Query         002049
Match_columns 975
No_of_seqs    177 out of 190
Neff          4.1 
Searched_HMMs 46136
Date          Thu Mar 28 15:21:45 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/002049.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/002049hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF07699 GCC2_GCC3:  GCC2 and G  96.9  0.0005 1.1E-08   56.5   2.2   26  805-832     9-34  (48)
  2 KOG0196 Tyrosine kinase, EPH (  96.3  0.0036 7.7E-08   76.4   4.5   55  796-863   261-319 (996)
  3 PF07562 NCD3G:  Nine Cysteines  94.0   0.012 2.5E-07   50.0  -0.6   36  795-832     6-51  (54)
  4 PHA02637 TNF-alpha-receptor-li  93.4   0.093   2E-06   52.2   4.3   58  797-859    31-93  (127)
  5 cd00185 TNFR Tumor necrosis fa  89.1    0.67 1.5E-05   43.4   5.0   66  793-864    12-87  (98)
  6 PHA02637 TNF-alpha-receptor-li  82.7       1 2.2E-05   45.0   2.9   41  789-830    38-87  (127)
  7 PF07699 GCC2_GCC3:  GCC2 and G  74.9     2.7 5.8E-05   34.7   2.6   33  790-822     6-43  (48)
  8 cd00185 TNFR Tumor necrosis fa  71.8     5.1 0.00011   37.6   4.1   32  804-835    11-44  (98)
  9 PF12273 RCR:  Chitin synthesis  71.2     3.3 7.1E-05   40.8   2.7   21  881-901     2-23  (130)
 10 PF14946 DUF4501:  Domain of un  64.5     7.2 0.00016   40.8   3.7   85  810-907    28-115 (180)
 11 PTZ00382 Variant-specific surf  63.1     5.6 0.00012   37.9   2.5   24  805-831     4-27  (96)
 12 PHA02691 hypothetical protein;  62.3     4.4 9.6E-05   39.7   1.6   47  880-926     2-51  (110)
 13 KOG1836 Extracellular matrix g  60.9     7.9 0.00017   52.5   4.1   42  790-831   794-837 (1705)
 14 smart00180 EGF_Lam Laminin-typ  55.3     7.2 0.00016   32.1   1.5   19  798-816    22-40  (46)
 15 KOG4289 Cadherin EGF LAG seven  55.1       9  0.0002   50.7   3.0   80  786-873  1733-1846(2531)
 16 cd00055 EGF_Lam Laminin-type e  54.6     7.3 0.00016   32.4   1.5   27  789-818    17-43  (50)
 17 KOG0921 Dosage compensation co  54.4      26 0.00057   45.0   6.6    9  172-180  1190-1198(1282)
 18 PF07354 Sp38:  Zona-pellucida-  51.2      12 0.00026   41.8   2.9   23  806-831   239-261 (271)
 19 PF00053 Laminin_EGF:  Laminin   46.6       9  0.0002   31.5   0.8   22  798-819    22-43  (49)
 20 cd00064 FU Furin-like repeats.  42.5      21 0.00045   29.3   2.3    9  807-815    17-25  (49)
 21 KOG2675 Adenylate cyclase-asso  42.1      15 0.00033   43.5   2.0   24  342-365   446-469 (480)
 22 PF05268 GP38:  Phage tail fibr  41.0      77  0.0017   35.0   6.8   37  210-247   114-152 (260)
 23 PF04519 Bactofilin:  Polymer-f  37.7 3.1E+02  0.0066   25.6   9.6   15  136-150    82-96  (101)
 24 PF02166 Androgen_recep:  Andro  37.1      11 0.00024   43.2   0.0   26   21-57    335-360 (423)
 25 KOG1056 Glutamate-gated metabo  36.4      39 0.00084   43.4   4.4   39  793-835   493-540 (878)
 26 PF15195 TMEM210:  TMEM210 fami  32.2      28 0.00061   33.8   1.8   11   40-50    100-110 (116)
 27 PHA03066 Hypothetical protein;  28.8      40 0.00087   33.3   2.2   44  883-926     5-51  (110)
 28 PF00020 TNFR_c6:  TNFR/NGFR cy  26.3      26 0.00057   27.7   0.4   20  810-831     1-20  (39)
 29 PF05281 Secretogranin_V:  Neur  25.4   1E+02  0.0022   33.7   4.6   90  762-867    50-144 (208)
 30 COG4736 CcoQ Cbb3-type cytochr  25.1      96  0.0021   27.8   3.7   35  867-908     3-37  (60)
 31 PF05545 FixQ:  Cbb3-type cytoc  24.5   1E+02  0.0023   25.7   3.7   33  867-906     3-35  (49)
 32 PRK09677 putative lipopolysacc  23.7 1.9E+02   0.004   30.3   6.2   60   88-150    36-95  (192)
 33 PF12661 hEGF:  Human growth fa  23.5      25 0.00054   22.6  -0.1   11  797-807     3-13  (13)
 34 KOG2906 RNA polymerase III sub  22.5      51  0.0011   32.2   1.6   31  805-836     2-33  (105)
 35 PF15048 OSTbeta:  Organic solu  22.5 1.2E+02  0.0025   30.9   4.1   30  869-898    19-53  (125)
 36 KOG4260 Uncharacterized conser  21.1      64  0.0014   36.6   2.3   28  798-827   132-159 (350)

No 1  
>PF07699 GCC2_GCC3:  GCC2 and GCC3;  InterPro: IPR011641 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Tyrosine-protein kinases can transfer a phosphate group from ATP to a tyrosine residue in a protein. These enzymes can be divided into two main groups []:   Receptor tyrosine kinases (RTK), which are transmembrane proteins involved in signal transduction; they play key roles in growth, differentiation, metabolism, adhesion, motility, death and oncogenesis []. RTKs are composed of 3 domains: an extracellular domain (binds ligand), a transmembrane (TM) domain, and an intracellular catalytic domain (phosphorylates substrate). The TM domain plays an important role in the dimerisation process necessary for signal transduction [].      Cytoplasmic / non-receptor tyrosine kinases, which act as regulatory proteins, playing key roles in cell differentiation, motility, proliferation, and survival. For example, the Src-family of protein-tyrosine kinases [].   This entry represents various ephrin type A and B receptors, which have tyrosine kinase activity.
Probab=96.93  E-value=0.0005  Score=56.54  Aligned_cols=26  Identities=31%  Similarity=0.887  Sum_probs=22.8

Q ss_pred             ccceeCCCCceeccCCCCCCCcccCCCC
Q 002049          805 VFCEECPVGTFKNVSGSDRALCRNCSSN  832 (975)
Q Consensus       805 ~fC~eCP~GtYKn~~gs~~~~C~pCp~~  832 (975)
                      .-|++||+||||+..|+  ..|++||.+
T Consensus         9 ~~C~~Cp~GtYq~~~g~--~~C~~Cp~g   34 (48)
T PF07699_consen    9 NKCQPCPKGTYQDEEGQ--TSCTPCPPG   34 (48)
T ss_pred             CccCCCCCCccCCccCC--ccCccCcCC
Confidence            36999999999999975  599999974


No 2  
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms]
Probab=96.31  E-value=0.0036  Score=76.41  Aligned_cols=55  Identities=33%  Similarity=0.776  Sum_probs=39.0

