | Back alignment and structure |
|---|
| >2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A | Back alignment and structure |
|---|
| >1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A | Back alignment and structure |
|---|
| >1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A | Back alignment and structure |
|---|
| >3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A | Back alignment and structure |
|---|
| >3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} | Back alignment and structure |
|---|
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A | Back alignment and structure |
|---|
| >3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A | Back alignment and structure |
|---|
| >3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} | Back alignment and structure |
|---|
| >2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 | Back alignment and structure |
|---|
| >2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A | Back alignment and structure |
|---|
| >3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A | Back alignment and structure |
|---|
| >2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A | Back alignment and structure |
|---|
| >3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} | Back alignment and structure |
|---|
| >3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* | Back alignment and structure |
|---|
| >1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* | Back alignment and structure |
|---|
| >2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* | Back alignment and structure |
|---|
| >2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A | Back alignment and structure |
|---|
| >1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A | Back alignment and structure |
|---|
| >2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* | Back alignment and structure |
|---|
| >3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A | Back alignment and structure |
|---|
| >2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 | Back alignment and structure |
|---|
| >3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} | Back alignment and structure |
|---|
| >2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A | Back alignment and structure |
|---|
| >1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} | Back alignment and structure |
|---|
| >1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A | Back alignment and structure |
|---|
| >3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A | Back alignment and structure |
|---|
| >1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 | Back alignment and structure |
|---|
| >3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A | Back alignment and structure |
|---|
| >3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} | Back alignment and structure |
|---|
| >2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A | Back alignment and structure |
|---|
| >2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* | Back alignment and structure |
|---|
| >2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 | Back alignment and structure |
|---|
| >2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 | Back alignment and structure |
|---|
| >3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} | Back alignment and structure |
|---|
| >3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 | Back alignment and structure |
|---|
| >4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A | Back alignment and structure |
|---|
| >2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* | Back alignment and structure |
|---|
| >3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* | Back alignment and structure |
|---|
| >3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} | Back alignment and structure |
|---|
| >2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A | Back alignment and structure |
|---|
| >1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* | Back alignment and structure |
|---|
| >3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A | Back alignment and structure |