Q ss_pred             CCCCCCCc----cccceeCCCCceeccCCCCCCCcccCCCCCCCCCcceeeccCCccCCCCCccccCCcccC
Q 002049          796 KACPRGLY----GVFCEECPVGTFKNVSGSDRALCRNCSSNELPHRALYIPIRGGVTECPCPYKCVSERYHM  863 (975)
Q Consensus       796 ~~CP~G~y----G~fC~eCP~GtYKn~~gs~~~~C~pCp~~~~p~ra~~i~~rggv~~~~Cpy~C~s~~y~~  863 (975)
                      =-|-+||.    +.-|+.||.||||...+  ..+|.+||.++..+       ..|  .+.|  +|.++.|+-
T Consensus       261 C~C~aGye~~~~~~~C~aCp~G~yK~~~~--~~~C~~CP~~S~s~-------~eg--a~~C--~C~~gyyRA  319 (996)
T KOG0196|consen  261 CVCKAGYEEAENGKACQACPPGTYKASQG--DSLCLPCPPNSHSS-------SEG--ATSC--TCENGYYRA  319 (996)
T ss_pred             eeecCCCCcccCCCcceeCCCCcccCCCC--CCCCCCCCCCCCCC-------CCC--CCcc--cccCCcccC
Confidence            46888883    45799999999999874  69999999865532       122  3455  467666643


No 3  
>PF07562 NCD3G:  Nine Cysteines Domain of family 3 GPCR;  InterPro: IPR011500 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  GPCR family 3 receptors (also known as family C) are structurally similar to other GPCRs, but do not show any significant sequence similarity and thus represent a distinct group. Structurally they are composed of four elements; an N-terminal signal sequence; a large hydrophilic extracellular agonist-binding region containing several conserved cysteine residues which could be involved in disulphide bonds; a shorter region containing seven transmembrane domains; and a C-terminal cytoplasmic domain of variable length []. Family 3 members include the metabotropic glutamate receptors, the extracellular calcium-sensing receptors, the gamma-amino-butyric acid (GABA) type B receptors, and the vomeronasal type-2 receptors [, , , ]. As these receptors regulate many important physiological processes they are potentially promising targets for drug development. This entry represents a conserved sequence, found in the extracellular region, that contains several highly-conserved Cys residues that are predicted to form disulphide bridges.; GO: 0004930 G-protein coupled receptor activity, 0007186 G-protein coupled receptor protein signaling pathway; PDB: 2E4X_B 2E4Y_A 2E4U_B 2E4V_B 2E4W_A.
Probab=94.01  E-value=0.012  Score=50.02  Aligned_cols=36  Identities=33%  Similarity=0.826  Sum_probs=20.9

Q ss_pred             cCCCCCCCc-----cc-----cceeCCCCceeccCCCCCCCcccCCCC
Q 002049          795 GKACPRGLY-----GV-----FCEECPVGTFKNVSGSDRALCRNCSSN  832 (975)
Q Consensus       795 g~~CP~G~y-----G~-----fC~eCP~GtYKn~~gs~~~~C~pCp~~  832 (975)
                      .++|++|++     +.     -|++||.|+|.|.+  |...|++||.+
T Consensus         6 S~~C~pG~~k~~~~~~~~CCw~C~~C~~~~is~~~--~~~~C~~C~~~   51 (54)
T PF07562_consen    6 SEPCPPGQRKKIQKGQPSCCWDCVPCPEGEISNQT--DSTSCTKCPEG   51 (54)
T ss_dssp             S----TTTEEEE--SSS-S--EEEE--TTEEEE----ETTEEEE--TT
T ss_pred             CCCCCCCCEECccCCCcceEEEeecCCCCcEECCC--CccccccCCCc
Confidence            478999984     32     39999999999987  67999999964


No 4  
>PHA02637 TNF-alpha-receptor-like protein; Provisional
Probab=93.40  E-value=0.093  Score=52.16  Aligned_cols=58  Identities=22%  Similarity=0.543  Sum_probs=40.9

Q ss_pred             CCCCCCc--c-ccceeCCCCceeccCCC--CCCCcccCCCCCCCCCcceeeccCCccCCCCCccccCC
Q 002049          797 ACPRGLY--G-VFCEECPVGTFKNVSGS--DRALCRNCSSNELPHRALYIPIRGGVTECPCPYKCVSE  859 (975)
Q Consensus       797 ~CP~G~y--G-~fC~eCP~GtYKn~~gs--~~~~C~pCp~~~~p~ra~~i~~rggv~~~~Cpy~C~s~  859 (975)
                      .|..+-|  + .-|.+||.|||+...=+  ....|.|||..++-...++..     ....|.-.|+++
T Consensus        31 ~C~e~EY~~~~~CC~kCPPGt~v~~~Ct~~t~T~C~PCp~GTYTe~~N~~~-----~C~~C~~~Cd~~   93 (127)
T PHA02637         31 KCKDNEYKRHNLCCLSCPPGTYASRLCDIKTNTQCTPCGSGTFTSHNNHLP-----ACLSCNGRCDRV   93 (127)
T ss_pred             CCCCCcCcCCCeEcCCCCCCCEEeCcCCCCCCcccccCCCCCeeccCCCCC-----cccccCCccCcc
Confidence            6888865  3 35999999999873221  246899999877765555443     367888888864


No 5  
>cd00185 TNFR Tumor necrosis factor receptor (TNFR) domain; superfamily of TNF-like receptor domains. When bound to TNF-like cytokines, TNFRs trigger multiple signal transduction pathways, they are involved in inflammation response, apoptosis, autoimmunity and organogenesis. TNFRs domains are elongated with generally three tandem repeats of cysteine-rich domains (CRDs). They fit in the grooves between protomers within the ligand trimer. Some TNFRs, such as NGFR and HveA, bind ligands with no structural similarity to TNF and do not bind ligand trimers.
Probab=89.11  E-value=0.67  Score=43.45  Aligned_cols=66  Identities=24%  Similarity=0.543  Sum_probs=41.1

Q ss_pred             EecCCCCCCCcc---------ccceeCCCCceeccCCCCCCCcccCCCCCCCCCcceeeccCCc-cCCCCCccccCCccc
Q 002049          793 VTGKACPRGLYG---------VFCEECPVGTFKNVSGSDRALCRNCSSNELPHRALYIPIRGGV-TECPCPYKCVSERYH  862 (975)
Q Consensus       793 i~g~~CP~G~yG---------~fC~eCP~GtYKn~~gs~~~~C~pCp~~~~p~ra~~i~~rggv-~~~~Cpy~C~s~~y~  862 (975)
                      .-=+.||+|++-         .-|++||.|||++... ....|++|..  -+ ...++....-. ..+.|-  |.++.|-
T Consensus        12 ~cC~~C~pG~~~~~~C~~~~~t~C~~C~~g~ys~~~~-~~~~C~~c~~--C~-~g~~~~~~ct~t~dt~C~--C~~G~y~   85 (98)
T cd00185          12 LCCDQCPPGTYLSKDCTPGSDTVCEPCPPGTYTDSWN-HLPKCLSCRT--CD-SGLVEKAPCTATRNTVCG--CKPGFYC   85 (98)
T ss_pred             CCCCCCCCCccCCCcCCCCCCCeecCCCCCCcccCCC-CCCcCCcCcc--CC-CCCEEEccCCCCCCCeEe--CCCCCEe
Confidence            455889999852         3599999999998653 2368999975  43 23344333322 223564  7777664


Q ss_pred             CC
Q 002049          863 MP  864 (975)
Q Consensus       863 ~p  864 (975)
                      .+
T Consensus        86 ~~   87 (98)
T cd00185          86 LT   87 (98)
T ss_pred             cC
Confidence            43


No 6  
>PHA02637 TNF-alpha-receptor-like protein; Provisional
Probab=82.74  E-value=1  Score=45.01  Aligned_cols=41  Identities=27%  Similarity=0.665  Sum_probs=30.3

Q ss_pred             CCceEecCCCCCCCc---------cccceeCCCCceeccCCCCCCCcccCC
Q 002049          789 GNGTVTGKACPRGLY---------GVFCEECPVGTFKNVSGSDRALCRNCS  830 (975)
Q Consensus       789 ~nGti~g~~CP~G~y---------G~fC~eCP~GtYKn~~gs~~~~C~pCp  830 (975)
                      ..+.+-=+.||||+|         ..-|.+||.|||-...- ....|.+|.
T Consensus        38 ~~~~~CC~kCPPGt~v~~~Ct~~t~T~C~PCp~GTYTe~~N-~~~~C~~C~   87 (127)
T PHA02637         38 KRHNLCCLSCPPGTYASRLCDIKTNTQCTPCGSGTFTSHNN-HLPACLSCN   87 (127)
T ss_pred             cCCCeEcCCCCCCCEEeCcCCCCCCcccccCCCCCeeccCC-CCCcccccC
Confidence            456667789999984         45799999999976432 245688886


No 7  
>PF07699 GCC2_GCC3:  GCC2 and GCC3;  InterPro: IPR011641 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Tyrosine-protein kinases can transfer a phosphate group from ATP to a tyrosine residue in a protein. These enzymes can be divided into two main groups []:   Receptor tyrosine kinases (RTK), which are transmembrane proteins involved in signal transduction; they play key roles in growth, differentiation, metabolism, adhesion, motility, death and oncogenesis []. RTKs are composed of 3 domains: an extracellular domain (binds ligand), a transmembrane (TM) domain, and an intracellular catalytic domain (phosphorylates substrate). The TM domain plays an important role in the dimerisation process necessary for signal transduction [].      Cytoplasmic / non-receptor tyrosine kinases, which act as regulatory proteins, playing key roles in cell differentiation, motility, proliferation, and survival. For example, the Src-family of protein-tyrosine kinases [].   This entry represents various ephrin type A and B receptors, which have tyrosine kinase activity.
Probab=74.93  E-value=2.7  Score=34.72  Aligned_cols=33  Identities=36%  Similarity=0.883  Sum_probs=24.5

Q ss_pred             CceEecCCCCCCCc----c-ccceeCCCCceeccCCCC
Q 002049          790 NGTVTGKACPRGLY----G-VFCEECPVGTFKNVSGSD  822 (975)
Q Consensus       790 nGti~g~~CP~G~y----G-~fC~eCP~GtYKn~~gs~  822 (975)
                      .+.-.=.+||+|+|    | ..|+.||.++|-...|+.
T Consensus         6 ~~~~~C~~Cp~GtYq~~~g~~~C~~Cp~g~~T~~~Gs~   43 (48)
T PF07699_consen    6 SGNNKCQPCPKGTYQDEEGQTSCTPCPPGSTTSSEGST   43 (48)
T ss_pred             CCCCccCCCCCCccCCccCCccCccCcCCCccCCcCCc
Confidence            34445589999986    3 359999999887777763


No 8  
>cd00185 TNFR Tumor necrosis factor receptor (TNFR) domain; superfamily of TNF-like receptor domains. When bound to TNF-like cytokines, TNFRs trigger multiple signal transduction pathways, they are involved in inflammation response, apoptosis, autoimmunity and organogenesis. TNFRs domains are elongated with generally three tandem repeats of cysteine-rich domains (CRDs). They fit in the grooves between protomers within the ligand trimer. Some TNFRs, such as NGFR and HveA, bind ligands with no structural similarity to TNF and do not bind ligand trimers.
Probab=71.83  E-value=5.1  Score=37.62  Aligned_cols=32  Identities=25%  Similarity=0.816  Sum_probs=24.0

Q ss_pred             cccceeCCCCceeccCCC--CCCCcccCCCCCCC
Q 002049          804 GVFCEECPVGTFKNVSGS--DRALCRNCSSNELP  835 (975)
Q Consensus       804 G~fC~eCP~GtYKn~~gs--~~~~C~pCp~~~~p  835 (975)
                      +.-|..||.|+|......  ....|.|||.+++-
T Consensus        11 ~~cC~~C~pG~~~~~~C~~~~~t~C~~C~~g~ys   44 (98)
T cd00185          11 GLCCDQCPPGTYLSKDCTPGSDTVCEPCPPGTYT   44 (98)
T ss_pred             CCCCCCCCCCccCCCcCCCCCCCeecCCCCCCcc
Confidence            456999999999876532  34689999986663


No 9  
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=71.16  E-value=3.3  Score=40.80  Aligned_cols=21  Identities=33%  Similarity=0.838  Sum_probs=12.1

Q ss_pred             e-ehhhHHHHHHHHHHHHHHhh
Q 002049          881 W-LFGLILLGLLILLALVLSVA  901 (975)
Q Consensus       881 ~-~F~L~l~~llilla~vls~~  901 (975)
                      | +|++||+++||+|++++.+.
T Consensus         2 W~l~~iii~~i~l~~~~~~~~~   23 (130)
T PF12273_consen    2 WVLFAIIIVAILLFLFLFYCHN   23 (130)
T ss_pred             eeeHHHHHHHHHHHHHHHHHHH
Confidence            6 56666666666655555444


No 10 
>PF14946 DUF4501:  Domain of unknown function (DUF4501)
Probab=64.49  E-value=7.2  Score=40.75  Aligned_cols=85  Identities=26%  Similarity=0.438  Sum_probs=47.7

Q ss_pred             CCCCceeccCCCCCCCcccCCCCCCCCCcceeeccCCccCCCCCccccCC-cccC-CcccchHHHHHHHhCCce-ehhhH
Q 002049          810 CPVGTFKNVSGSDRALCRNCSSNELPHRALYIPIRGGVTECPCPYKCVSE-RYHM-PHCYTTLEELVYTFGGPW-LFGLI  886 (975)
Q Consensus       810 CP~GtYKn~~gs~~~~C~pCp~~~~p~ra~~i~~rggv~~~~Cpy~C~s~-~y~~-p~C~t~le~li~~~GGp~-~F~L~  886 (975)
                      |-.|-|.........-|..|-+.+++.   |       ..+.|.+-=... ...| .-=-||.   .-.+|+|+ .-.||
T Consensus        28 CgPGcyr~~~edgs~sCv~c~n~t~~~---~-------n~s~c~~~~grg~~~pmNrStgtpg---~p~~g~P~vAASL~   94 (180)
T PF14946_consen   28 CGPGCYRHWNEDGSVSCVQCGNGTFPA---Y-------NGSECRSLAGRGAQFPMNRSTGTPG---RPHTGGPQVAASLF   94 (180)
T ss_pred             cCCcceeeecCCCCeEEEEcCCCcccc---c-------CccccccccccCCccccccccCCCC---CCcCCChhHHHHHH
Confidence            555655543333456778887655542   1       124454431110 1111 1111222   23689999 67788


Q ss_pred             HHHHHHHHHHHHHhhheeccC
Q 002049          887 LLGLLILLALVLSVARMKYMG  907 (975)
Q Consensus       887 l~~llilla~vls~~R~K~~~  907 (975)
                      |=.+||-++|+||++-+-|-|
T Consensus        95 LgTffIS~~LilSvA~FFYLK  115 (180)
T PF14946_consen   95 LGTFFISLGLILSVASFFYLK  115 (180)
T ss_pred             HHHHHHHHHHHHHHhhheeec
Confidence            888999999999987665544


No 11 
>PTZ00382 Variant-specific surface protein (VSP); Provisional
Probab=63.08  E-value=5.6  Score=37.91  Aligned_cols=24  Identities=25%  Similarity=0.493  Sum_probs=19.1