|---|
| >3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A | Back alignment and structure |
|---|
| >4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* | Back alignment and structure |
|---|
| >2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A | Back alignment and structure |
|---|
| >2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A | Back alignment and structure |
|---|
| >4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* | Back alignment and structure |
|---|
| >3gwi_A Magnesium-transporting ATPase, P-type 1; P-type ATPase, nucleotide binding, ATP binding, MGTA, membra protein, cell inner membrane; 1.60A {Escherichia coli} | Back alignment and structure |
|---|
| >2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 | Back alignment and structure |
|---|
| >2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A | Back alignment and structure |
|---|
| >2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* | Back alignment and structure |
|---|
| >1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A | Back alignment and structure |
|---|
| >2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* | Back alignment and structure |
|---|
| >3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A | Back alignment and structure |
|---|
| >4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A | Back alignment and structure |
|---|
| >4gwb_A Peptide methionine sulfoxide reductase MSRA 3; structural genomics, protein structure initiative, nysgrc, R PSI-biology; 1.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A | Back alignment and structure |
|---|
| >2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 | Back alignment and structure |
|---|
| >1fvg_A Peptide methionine sulfoxide reductase; oxidoreductase; 1.60A {Bos taurus} SCOP: d.58.28.1 PDB: 1fva_A 2l90_A* | Back alignment and structure |
|---|
| >2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* | Back alignment and structure |
|---|
| >1nwa_A Peptide methionine sulfoxide reductase MSRA; oxidoreductase, product complex, structural genomics, PSI, protein structure initiative; 1.50A {Mycobacterium tuberculosis} SCOP: d.58.28.1 | Back alignment and structure |
|---|
| >1ff3_A Peptide methionine sulfoxide reductase; alpha beta roll, PMSR, MSRA, oxidoreductase; 1.90A {Escherichia coli} SCOP: d.58.28.1 PDB: 2gt3_A 2iem_A | Back alignment and structure |
|---|
| >3bqh_A PILB, peptide methionine sulfoxide reductase MSRA/MSRB; methionine sulfoxide reductase A, oxidized form, elect transport; 1.95A {Neisseria meningitidis} PDB: 3bqe_A 3bqf_A* 3bqg_A | Back alignment and structure |
|---|
| >2j89_A Methionine sulfoxide reductase A; MSRA, poplar, oxidoreductase; 1.7A {Populus trichocarpa} | Back alignment and structure |
|---|
| >2q5c_A NTRC family transcriptional regulator; structural genomics, protein structure initiative; HET: SO4 GOL; 1.49A {Clostridium acetobutylicum atcc 824} | Back alignment and structure |
|---|
| >2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2jc9_A Cytosolic purine 5'-nucleotidase; cytosolic 5-prime nucleotidase II, GMP-IMP specific nucleotidase, CN-II, NT5C2, hydrolase, polymorphism; HET: ADN; 1.5A {Homo sapiens} PDB: 2j2c_A* 2xje_A* 2xjf_A* 2jcm_A* 2xcw_A* 2xcv_A* 2xcx_A 2xjb_A* 2xjc_A* 2xjd_A* | Back alignment and structure |
|---|
| >1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 986 | ||||
| d2b8ea1 | 135 | c.108.1.7 (A:416-434,A:548-663) Cation-transportin | 4e-29 | |
| d1wpga2 | 168 | c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, ca | 7e-28 | |
| d2a29a1 | 136 | d.220.1.1 (A:316-451) Potassium-transporting ATPas | 8e-18 | |
| d1p6ta2 | 79 | d.58.17.1 (A:73-151) Potential copper-translocatin | 2e-17 | |
| d1p6ta2 | 79 | d.58.17.1 (A:73-151) Potential copper-translocatin | 1e-14 | |
| d1p6ta2 | 79 | d.58.17.1 (A:73-151) Potential copper-translocatin | 6e-07 | |
| d1kvja_ | 79 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 2e-17 | |
| d1kvja_ | 79 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 2e-15 | |
| d1kvja_ | 79 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 2e-09 | |
| d1cpza_ | 68 | d.58.17.1 (A:) Copper chaperone {Enterococcus hira | 3e-17 | |
| d1cpza_ | 68 | d.58.17.1 (A:) Copper chaperone {Enterococcus hira | 4e-13 | |
| d1cpza_ | 68 | d.58.17.1 (A:) Copper chaperone {Enterococcus hira | 1e-06 | |
| d2aw0a_ | 72 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 4e-17 | |
| d2aw0a_ | 72 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 3e-13 | |
| d2aw0a_ | 72 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 2e-07 | |
| d1osda_ | 72 | d.58.17.1 (A:) Mercuric ion binding protein MerP { | 5e-17 | |
| d1osda_ | 72 | d.58.17.1 (A:) Mercuric ion binding protein MerP { | 4e-15 | |
| d1osda_ | 72 | d.58.17.1 (A:) Mercuric ion binding protein MerP { | 4e-07 | |
| d2ggpb1 | 72 | d.58.17.1 (B:1-72) Copper transporter domain ccc2a | 2e-16 | |
| d2ggpb1 | 72 | d.58.17.1 (B:1-72) Copper transporter domain ccc2a | 1e-12 | |
| d2ggpb1 | 72 | d.58.17.1 (B:1-72) Copper transporter domain ccc2a | 2e-06 | |
| d2qifa1 | 69 | d.58.17.1 (A:1-69) Copper chaperone {Bacillus subt | 3e-16 | |
| d2qifa1 | 69 | d.58.17.1 (A:1-69) Copper chaperone {Bacillus subt | 2e-13 | |
| d2qifa1 | 69 | d.58.17.1 (A:1-69) Copper chaperone {Bacillus subt | 5e-07 | |
| d1p6ta1 | 72 | d.58.17.1 (A:1-72) Potential copper-translocating | 3e-16 | |
| d1p6ta1 | 72 | d.58.17.1 (A:1-72) Potential copper-translocating | 1e-14 | |
| d1p6ta1 | 72 | d.58.17.1 (A:1-72) Potential copper-translocating | 6e-07 | |
| d2b8ea2 | 113 | d.220.1.1 (A:435-547) Cation-transporting ATPase { | 3e-16 | |
| d1q8la_ | 84 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 1e-15 | |
| d1q8la_ | 84 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 2e-11 | |
| d1q8la_ | 84 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 5e-05 | |
| d1mwza_ | 73 | d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, | 1e-14 | |
| d1mwza_ | 73 | d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, | 2e-11 | |
| d1mwza_ | 73 | d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, | 1e-04 | |
| d2feaa1 | 226 | c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthio | 3e-11 | |
| d1rkua_ | 206 | c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomona | 4e-11 | |
| d1qupa2 | 72 | d.58.17.1 (A:2-73) Copper chaperone for superoxide | 5e-10 | |
| d1qupa2 | 72 | d.58.17.1 (A:2-73) Copper chaperone for superoxide | 3e-07 | |
| d1sb6a_ | 64 | d.58.17.1 (A:) Copper chaperone {Synechocystis sp. | 2e-09 | |
| d1sb6a_ | 64 | d.58.17.1 (A:) Copper chaperone {Synechocystis sp. | 6e-09 | |
| d1sb6a_ | 64 | d.58.17.1 (A:) Copper chaperone {Synechocystis sp. | 0.001 | |
| d1k1ea_ | 177 | c.108.1.5 (A:) Probable phosphatase YrbI {Haemophi | 9e-09 | |
| d1fe0a_ | 66 | d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX | 2e-08 | |
| d1fe0a_ | 66 | d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX | 9e-05 | |
| d1cc8a_ | 72 | d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX | 7e-08 | |
| d1cc8a_ | 72 | d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX | 1e-07 | |
| d1wr8a_ | 230 | c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPa | 3e-07 | |
| d1wpga1 | 115 | b.82.7.1 (A:125-239) Calcium ATPase, transduction | 4e-07 | |
| d1qyia_ | 380 | c.108.1.13 (A:) Hypothetical protein MW1667 (SA154 | 1e-06 | |
| d1j97a_ | 210 | c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon | 1e-06 | |
| d2b30a1 | 283 | c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmod | 1e-05 | |
| d1nnla_ | 217 | c.108.1.4 (A:) Phosphoserine phosphatase {Human (H | 4e-05 | |
| d1l6ra_ | 225 | c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPa | 0.001 | |
| d1nrwa_ | 285 | c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillu | 0.002 | |
| d1rkqa_ | 271 | c.108.1.10 (A:) Hypothetical protein YidA {Escheri | 0.002 |
| >d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 135 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: Meta-cation ATPase, catalytic domain P domain: Cation-transporting ATPase species: Archaeon Archaeoglobus fulgidus [TaxId: 2234]
Score = 110 bits (277), Expect = 4e-29
Identities = 60/134 (44%), Positives = 82/134 (61%), Gaps = 1/134 (0%)
Query: 772 TCVLVAIDGRVAGAFAVTDPVKPEAQIVVSSLRSMEISSIMVTGDNWATANAIAKEVGIG 831