Q ss_pred             ccceeCCCCceeccCCCCCCCcccCCC
Q 002049          805 VFCEECPVGTFKNVSGSDRALCRNCSS  831 (975)
Q Consensus       805 ~fC~eCP~GtYKn~~gs~~~~C~pCp~  831 (975)
                      ..|.+|..|+|++..   ...|.+|+.
T Consensus         4 ~~Ct~C~~g~~~~~~---~~~C~~C~~   27 (96)
T PTZ00382          4 AVCTSCDSDKKPNKD---GSGCVLCSV   27 (96)
T ss_pred             cccCcCCCCCccCCC---CCcCCcCCC
Confidence            369999999998854   457999985


No 12 
>PHA02691 hypothetical protein; Provisional
Probab=62.34  E-value=4.4  Score=39.67  Aligned_cols=47  Identities=21%  Similarity=0.266  Sum_probs=32.6

Q ss_pred             ceehhhHHHHHHHHHHHHHHhhheeccC--CCccCCCCcc-ccccccccc
Q 002049          880 PWLFGLILLGLLILLALVLSVARMKYMG--GDELPALVPA-RRIDHSFPF  926 (975)
Q Consensus       880 p~~F~L~l~~llilla~vls~~R~K~~~--~d~~~~~~~~-~~iD~sfp~  926 (975)
                      .|++.+++++++++|+|.+.++|-.+-.  .+++..+++. +|.|..||.
T Consensus         2 ~~l~~l~fFi~FL~l~Y~~ny~PTNKlqlaV~~l~~e~~~~k~~d~~~p~   51 (110)
T PHA02691          2 SWALEVALFAAFLAAAYVLTFLPTNKMQLAVRELADARAWRQRTDAQLDG   51 (110)
T ss_pred             chHHHHHHHHHHHHHHHHHhhccchhHHHhhhhhhhhhhHHhhccccCcc
Confidence            3778888999999999999887544222  3455555553 466777776


No 13 
>KOG1836 consensus Extracellular matrix glycoprotein Laminin subunits alpha and gamma [Extracellular structures]
Probab=60.88  E-value=7.9  Score=52.49  Aligned_cols=42  Identities=40%  Similarity=0.755  Sum_probs=35.3

Q ss_pred             CceEecCCCCCCCccccceeCCCCceeccCCCC--CCCcccCCC
Q 002049          790 NGTVTGKACPRGLYGVFCEECPVGTFKNVSGSD--RALCRNCSS  831 (975)
Q Consensus       790 nGti~g~~CP~G~yG~fC~eCP~GtYKn~~gs~--~~~C~pCp~  831 (975)
                      .-++.-|.||+||.|.-|++|.-|+|=|..+-+  ...|++|+-
T Consensus       794 ~~~~iCk~Cp~gytG~rCe~c~dgyfg~p~~~~~~~~~c~~c~c  837 (1705)
T KOG1836|consen  794 ILEVVCKNCPPGYTGLRCEECADGYFGNPLGHDGDVRPCQSCQC  837 (1705)
T ss_pred             ccceecCCCCCCCcccccccCCCccccCCCCCCCCcccCcccee
Confidence            667778999999999999999999998876421  259999996


No 14 
>smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai.
Probab=55.30  E-value=7.2  Score=32.15  Aligned_cols=19  Identities=26%  Similarity=0.789  Sum_probs=18.0

Q ss_pred             CCCCCccccceeCCCCcee
Q 002049          798 CPRGLYGVFCEECPVGTFK  816 (975)
Q Consensus       798 CP~G~yG~fC~eCP~GtYK  816 (975)
                      |++++.|..|++|+.|+|-
T Consensus        22 C~~~~~G~~C~~C~~g~~g   40 (46)
T smart00180       22 CKPNVTGRRCDRCAPGYYG   40 (46)
T ss_pred             CCCCCCCCCCCcCCCCcCC
Confidence            9999999999999999996


No 15 
>KOG4289 consensus Cadherin EGF LAG seven-pass G-type receptor [Signal transduction mechanisms]
Probab=55.09  E-value=9  Score=50.66  Aligned_cols=80  Identities=28%  Similarity=0.628  Sum_probs=50.2

Q ss_pred             cccCCceEecCCCCCCCccccce-----eCCCCceeccCCCCCCCcccCCCCC----CCC-----------CcceeeccC
Q 002049          786 LAGGNGTVTGKACPRGLYGVFCE-----ECPVGTFKNVSGSDRALCRNCSSNE----LPH-----------RALYIPIRG  845 (975)
Q Consensus       786 ~~g~nGti~g~~CP~G~yG~fC~-----eCP~GtYKn~~gs~~~~C~pCp~~~----~p~-----------ra~~i~~rg  845 (975)
                      .++.+|-.  -.||+||+|.+|+     +||-|+|-      ...|.||.-.-    -|.           ..+|....+
T Consensus      1733 sp~a~GY~--C~C~~g~~G~~Ce~~~dq~CPrGWWG------~P~CgpC~CavsKgfdp~CnKt~G~CqCKe~hy~~~~~ 1804 (2531)
T KOG4289|consen 1733 SPGAHGYT--CECPPGYTGPYCELRADQPCPRGWWG------FPTCGPCNCAVSKGFDPDCNKTNGQCQCKENHYRPIGS 1804 (2531)
T ss_pred             CCCCCcee--EECCCcccCcchhhhccCCCCCcccC------CCCccCccccccCCCCCCccccCcceeeccccccCCCc
Confidence            34445543  6899999999995     79999885      35788886310    000           123332211


Q ss_pred             --------CccCCCCC----ccccCCcc--cCCcccchHHHH
Q 002049          846 --------GVTECPCP----YKCVSERY--HMPHCYTTLEEL  873 (975)
Q Consensus       846 --------gv~~~~Cp----y~C~s~~y--~~p~C~t~le~l  873 (975)
                              |...+.|.    -+|.++..  +...|-.||.|.
T Consensus      1805 Cl~CdC~~Gs~Sr~C~adGqC~C~pgaiGRqCdrCd~pfaev 1846 (2531)
T KOG4289|consen 1805 CLPCDCYFGSDSRECDADGQCPCKPGAIGRQCDRCDNPFAEV 1846 (2531)
T ss_pred             ceeeccccCCCcccccCCCcCCCCCccccccccccCChhhhc
Confidence                    55666774    34777644  668899999874


No 16 
>cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies
Probab=54.58  E-value=7.3  Score=32.42  Aligned_cols=27  Identities=26%  Similarity=0.628  Sum_probs=22.2

Q ss_pred             CCceEecCCCCCCCccccceeCCCCceecc
Q 002049          789 GNGTVTGKACPRGLYGVFCEECPVGTFKNV  818 (975)
Q Consensus       789 ~nGti~g~~CP~G~yG~fC~eCP~GtYKn~  818 (975)
                      .+|.-   .|++++.|..|++|+.|+|...
T Consensus        17 ~~G~C---~C~~~~~G~~C~~C~~g~~~~~   43 (50)
T cd00055          17 GTGQC---ECKPNTTGRRCDRCAPGYYGLP   43 (50)
T ss_pred             CCCEE---eCCCcCCCCCCCCCCCCCccCC
Confidence            45554   3999999999999999999754


No 17 
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription]
Probab=54.39  E-value=26  Score=45.04  Aligned_cols=9  Identities=56%  Similarity=0.996  Sum_probs=3.6

Q ss_pred             CCCCCCCCC
Q 002049          172 AGGGHGGRG  180 (975)
Q Consensus       172 ~GGGhGG~G  180 (975)
                      +|||+||..
T Consensus      1190 sgGGYGggy 1198 (1282)
T KOG0921|consen 1190 SGGGYGGGY 1198 (1282)
T ss_pred             CCCCcCCCC
Confidence            344444333