V D D +K A+ V L+ M I M+TGDNW +A AI++E+ +
Sbjct: 2 KVTAVIFDKTGTLTKGKPDTLKESAKPAVQELKRMGIKVGMITGDNWRSAEAISRELNLD 61
Query: 832 KVFAETDPVGKANKIKELQLKGMTVAMVGDGINDSPALVAADVGMAIGAGTDVAIEAADI 891
V AE P K+ ++K+LQ VA VGDGIND+PAL AD+G+A+G+G+DVA+E+ DI
Sbjct: 62 LVIAEVLPHQKSEEVKKLQ-AKEVVAFVGDGINDAPALAQADLGIAVGSGSDVAVESGDI 120
Query: 892 VLIKSSLEDVVTAI 905
VLI+ L DVV AI
Sbjct: 121 VLIRDDLRDVVAAI 134
|
| >d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 168 | Back information, alignment and structure |
|---|
| >d2a29a1 d.220.1.1 (A:316-451) Potassium-transporting ATPase B chain, KdpB {Escherichia coli [TaxId: 562]} Length = 136 | Back information, alignment and structure |
|---|
| >d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 79 | Back information, alignment and structure |
|---|
| >d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 79 | Back information, alignment and structure |
|---|
| >d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 79 | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Length = 68 | Back information, alignment and structure |
|---|
| >d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Length = 68 | Back information, alignment and structure |
|---|
| >d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Length = 68 | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Length = 72 | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Length = 72 | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Length = 72 | Back information, alignment and structure |
|---|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Length = 69 | Back information, alignment and structure |
|---|
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Length = 69 | Back information, alignment and structure |
|---|
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Length = 69 | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 72 | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 72 | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 72 | Back information, alignment and structure |
|---|
| >d2b8ea2 d.220.1.1 (A:435-547) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 113 | Back information, alignment and structure |
|---|
| >d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 73 | Back information, alignment and structure |
|---|
| >d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 73 | Back information, alignment and structure |
|---|
| >d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 73 | Back information, alignment and structure |
|---|
| >d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Length = 226 | Back information, alignment and structure |
|---|
| >d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Length = 206 | Back information, alignment and structure |
|---|
| >d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Length = 64 | Back information, alignment and structure |
|---|
| >d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Length = 64 | Back information, alignment and structure |
|---|
| >d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Length = 64 | Back information, alignment and structure |
|---|
| >d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} Length = 177 | Back information, alignment and structure |
|---|
| >d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Length = 66 | Back information, alignment and structure |
|---|
| >d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Length = 66 | Back information, alignment and structure |
|---|
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Length = 230 | Back information, alignment and structure |
|---|
| >d1wpga1 b.82.7.1 (A:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 115 | Back information, alignment and structure |
|---|
| >d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Length = 380 | Back information, alignment and structure |
|---|
| >d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 210 | Back information, alignment and structure |
|---|
| >d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Length = 283 | Back information, alignment and structure |
|---|
| >d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Length = 217 | Back information, alignment and structure |
|---|
| >d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 225 | Back information, alignment and structure |
|---|
| >d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Length = 285 | Back information, alignment and structure |
|---|
| >d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Length = 271 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 986 | |||
| d2b8ea1 | 135 | Cation-transporting ATPase {Archaeon Archaeoglobus | 99.94 | |
| d1wpga2 | 168 | Calcium ATPase, catalytic domain P {Rabbit (Orycto | 99.93 | |
| d1wpga1 | 115 | Calcium ATPase, transduction domain A {Rabbit (Ory | 99.85 | |
| d1qyia_ | 380 | Hypothetical protein MW1667 (SA1546) {Staphylococc | 99.63 | |
| d2b8ea2 | 113 | Cation-transporting ATPase {Archaeon Archaeoglobus | 99.53 | |
| d2a29a1 | 136 | Potassium-transporting ATPase B chain, KdpB {Esche | 99.44 | |
| d1cpza_ | 68 | Copper chaperone {Enterococcus hirae [TaxId: 1354] | 99.42 | |
| d1osda_ | 72 | Mercuric ion binding protein MerP {Ralstonia metal | 99.42 | |
| d2qifa1 | 69 | Copper chaperone {Bacillus subtilis, CopZ [TaxId: | 99.41 | |
| d1p6ta1 | 72 | Potential copper-translocating P-type ATPase CopA | 99.41 | |
| d2aw0a_ | 72 | Menkes copper-transporting ATPase {Human (Homo sap | 99.4 | |
| d2ggpb1 | 72 | Copper transporter domain ccc2a {Baker's yeast (Sa | 99.4 | |
| d1cpza_ | 68 | Copper chaperone {Enterococcus hirae [TaxId: 1354] | 99.4 | |
| d1q8la_ | 84 | Menkes copper-transporting ATPase {Human (Homo sap | 99.38 | |
| d1kvja_ | 79 | Menkes copper-transporting ATPase {Human (Homo sap | 99.38 | |
| d1osda_ | 72 | Mercuric ion binding protein MerP {Ralstonia metal | 99.37 | |
| d2aw0a_ | 72 | Menkes copper-transporting ATPase {Human (Homo sap | 99.36 | |
| d1q8la_ | 84 | Menkes copper-transporting ATPase {Human (Homo sap | 99.36 | |
| d1p6ta2 | 79 | Potential copper-translocating P-type ATPase CopA | 99.35 | |
| d2qifa1 | 69 | Copper chaperone {Bacillus subtilis, CopZ [TaxId: | 99.35 | |
| d1p6ta1 | 72 | Potential copper-translocating P-type ATPase CopA | 99.35 | |
| d1kvja_ | 79 | Menkes copper-transporting ATPase {Human (Homo sap | 99.34 | |
| d2ggpb1 | 72 | Copper transporter domain ccc2a {Baker's yeast (Sa | 99.34 | |
| d1p6ta2 | 79 | Potential copper-translocating P-type ATPase CopA | 99.31 | |
| d1mwza_ | 73 | Metal ion-transporting ATPase ZntA, N-terminal dom | 99.27 | |
| d1wr8a_ | 230 | Phosphoglycolate phosphatase, PGPase {Pyrococcus h | 99.21 | |
| d1mwza_ | 73 | Metal ion-transporting ATPase ZntA, N-terminal dom | 99.2 | |
| d1k1ea_ | 177 | Probable phosphatase YrbI {Haemophilus influenzae, | 99.2 | |
| d1l6ra_ | 225 | Phosphoglycolate phosphatase, PGPase {Archaeon The | 99.17 | |
| d1sb6a_ | 64 | Copper chaperone {Synechocystis sp. pcc 6803, Scat | 99.16 | |
| d1nrwa_ | 285 | Hypothetical protein YwpJ {Bacillus subtilis [TaxI | 99.11 | |
| d1sb6a_ | 64 | Copper chaperone {Synechocystis sp. pcc 6803, Scat | 99.11 | |
| d1rlma_ | 269 | Sugar phosphatase SupH (YbiV) {Escherichia coli [T | 99.1 | |
| d1rkqa_ | 271 | Hypothetical protein YidA {Escherichia coli [TaxId | 99.08 | |
| d1qupa2 | 72 | Copper chaperone for superoxide dismutase, N-termi | 99.08 | |
| d1qupa2 | 72 | Copper chaperone for superoxide dismutase, N-termi | 99.01 | |
| d1fe0a_ | 66 | ATX1 metallochaperone protein (ATOX1) {Human (Homo | 99.0 | |
| d1fe0a_ | 66 | ATX1 metallochaperone protein (ATOX1) {Human (Homo | 98.99 | |
| d1nnla_ | 217 | Phosphoserine phosphatase {Human (Homo sapiens) [T | 98.99 | |
| d1cc8a_ | 72 | ATX1 metallochaperone protein (ATOX1) {Baker's yea | 98.97 | |
| d1nf2a_ | 267 | Hypothetical protein TM0651 {Thermotoga maritima [ | 98.96 | |
| d1cc8a_ | 72 | ATX1 metallochaperone protein (ATOX1) {Baker's yea | 98.95 | |
| d2feaa1 | 226 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 98.95 | |
| d2rbka1 | 260 | Sugar-phosphate phosphatase BT4131 {Bacteroides th | 98.9 | |
| d1j97a_ | 210 | Phosphoserine phosphatase {Archaeon Methanococcus | 98.89 | |