No 18 
>PF07354 Sp38:  Zona-pellucida-binding protein (Sp38);  InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals. These are sperm proteins that bind to the 90 kDa family of zona pellucida glycoproteins in a calcium-dependent manner []. These represent some of the specific molecules that mediate the first steps of gamete interaction, allowing fertilisation to occur [].; GO: 0007339 binding of sperm to zona pellucida, 0005576 extracellular region
Probab=51.21  E-value=12  Score=41.81  Aligned_cols=23  Identities=30%  Similarity=0.791  Sum_probs=20.0

Q ss_pred             cceeCCCCceeccCCCCCCCcccCCC
Q 002049          806 FCEECPVGTFKNVSGSDRALCRNCSS  831 (975)
Q Consensus       806 fC~eCP~GtYKn~~gs~~~~C~pCp~  831 (975)
                      =|+-|++|||....+   ..|+.|..
T Consensus       239 CCVvCsPgTysp~~~---~~C~~C~~  261 (271)
T PF07354_consen  239 CCVVCSPGTYSPDDD---VHCQQCNS  261 (271)
T ss_pred             eeEECCCcccCCCCC---ceEEecCc
Confidence            599999999998764   69999995


No 19 
>PF00053 Laminin_EGF:  Laminin EGF-like (Domains III and V);  InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation. They are composed of distinct but related alpha, beta and gamma chains. The three chains form a cross-shaped molecule that consist of a long arm and three short globular arms. The long arm consist of a coiled coil structure contributed by all three chains and cross-linked by interchain disulphide bonds. Beside different types of globular domains each subunit contains, in its first half, consecutive repeats of about 60 amino acids in length that include eight conserved cysteines []. The tertiary structure [, ] of this domain is remotely similar in its N-terminal to that of the EGF-like module (see PDOC00021 from PROSITEDOC). It is known as a 'LE' or 'laminin-type EGF-like' domain. The number of copies of the LE domain in the different forms of laminins is highly variable; from 3 up to 22 copies have been found. A schematic representation of the topology of the four disulphide bonds in the LE domain is shown below.  +-------------------+ +-|-----------+ | +--------+ +-----------------+ | | | | | | | | xxCxCxxxxxxxxxxxCxxxxxxxCxxCxxxxxGxxCxxCxxgaagxxxxxxxxxxxCxx sssssssssssssssssssssssssssssssssss 'C': conserved cysteine involved in a disulphide bond 'a': conserved aromatic residue 'G': conserved glycine (lower case = less conserved) 's': region similar to the EGF-like domain  In mouse laminin gamma-1 chain, the seventh LE domain has been shown to be the only one that binds with a high affinity to nidogen []. The binding-sites are located on the surface within the loops C1-C3 and C5-C6 [, ]. Long consecutive arrays of LE domains in laminins form rod-like elements of limited flexibility [], which determine the spacing in the formation of laminin networks of basement membranes [].; PDB: 3TBD_A 3ZYG_B 3ZYI_B 2Y38_A 1KLO_A 1NPE_B 3ZYJ_B 1TLE_A.
Probab=46.63  E-value=9  Score=31.49  Aligned_cols=22  Identities=36%  Similarity=0.727  Sum_probs=18.0

Q ss_pred             CCCCCccccceeCCCCceeccC
Q 002049          798 CPRGLYGVFCEECPVGTFKNVS  819 (975)
Q Consensus       798 CP~G~yG~fC~eCP~GtYKn~~  819 (975)
                      |++++.|..|++|..++|....
T Consensus        22 C~~~~~G~~C~~C~~g~~~~~~   43 (49)
T PF00053_consen   22 CKPGTTGPRCDQCKPGYFGLPS   43 (49)
T ss_dssp             BSTTEESTTS-EE-TTEECSTT
T ss_pred             ccccccCCcCcCCCCccccccC
Confidence            9999999999999999997643


No 20 
>cd00064 FU Furin-like repeats. Cysteine rich region. Exact function of the domain is not known. Furin is a serine-kinase dependent proprotein processor. Other members of this family include endoproteases and cell surface receptors.
Probab=42.50  E-value=21  Score=29.27  Aligned_cols=9  Identities=33%  Similarity=1.099  Sum_probs=4.8

Q ss_pred             ceeCCCCce
Q 002049          807 CEECPVGTF  815 (975)
Q Consensus       807 C~eCP~GtY  815 (975)
                      |..|+.++|
T Consensus        17 C~~C~~~~~   25 (49)
T cd00064          17 CTSCRHGFY   25 (49)
T ss_pred             CccCcCccC
Confidence            555555554


No 21 
>KOG2675 consensus Adenylate cyclase-associated protein (CAP/Srv2p) [Cytoskeleton; Signal transduction mechanisms]
Probab=42.13  E-value=15  Score=43.48  Aligned_cols=24  Identities=29%  Similarity=0.517  Sum_probs=11.5

Q ss_pred             CCCccccccccCCCcceeeEEEEe
Q 002049          342 LPTNTDTLLLEFPKQQLWTNVYIR  365 (975)
Q Consensus       342 ~~t~t~T~ll~fp~~~l~~nv~v~  365 (975)
                      .++.-|--..|||...-|.|.++.
T Consensus       446 vp~~~dgDy~EfpvPEQfkt~~~~  469 (480)
T KOG2675|consen  446 VPTNEDGDYVEFPVPEQFKTKFNG  469 (480)
T ss_pred             cccCCCCCcccccChHHHhhhccC
Confidence            333334444666655555554443


No 22 
>PF05268 GP38:  Phage tail fibre adhesin Gp38;  InterPro: IPR007932 This entry is represented by Bacteriophage T2, Gp38. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family contains several Gp38 proteins from T-even-like phages. Gp38, together with a second phage protein, Gp57, catalyses the organisation of Gp37 but is absent from the phage particle. Gp37 is responsible for receptor recognition [].
Probab=41.03  E-value=77  Score=35.00  Aligned_cols=37  Identities=24%  Similarity=0.514  Sum_probs=21.2

Q ss_pred             cccCCCCCCCCCCCCCcCcccEEEEEEceeeee--ecEEE
Q 002049          210 SYGSKGGTTFKGENFGGDGGGRIRLEVVNEIEV--NGSLL  247 (975)
Q Consensus       210 ~~GSGGG~~~~~~~~GG~GGG~I~I~a~~~L~l--~G~I~  247 (975)
                      ++|-|| +++.....+.+||=+|+=....+|+|  +|.|.
T Consensus       114 ~yGRGG-nGs~~~~~g~~GG~~I~N~iG~rLRI~N~GaIA  152 (260)
T PF05268_consen  114 MYGRGG-NGSGSNSAGAAGGHAIQNDIGGRLRINNNGAIA  152 (260)
T ss_pred             EEecCC-CCCCCCCCccccceeeecCCcceEEEecCCEEe
Confidence            444444 43445566777787887555455554  45554


No 23 
>PF04519 Bactofilin:  Polymer-forming cytoskeletal;  InterPro: IPR007607 This family contains several uncharacterised hypothetical proteins.
Probab=37.75  E-value=3.1e+02  Score=25.61  Aligned_cols=15  Identities=20%  Similarity=0.372  Sum_probs=9.4

Q ss_pred             EEEeeEEEccCcEEE
Q 002049          136 VSALNASFSSGSVVN  150 (975)
Q Consensus       136 l~A~niti~~~s~I~  150 (975)
                      +.+..+.|..++.|+
T Consensus        82 i~~~~l~v~~ga~i~   96 (101)
T PF04519_consen   82 ITAGKLEVEGGASIN   96 (101)
T ss_pred             EEECEEEEeCCCEEE
Confidence            455666676666665