| d2b30a1 | 283 | PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 | 98.87 | |
| d1wzca1 | 243 | Putative mannosyl-3-phosphoglycerate phosphatase M | 98.8 | |
| d1rkua_ | 206 | Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta | 98.74 | |
| d1wpga4 | 472 | Calcium ATPase, transmembrane domain M {Rabbit (Or | 98.63 | |
| d1s2oa1 | 244 | Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc | 98.61 | |
| d1xvia_ | 232 | Putative mannosyl-3-phosphoglycerate phosphatase M | 98.51 | |
| d2ah5a1 | 210 | predicted phosphatase SP0104 {Streptococcus pneumo | 98.29 | |
| d1u02a_ | 229 | Trehalose-6-phosphate phosphatase related protein | 98.23 | |
| d2hsza1 | 224 | Phosphoglycolate phosphatase Gph {Haemophilus somn | 98.15 | |
| d2hcfa1 | 228 | Hypothetical protein CT1708 {Chlorobium tepidum [T | 98.12 | |
| d1swva_ | 257 | Phosphonoacetaldehyde hydrolase {Bacillus cereus [ | 98.11 | |
| d2fuea1 | 244 | Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: | 98.06 | |
| d1te2a_ | 218 | Phosphatase YniC {Escherichia coli [TaxId: 562]} | 97.97 | |
| d2go7a1 | 204 | Hypothetical protein SP2064 {Streptococcus pneumon | 97.8 | |
| d1x42a1 | 230 | Hypothetical protein PH0459 {Archaeon Pyrococcus h | 97.76 | |
| d2hdoa1 | 207 | Phosphoglycolate phosphatase {Lactobacillus planta | 97.72 | |
| d2bdua1 | 291 | Cytosolic 5'-nucleotidase III {Mouse (Mus musculus | 97.72 | |
| d2gmwa1 | 182 | D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc | 97.71 | |
| d1u7pa_ | 164 | Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu | 97.45 | |
| d2amya1 | 243 | Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: | 97.41 | |
| d1zs9a1 | 253 | E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | 97.38 | |
| d2gfha1 | 247 | N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m | 97.34 | |
| d2fi1a1 | 187 | Putative hydrolase SP0805 {Streptococcus pneumonia | 97.2 | |
| d2o2xa1 | 209 | Hypothetical protein Mll2559 {Mesorhizobium loti [ | 96.98 | |
| d1zrna_ | 220 | L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s | 96.88 | |
| d1ltqa1 | 149 | Polynucleotide kinase, phosphatase domain {Bacteri | 96.67 | |
| d2fdra1 | 222 | Hypothetical protein Atu0790 {Agrobacterium tumefa | 96.64 | |
| d1vjra_ | 261 | Hypothetical protein TM1742 {Thermotoga maritima [ | 96.62 | |
| d1o08a_ | 221 | beta-Phosphoglucomutase {Lactococcus lactis [TaxId | 96.59 | |
| d1y8aa1 | 308 | Hypothetical protein AF1437 {Archaeon Archaeoglobu | 96.26 | |
| d1cr6a1 | 222 | Epoxide hydrolase, N-terminal domain {Mouse (Mus m | 96.21 | |
| d1qq5a_ | 245 | L-2-Haloacid dehalogenase, HAD {Xanthobacter autot | 96.18 | |
| d1yv9a1 | 253 | Putative hydrolase EF1188 {Enterococcus faecalis [ | 96.17 | |
| d1q3ia_ | 214 | Sodium/potassium-transporting ATPase alpha chain { | 96.14 | |
| d1wvia_ | 253 | Putative phosphatase SMU.1415c {Streptococcus muta | 96.1 | |
| d2fpwa1 | 161 | Histidine biosynthesis bifunctional protein HisB, | 96.05 | |
| d2c4na1 | 250 | NagD {Escherichia coli [TaxId: 562]} | 96.0 | |
| d2b82a1 | 209 | Class B acid phosphatase, AphA {Escherichia coli [ | 95.51 | |
| d1zd3a1 | 225 | Epoxide hydrolase, N-terminal domain {Human (Homo | 95.19 | |
| d2b0ca1 | 197 | Putative phosphatase YihX {Escherichia coli [TaxId | 94.25 | |
| d1nwaa_ | 168 | Peptide methionine sulfoxide reductase {Mycobacter | 86.03 | |
| d1ff3a_ | 211 | Peptide methionine sulfoxide reductase {Escherichi | 81.96 | |
| d1fvga_ | 192 | Peptide methionine sulfoxide reductase {Cow (Bos t | 81.39 |
| >d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: Meta-cation ATPase, catalytic domain P domain: Cation-transporting ATPase species: Archaeon Archaeoglobus fulgidus [TaxId: 2234]
Probab=99.94 E-value=2.4e-27 Score=221.60 Aligned_cols=132 Identities=46% Similarity=0.687 Sum_probs=117.1
Q ss_pred EEEEECCEEEEEEEecCCCChhHHHHHHHHHHCCCeEEEEcCCCHHHHHHHHHHcCCceEEEecCcccHHHHHHHHhHcC
Q 001985 774 VLVAIDGRVAGAFAVTDPVKPEAQIVVSSLRSMEISSIMVTGDNWATANAIAKEVGIGKVFAETDPVGKANKIKELQLKG 853 (986)
Q Consensus 774 i~va~~~~~~G~i~~~d~~~~~~~~~i~~l~~~gi~~~~~Tgd~~~~a~~~a~~~gi~~~~~~~~p~~K~~~v~~l~~~g 853 (986)
..++.|++..+.++++|++|++++++|+.||++|++++|+|||+..+++++|+++||+.+|++++|++|..+++.+|+.