No 24 
>PF02166 Androgen_recep:  Androgen receptor;  InterPro: IPR001103 Steroid or nuclear hormone receptors (NRs) constitute an important super-family of transcription regulators that are involved in diverse physiological functions, including control of embryonic development, cell differentiation and homeostasis. Members include the steroid hormone receptors and receptors for thyroid hormone, retinoids and 1,25-dihydroxy-vitamin D3. The proteins function as dimeric molecules in the nucleus to regulate the transcription of target genes in a ligand-responsive manner [, ].   NRs are extremely important in medical research, a large number of them being implicated in diseases such as cancer, diabetes and hormone resistance syndromes. Many do not yet have a defined ligand and are accordingly termed "orphan" receptors. More than 300 NRs have been described to date and a new system has recently been introduced in an attempt to rationalise the increasingly complex set of names used to describe superfamily members. The androgen receptor (AR) consists of 3 functional and structural domains: an N-terminal (modulatory) domain; a DNA binding domain (IPR001628 from INTERPRO) that mediates specific binding to target DNA sequences (ligand-responsive elements); and a hormone binding domain. The N-terminal domain (NTD) is unique to the androgen receptors and spans approximately the first 530 residues; the highly-conserved DNA-binding domain is smaller (around 65 residues) and occupies the central portion of the protein; and the hormone ligand binding domain (LBD) lies at the receptor C terminus. In the absence of ligand, steroid hormone receptors are thought to be weakly associated with nuclear components; hormone binding greatly increases receptor affinity.  The LBDs of steroid hormone receptors fold into 12 helices that form a ligand-binding pocket. When an agonist is bound, helix 12 folds over the pocket to enclose the ligand []. When an antagonist is unbound, helix 12 is positioned away from the pocket in a way that interferes with the binding of coactivators to a groove in the hormone-binding domain formed after ligand binding. In AR, ligand binding that induces folding of helix 12 to overlie the pocket discloses a groove that binds a region of the NTD. Coactivator molecules can also bind to this groove, but the predominant site for coactivator binding to AR is in the NTD. AR ligand resides in a pocket and primarily contacts helices 4, 5, and 10. The DNA-binding region includes eight cysteine residues that form two coordination complexes, each composed of four cysteines and a Zn2+ ion. These two zinc fingers form the structure that binds to the major groove of DNA. The second zinc finger stabilises the binding complex by hydrophobic interactions with the first finger and contributes to specificity of receptor DNA binding. It is also necessary for receptor dimerisation that occurs during DNA binding Defects in the androgen receptor cause testicular feminisation syndrome, androgen insensibility syndrome (AIS) [, ]. AIS may be complete (CAIS), where external genitalia are phenotypically female; partial (PAIS), where genitalia are substantively ambiguous; or mild (MAIS), where external genitalia are normal male, or nearly so. Defects in the receptor also cause X-linked spinal and bulbar muscular atrophy (also known as Kennedy's disease).; GO: 0003677 DNA binding, 0004882 androgen receptor activity, 0005496 steroid binding, 0006355 regulation of transcription, DNA-dependent, 0030521 androgen receptor signaling pathway, 0005634 nucleus; PDB: 1XOW_B 2Q7K_B 2Q7I_B.
Probab=37.11  E-value=11  Score=43.24  Aligned_cols=26  Identities=50%  Similarity=0.989  Sum_probs=0.0

Q ss_pred             cccccccceeeeCCCCCcccCCCCCCCCCCCCCCCCC
Q 002049           21 SLDQYNFPVIGFGADSLFHGDYTPPSPPPPIAPPHPP   57 (975)
Q Consensus        21 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~   57 (975)
                      +-|-||||+-           ..-|+|||||+|||+.
T Consensus       335 sRDyYnF~la-----------Lag~~~p~~~~hph~R  360 (423)
T PF02166_consen  335 SRDYYNFPLA-----------LAGPPPPPPPPHPHAR  360 (423)
T ss_dssp             -------------------------------------
T ss_pred             cccccccccc-----------cccccccccccccccc
Confidence            4567777752           2335555666677554


No 25 
>KOG1056 consensus Glutamate-gated metabotropic ion channel receptor subunit GRM2 and related subunits, G-protein coupled receptor superfamily [Inorganic ion transport and metabolism; Signal transduction mechanisms]
Probab=36.45  E-value=39  Score=43.45  Aligned_cols=39  Identities=26%  Similarity=0.583  Sum_probs=29.1

Q ss_pred             EecCCCCCCCc-c--------ccceeCCCCceeccCCCCCCCcccCCCCCCC
Q 002049          793 VTGKACPRGLY-G--------VFCEECPVGTFKNVSGSDRALCRNCSSNELP  835 (975)
Q Consensus       793 i~g~~CP~G~y-G--------~fC~eCP~GtYKn~~gs~~~~C~pCp~~~~p  835 (975)
                      +=..+|-+|.. .        .-|++|+...|++    |...|.+|+...-|
T Consensus       493 ~CS~pC~~g~~k~~~~~~~ccw~c~~c~~~eY~~----d~~tc~~C~~~~wp  540 (878)
T KOG1056|consen  493 VCSEPCLPGQRKKVTKGVTCCWHCTPCMSYEYVN----DEFTCSDCQLGQWP  540 (878)
T ss_pred             cccCcCCcchhcccccCceeEEEcccCCCcceec----CcceeccCCcCcCC
Confidence            33578888872 1        2499999999999    45799999965444


No 26 
>PF15195 TMEM210:  TMEM210 family
Probab=32.24  E-value=28  Score=33.77  Aligned_cols=11  Identities=45%  Similarity=1.096  Sum_probs=4.8

Q ss_pred             cCCCCCCCCCC
Q 002049           40 GDYTPPSPPPP   50 (975)
Q Consensus        40 ~~~~~~~~~p~   50 (975)
                      -+-+|++||||
T Consensus       100 m~~~p~~pppp  110 (116)
T PF15195_consen  100 MEASPEEPPPP  110 (116)
T ss_pred             cCCCCCCCCcC
Confidence            34444444443


No 27 
>PHA03066 Hypothetical protein; Provisional
Probab=28.77  E-value=40  Score=33.35  Aligned_cols=44  Identities=11%  Similarity=0.203  Sum_probs=28.0

Q ss_pred             hhhHHHHHHHHHHHHHHhhheeccC--CCccCCCCc-cccccccccc
Q 002049          883 FGLILLGLLILLALVLSVARMKYMG--GDELPALVP-ARRIDHSFPF  926 (975)
Q Consensus       883 F~L~l~~llilla~vls~~R~K~~~--~d~~~~~~~-~~~iD~sfp~  926 (975)
                      +.|++++++++++|++.+++-.+..  .+++..+++ .||.|.+||+
T Consensus         5 ~~l~fFi~Fl~~~Y~~n~~PTNKlqlaV~~l~~e~~~ik~~d~~~P~   51 (110)
T PHA03066          5 LYLLFFIIFLCISYYFNYYPTNKLQMAVKELNRENAIIKQRNDEFPT   51 (110)
T ss_pred             HHHHHHHHHHHHHHHHhhccChhHHhhhhhhhHHHHHHHhhhccCCc
Confidence            4466677888899999776443221  245554443 4577888885