T Consensus 4 ~~~~~d~~~~~~~g~~D~lr~~a~~~I~~L~~~Gi~v~ilTGD~~~~a~~ia~~lgI~~v~~~~~p~~k~~~v~~~q~~- 82 (135)
T d2b8ea1 4 TAVIFDKTGTLTKGKPDTLKESAKPAVQELKRMGIKVGMITGDNWRSAEAISRELNLDLVIAEVLPHQKSEEVKKLQAK- 82 (135)
T ss_dssp CEEEEECCCCCBCSCCCCBCTTHHHHHHHHHHTTCEEEEECSSCHHHHHHHHHHHTCSEEECSCCHHHHHHHHHHHTTT-
T ss_pred EEEEECCceEEEEecCCCCCccHHHHHHHHHHcCCEEEEEcCcchhhhhHHHhhhhhhhhccccchhHHHHHHHHHHcC-
Confidence 4566777777889999999999999999999999999999999999999999999999999999999999999999875
Q ss_pred CEEEEEcCCcccHHHHHhCCceEEecCCcHHHHHhcCEEEeCCChhHHHHHHH
Q 001985 854 MTVAMVGDGINDSPALVAADVGMAIGAGTDVAIEAADIVLIKSSLEDVVTAID 906 (986)
Q Consensus 854 ~~v~~vGDg~nD~~al~~A~vgia~~~~~~~~~~~ad~vl~~~~~~~l~~~i~ 906 (986)
+.|+|+|||.||+|||++||+||+++++++.++++||++++++++..|+++|+
T Consensus 83 ~~v~~vGDg~nD~~aL~~Advgia~~~~~~~~~~aADivl~~~~l~~i~~aI~ 135 (135)
T d2b8ea1 83 EVVAFVGDGINDAPALAQADLGIAVGSGSDVAVESGDIVLIRDDLRDVVAAIQ 135 (135)
T ss_dssp SCEEEEECSSSSHHHHHHSSEEEEECCC--------SEEESSCCTHHHHHHHC
T ss_pred CEEEEEeCCCCcHHHHHhCCeeeecCccCHHHHHhCCEEEECCCHHHHHHHhC
Confidence 57999999999999999999999999999999999999999999999998874
|
| >d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1wpga1 b.82.7.1 (A:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2b8ea2 d.220.1.1 (A:435-547) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2a29a1 d.220.1.1 (A:316-451) Potassium-transporting ATPase B chain, KdpB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} | Back information, alignment and structure |
|---|
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} | Back information, alignment and structure |
|---|
| >d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} | Back information, alignment and structure |
|---|
| >d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1wpga4 f.33.1.1 (A:1-124,A:240-343,A:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} | Back information, alignment and structure |
|---|
| >d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1y8aa1 c.108.1.24 (A:1-308) Hypothetical protein AF1437 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1q3ia_ d.220.1.1 (A:) Sodium/potassium-transporting ATPase alpha chain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nwaa_ d.58.28.1 (A:) Peptide methionine sulfoxide reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ff3a_ d.58.28.1 (A:) Peptide methionine sulfoxide reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fvga_ d.58.28.1 (A:) Peptide methionine sulfoxide reductase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|