No 28 
>PF00020 TNFR_c6:  TNFR/NGFR cysteine-rich region;  InterPro: IPR001368 A number of proteins, some of which are known to be receptors for growth factors have been found to contain a cysteine-rich domain at the N-terminal region that can be subdivided into four (or in some cases, three) repeats containing six conserved cysteines all of which are involved in intrachain disulphide bonds [].  CD27 (also called S152 or T14) mediates a co-stimulatory signal for T and B cell activation and is involved in murine T cell development. Tyrosine-phosphorylation of ZAP-70 following CD27 ligation of T cells has been reported [], but not confirmed independently. CD30 was originally identified as Ki-1, an antigen expressed on Reed-Sternberg cells in Hodgkin's lymphomas and other non-Hodgkin's lymphomas, particularly diffuse large-cell lymphoma and immunoblastic lymphoma. CD30 has pleiotropic effects on CD30-positive lymphoma cell lines ranging from cell proliferation to cell death. It is thought to be involved in negative selection of T-cells in the thymus and is involved in TCR-mediated cell death. CD30 is a member of the TNFR family of molecules, activate NFkB through interaction with TRAF2 and TRAF5. CD40 (Bp50) plays a central role in the regulation of cell-mediated immunity as well as antibody mediated immunity. It is central to T cell dependent (TD)-responses and may influence survival of B cell lymphomas. CD95 (also called APO-1, fas antigen, Fas tumour necrosis factor receptor superfamily, member 6, TNFRSF6 or apoptosis antigen 1, APT1) is expressed, typically at high levels, on activated T and B cells. It is involved in the mediation of apoptosis-inducing signals.  Other proteins known to belong to this family [, , , ] are, tumour Necrosis Factor type I and type II receptors (TNFR), Rabbit fibroma virus soluble TNF receptor (protein T2), lymphotoxin alpha/beta receptor, low-affinity nerve growth factor receptor (LA-NGFR) (p75), T-cell antigen OX40, Wsl-1, a receptor (for a yet undefined ligand) that mediates apoptosis and Vaccinia virus protein A53 (SalF19R). CD molecules are leucocyte antigens on cell surfaces. CD antigens nomenclature is updated at Protein Reviews On The Web (http://prow.nci.nih.gov/).; GO: 0005488 binding; PDB: 3TJE_F 3QD6_S 3ALQ_U 3IJ2_Y 3BUK_D 1SG1_X 1NCF_B 1EXT_A 1FT4_B 1TNR_R ....
Probab=26.27  E-value=26  Score=27.67  Aligned_cols=20  Identities=35%  Similarity=0.909  Sum_probs=15.0

Q ss_pred             CCCCceeccCCCCCCCcccCCC
Q 002049          810 CPVGTFKNVSGSDRALCRNCSS  831 (975)
Q Consensus       810 CP~GtYKn~~gs~~~~C~pCp~  831 (975)
                      ||.|+|.+..+  ...|.+|..
T Consensus         1 C~~g~y~~~~~--~~~C~~C~~   20 (39)
T PF00020_consen    1 CPPGTYSDSEN--HPQCLPCSR   20 (39)
T ss_dssp             ECTTEEEESSC--SSSEEEEES
T ss_pred             CccCcccCCCC--CCcCCccCC
Confidence            89999998754  378877753


No 29 
>PF05281 Secretogranin_V:  Neuroendocrine protein 7B2 precursor (Secretogranin V);  InterPro: IPR007945 Mature peptide hormones and neuropeptides are typically synthesised from much larger precursors and require several post-translational processing steps--including proteolytic cleavage--for the formation of the bioactive species. The subtilisin-related proteolytic enzymes that accomplish neuroendocrine-specific cleavages are known as prohormone convertases 1 and 2 (PC1 and PC2), which belong to MEROPS peptidase family S8B. The cell biology of these proteases within the regulated secretory pathway of neuroendocrine cells is complex, and they are themselves initially synthesised as inactive precursor molecules. ProPC1 propeptide cleavage occurs rapidly in the endoplasmic reticulum, yet its major site of action on prohormones takes place later in the secretory pathway. PC1 undergoes an interesting carboxyl terminal processing event whose function appears to be to activate the enzyme. ProPC2, on the other hand, exhibits comparatively long initial folding times and exits the endoplasmic reticulum without propeptide cleavage, in association with the neuroendocrine-specific protein 7B2. Once the proPC2/7B2 complex arrives at the trans-Golgi network, 7B2 is internally cleaved into two domains, the 21kDa fragment and a carboxy-terminal 31 residue peptide. PC2 propeptide removal occurs in the maturing secretory granule, most likely through autocatalysis, and 7B2 association does not appear to be directly required for this cleavage event. However, if proPC2 has not encountered 7B2 intracellularly, it cannot generate a catalytically active mature species. The molecular mechanism behind the intriguing intracellular association of 7B2 and proPC2 is still unknown, but may involve conformational rearrangement or stabilisation of a proPC2 conformer mediated by a 36-residue internal segment of 21kDa 7B2. This family represents, 7B2 (secretogranin V), which is the molecular escort protein for PC2. 7B2 is a bifunctional protein with an N-terminal activation domain and a C-terminal inhibitory domain (MEROPS inhibitor family I21, clan I-) separated by a furin cleavage site []. Although 7B2 represents a potent inhibitor of PC2, there is an absolute requirement of 7B2 for the activation of PC2, which is synthesised as a zymogen. Both the full length, 27 kDa, and the C-terminal peptide (CT domain) derived from intramolecular cleavage of 7B2 are potent inhibitors of PC2. Studies have shown that the active peptide in the CT domain to be LLRVHK, active in the nanomolar range not only against PC2 but also PC1 [, ]. Knock-out studies have shown that the PC2 nulls are not phenotypically equivalent to the 7B2 nulls, which suggests that 7B2 may have other activities in addition to being the activator of PC2 [].  7B2 exhibits both structural and functional homology to proSAAS (IPR010832 from INTERPRO), which is the PC1 binding protein. The CT domain of proSAAS contains the same inhibitor hexapeptide as 7B2, consequently both 7B2 and proSAAS are two members of a homologous family of prohormone convertase inhibitor proteins. ; GO: 0007218 neuropeptide signaling pathway, 0030141 stored secretory granule
Probab=25.38  E-value=1e+02  Score=33.66  Aligned_cols=90  Identities=24%  Similarity=0.428  Sum_probs=52.6

Q ss_pred             CccccccccceEEEecCCcCCCCCcccCCceEecCCCCCCC--ccccce---eCCCCceeccCCCCCCCcccCCCCCCCC
Q 002049          762 DEYLPLASVNGSIDARGGLGRGQGLAGGNGTVTGKACPRGL--YGVFCE---ECPVGTFKNVSGSDRALCRNCSSNELPH  836 (975)
Q Consensus       762 d~y~pia~~~G~I~~~GG~~~~~g~~g~nGti~g~~CP~G~--yG~fC~---eCP~GtYKn~~gs~~~~C~pCp~~~~p~  836 (975)
                      +||.+=.+.-|.-.++||++.+....+..|.|-...=.+--  ---+|.   +||+|+=. .     ..|   - ++++.
T Consensus        50 ~E~l~hssLwG~q~isGGagEG~q~L~~~~~i~n~~~~ktd~~lPaYCnPPNPCPvGyt~-~-----dgC---l-e~fEn  119 (208)
T PF05281_consen   50 QEYLQHSSLWGHQYISGGAGEGPQHLGPEGNIPNIKIVKTDNNLPAYCNPPNPCPVGYTA-E-----DGC---L-ENFEN  119 (208)
T ss_pred             cccccccccCCceeeeCCCCccchhcCccCCcCcccccccccCCCCCCCCCCCCCCCccc-c-----cCc---c-cCCcc
Confidence            36776667788888999998876666666665332211110  113675   69998652 2     234   4 35656


Q ss_pred             CcceeeccCCccCCCCCccccCCcccCCccc
Q 002049          837 RALYIPIRGGVTECPCPYKCVSERYHMPHCY  867 (975)
Q Consensus       837 ra~~i~~rggv~~~~Cpy~C~s~~y~~p~C~  867 (975)
                      -|.|.-.  -...    ..|.=|..||-+|-
T Consensus       120 TAeFSRe--yQa~----QdC~CD~EHMf~C~  144 (208)
T PF05281_consen  120 TAEFSRE--YQAA----QDCMCDTEHMFDCP  144 (208)
T ss_pred             HHHhhHH--HHhc----CccCCCcccccCCc
Confidence            5655431  1111    23555788998886


No 30 
>COG4736 CcoQ Cbb3-type cytochrome oxidase, subunit 3 [Posttranslational modification, protein turnover, chaperones]
Probab=25.13  E-value=96  Score=27.84  Aligned_cols=35  Identities=17%  Similarity=0.285  Sum_probs=23.8

Q ss_pred             cchHHHHHHHhCCceehhhHHHHHHHHHHHHHHhhheeccCC
Q 002049          867 YTTLEELVYTFGGPWLFGLILLGLLILLALVLSVARMKYMGG  908 (975)
Q Consensus       867 ~t~le~li~~~GGp~~F~L~l~~llilla~vls~~R~K~~~~  908 (975)
                      |+.+.++++.+|       ++.+.+++++++++++|-+.++.
T Consensus         3 ~e~~~~~a~a~~-------t~~~~l~fiavi~~ayr~~~K~~   37 (60)
T COG4736           3 YEMMRGFADAWG-------TIAFTLFFIAVIYFAYRPGKKGE   37 (60)
T ss_pred             HHHHHHHHHHHH-------HHHHHHHHHHHHHHHhcccchhh
Confidence            566777777333       45555667888888888776653


No 31 
>PF05545 FixQ:  Cbb3-type cytochrome oxidase component FixQ;  InterPro: IPR008621 This family consists of several Cbb3-type cytochrome oxidase components (FixQ/CcoQ). FixQ is found in nitrogen fixing bacteria. Since nitrogen fixation is an energy-consuming process, effective symbioses depend on operation of a respiratory chain with a high affinity for O2, closely coupled to ATP production. This requirement is fulfilled by a special three-subunit terminal oxidase (cytochrome terminal oxidase cbb3), which was first identified in Bradyrhizobium japonicum as the product of the fixNOQP operon [].
Probab=24.50  E-value=1e+02  Score=25.71  Aligned_cols=33  Identities=21%  Similarity=0.409  Sum_probs=18.8

Q ss_pred             cchHHHHHHHhCCceehhhHHHHHHHHHHHHHHhhheecc
Q 002049          867 YTTLEELVYTFGGPWLFGLILLGLLILLALVLSVARMKYM  906 (975)
Q Consensus       867 ~t~le~li~~~GGp~~F~L~l~~llilla~vls~~R~K~~  906 (975)
                      |+.+..+.+.++       +++++++++++++.+.|.|.+
T Consensus         3 ~~~~~~~~~~~~-------~v~~~~~F~gi~~w~~~~~~k   35 (49)
T PF05545_consen    3 YETLQGFARSIG-------TVLFFVFFIGIVIWAYRPRNK   35 (49)
T ss_pred             HHHHHHHHHHHH-------HHHHHHHHHHHHHHHHcccch
Confidence            455666666322       444445556667767776654


No 32 
>PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional
Probab=23.66  E-value=1.9e+02  Score=30.33  Aligned_cols=60  Identities=15%  Similarity=0.253  Sum_probs=32.5

Q ss_pred             eEEEccceeEecCCceEEeeccCcEEEEEeeccEEecccceEEeeeEEEEEeeEEEccCcEEE
Q 002049           88 IYVEGSGNLHILPGVTLCCPIKGCLLTINVTGEFLLGRNSEIVAGTVYVSALNASFSSGSVVN  150 (975)
Q Consensus        88 v~i~G~g~l~i~~gv~l~c~~~G~~I~i~~sg~~~lg~~s~i~assi~l~A~niti~~~s~I~  150 (975)
                      .++.+..++++-++|.+   ..+|.+.+...+.+.|++++.|-.........+++|.++..|.
T Consensus        36 f~~~~~~~I~iG~~v~i---~~~~ri~~~~~~~i~IG~~v~Ig~~v~I~~~~~v~IG~~v~Ig   95 (192)
T PRK09677         36 FYIRNDGSINFGEGFTS---GVGLRLDAFGRGKLFFGDNVQVNDYVHIACIESITIGRDTLIA   95 (192)
T ss_pred             EEEcCCCeEEECCceEE---CCCeEEEecCCCeEEECCCCEECCCcEEccCceEEECCCCEEC
Confidence            34555556666666443   3456665555566666666666544443333455555554443


No 33 
>PF12661 hEGF:  Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A.
Probab=23.54  E-value=25  Score=22.57  Aligned_cols=11  Identities=45%  Similarity=1.066  Sum_probs=8.1

Q ss_pred             CCCCCCccccc
Q 002049          797 ACPRGLYGVFC  807 (975)
Q Consensus       797 ~CP~G~yG~fC  807 (975)
                      .||+||.|..|
T Consensus         3 ~C~~G~~G~~C   13 (13)
T PF12661_consen    3 QCPPGWTGPNC   13 (13)
T ss_dssp             EE-TTEETTTT
T ss_pred             cCcCCCcCCCC
Confidence            48999988877


No 34 
>KOG2906 consensus RNA polymerase III subunit C11 [Transcription]
Probab=22.50  E-value=51  Score=32.22  Aligned_cols=31  Identities=26%  Similarity=0.620  Sum_probs=16.1

Q ss_pred             ccceeCCCC-ceeccCCCCCCCcccCCCCCCCC
Q 002049          805 VFCEECPVG-TFKNVSGSDRALCRNCSSNELPH  836 (975)
Q Consensus       805 ~fC~eCP~G-tYKn~~gs~~~~C~pCp~~~~p~  836 (975)
                      .||..|.-. -++...--++--|+.||+ .+|.
T Consensus         2 ~FCP~Cgn~Live~g~~~~rf~C~tCpY-~~~I   33 (105)
T KOG2906|consen    2 LFCPTCGNMLIVESGESCNRFSCRTCPY-VFPI   33 (105)
T ss_pred             cccCCCCCEEEEecCCeEeeEEcCCCCc-eeeE
Confidence            367777643 122111013457899996 5554


No 35 
>PF15048 OSTbeta:  Organic solute transporter subunit beta protein
Probab=22.46  E-value=1.2e+02  Score=30.92  Aligned_cols=30  Identities=30%  Similarity=0.853  Sum_probs=19.1

Q ss_pred             hHHHHHHHh----CCceehhhHHHHHHHH-HHHHH
Q 002049          869 TLEELVYTF----GGPWLFGLILLGLLIL-LALVL  898 (975)
Q Consensus       869 ~le~li~~~----GGp~~F~L~l~~llil-la~vl  898 (975)
                      -|||++--|    .-||-|++|++..+++ |++||
T Consensus        19 ~LEemlW~fR~ED~tpWNysiL~Ls~vvlvi~~~L   53 (125)
T PF15048_consen   19 LLEEMLWFFRVEDATPWNYSILALSFVVLVISFFL   53 (125)
T ss_pred             HHHHHHHheecCCCCCcchHHHHHHHHHHHHHHHH
Confidence            488877434    4689777776666444 55555


No 36 
>KOG4260 consensus Uncharacterized conserved protein [Function unknown]
Probab=21.07  E-value=64  Score=36.62  Aligned_cols=28  Identities=39%  Similarity=0.940  Sum_probs=0.0

Q ss_pred             CCCCCccccceeCCCCceeccCCCCCCCcc
Q 002049          798 CPRGLYGVFCEECPVGTFKNVSGSDRALCR  827 (975)
Q Consensus       798 CP~G~yG~fC~eCP~GtYKn~~gs~~~~C~  827 (975)
                      ||+|.||.-|..||-|+=|.=.|  ...|+
T Consensus       132 Cp~gtyGpdCl~Cpggser~C~G--nG~C~  159 (350)
T KOG4260|consen  132 CPDGTYGPDCLQCPGGSERPCFG--NGSCH  159 (350)
T ss_pred             cCCCCcCCccccCCCCCcCCcCC--CCccc


Done!