Citrus Sinensis ID: 002069


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970---
MLKVLGLSFNQFSGSIPPEIGHLTHLKLLSFSKNQLSGLIPHEIGRLSSLNGLSLYSNFLKGSIPPSLGNLTSLIYIDIGNNLLSGSIPNEVGSLKSLSDLRLSNNSLNGSIPSSLGNLTNLVTLYLHMNALSGSIPDEIGNLKFLSDLQVSYNTLSGAIPFSLGNLTNLVTLYIGINALSGSIPNEIGNLKSLSDLRLDYNTLSGSILYSFGNLTKLEILYLDVNALSGLIPNEIGNLKSLLALQLNYNTLSGSIPCSFGNLTKLVISCLGTNALSSSILEEIGNLKSLLHLQLNYNTLSGSIPLSLGSLTNLATLYFSTNALSGSIPNEITNLRSLSDLQLSENTLNGSIPLALGNLTKLVSLDLSINKLSGSIPLSFASLTSLTTLYLYENSLCDSIPKEIGDMKSLSILDLSSNKLNGSIPLSLANLTNSLKVLYLSSNHIVGEIPLGHGKFSSLIQLILNNNELSGQLSPELGSLNQLEYLDLSANTFHNSIPESLGNLVKLHYLNLSNNQFSQKIPNPIEKLIHLSELDLSYKIFGEEIPSQVCSMQSLEKLNLSHNNLSGSISRCFEEMHWLSCIDISYNALQGLIPNSTAFRDAPMLALQGNKRLCGDIKRLPPCKAFKSHKQSLKKIWIVIVFPLLGTVALLISLIGLFFNFRQRKNGLQTQQSSPRNTLGLLSVLTFDGKIVHEEIIRATKNFDDEHCIGNGGQGSVYKAELPTGEIVAVKKFHSPLPGEMACQQEFLNEGNALTKIRHRNIVKFYGFCSHALHSFVVYEYLEMGSLAMILSNDAAAEEFGWTKRMNAIKGVADALLYMHTNCFPPIVHRDISSKNVLLNLEYEAHVSDFGISKFLKLGLSNRTELAGTFGYIAPELAYTMKVTEKCDVYSFGVLALEVIKGKHPRDFISSICSSLSSNLNIALDEMLDPRLPTPLRNVQDKLISIMEVSISCLDESPTSRPTMQKVSQLLKI
cccEEEccccccECcccccccccccccEEEcccccccccccccccccccccEEEccccccEECccccccccccccEEEcccccCEEcccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccCCcccccccccccccEEEccccccCEcccccccccccccEEEcccccccccccHHcccccccccEEcccccccccccHHHHcccccccccccccccEECccccccccccccEEEccccEEEEEcccccccccccccEEcccccccccccHHHHcccccccEEccccCEEEcccccccccccccEEEcccccccccccccccccccccEEEccccEEECcccccccccccccEEEccccCEEEcccccccccccccEEEcccccccccccHHHHHccccccEEEccccCCcccccccccccccccEEEcccccccccccHHHcccccccccccccccccccccHHHHccccccccccccccccccccHHccccccccEEEcccccccccccHHHHccccccEEccccccccccccHHccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHcccccccEEccccccEEEEEEcccccEEEEEECcccccccccccHHHHHHHHHHccccccccccEEEEEEcccccEEEEcccccccccHHcccccccccccHHHHHHHHHHHHHHHcccccccccccEEccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccHHHHHHcccccccccccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHcc
MLKVLGLSFNQFSGSIPPEIGHLTHLKLLSFSKNQLSGLIPHEIGRLSSLNGLSLYSNFLKGSIPPSLGNLTSLIYIDIGNNLLSGSIPNEVGSLKSLSDLRLSNNSLNGSIPSSLGNLTNLVTLYLHMNALSGSIPDEIGNLKFLSDLQVSYNTLSGAIPFSLGNLTNLVTLYIGINALSGSIPNEIGNLKSLSDLRLDYNTLSGSILYSFGNLTKLEILYLDVNALSGLIPNEIGNLKSLLALQLNYNTLSGSIPCSFGNLTKLVISCLGTNALSSSILEEIGNLKSLLHLQLNYNTLSGSIPLSLGSLTNLATLYFSTNALSGSIPNEITNLRSLSDLQLSENTLNGSIPLALGNLTKLVSLDLSINKLSGSIPLSFASLTSLTTLYLYENSLCDSIPKEIGDMKSLSILDLSSNKLNGSIPLSLANLTNSLKVLYLSSNHIVGEIPLGHGKFSSLIQLILNNNELSGQLSPELGSLNQLEYLDLSANTFHNSIPESLGNLVKLHYLNLSNNQFSQKIPNPIEKLIHLSELDLSYKIFGEEIPSQVCSMQSLEKLNLSHNNLSGSISRCFEEMHWLSCIDISYNALQGLIPNSTAFRDAPMLALQGNKRLCGDIKRLPPCK*******SLKKIWIVIVFPLLGTVALLISLIGLFFNFRQR***************GLLSVLTFDGKIVHEEIIRATKNFDDEHCIGNGGQGSVYKAELPTGEIVAVKKFHSPLPGEMACQQEFLNEGNALTKIRHRNIVKFYGFCSHALHSFVVYEYLEMGSLAMILSNDAAAEEFGWTKRMNAIKGVADALLYMHTNCFPPIVHRDISSKNVLLNLEYEAHVSDFGISKFLKLGLSNRTELAGTFGYIAPELAYTMKVTEKCDVYSFGVLALEVIKGKHPRDFISSICSSLSSNLNIALDEMLDPRLPTPLRNVQDKLISIMEVSISCLDESPTSRPT*QKVS*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLKVLGLSFNQFSGSIPPEIGHLTHLKLLSFSKNQLSGLIPHEIGRLSSLNGLSLYSNFLKGSIPPSLGNLTSLIYIDIGNNLLSGSIPNEVGSLKSLSDLRLSNNSLNGSIPSSLGNLTNLVTLYLHMNALSGSIPDEIGNLKFLSDLQVSYNTLSGAIPFSLGNLTNLVTLYIGINALSGSIPNEIGNLKSLSDLRLDYNTLSGSILYSFGNLTKLEILYLDVNALSGLIPNEIGNLKSLLALQLNYNTLSGSIPCSFGNLTKLVISCLGTNALSSSILEEIGNLKSLLHLQLNYNTLSGSIPLSLGSLTNLATLYFSTNALSGSIPNEITNLRSLSDLQLSENTLNGSIPLALGNLTKLVSLDLSINKLSGSIPLSFASLTSLTTLYLYENSLCDSIPKEIGDMKSLSILDLSSNKLNGSIPLSLANLTNSLKVLYLSSNHIVGEIPLGHGKFSSLIQLILNNNELSGQLSPELGSLNQLEYLDLSANTFHNSIPESLGNLVKLHYLNLSNNQFSQKIPNPIEKLIHLSELDLSYKIFGEEIPSQVCSMQSLEKLNLSHNNLSGSISRCFEEMHWLSCIDISYNALQGLIPNSTAFRDAPMLALQGNKRLCGDIKRLPPCKAFKSHKQSLKKIWIVIVFPLLGTVALLISLIGLFFNFRQRKNGLQTQQSSPRNTLGLLSVLTFDGKIVHEEIIRATKNFDDEHCIGNGGQGSVYKAELPTGEIVAVKKFHSPLPGEMACQQEFLNEGNALTKIRHRNIVKFYGFCSHALHSFVVYEYLEMGSLAMILSNDAAAEEFGWTKRMNAIKGVADALLYMHTNCFPPIVHRDISSKNVLLNLEYEAHVSDFGISKFLKLGLSNRTELAGTFGYIAPELAYTMKVTEKCDVYSFGVLALEVIKGKHPRDFISSICSSLSSNLNIALDEMLDPRLPTPLRNVQDKLISIMEVSISCLDESPTSRPTMQKVSQLLKI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable leucine-rich repeat receptor-like protein kinase At1g35710 probableQ9LP24

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IFG, chain A
Confidence level:very confident
Coverage over the Query: 4-110
View the alignment between query and template
View the model in PyMOL
Template: 2IFG, chain A
Confidence level:very confident
Coverage over the Query: 28-133
View the alignment between query and template
View the model in PyMOL
Template: 1OGQ, chain A
Confidence level:very confident
Coverage over the Query: 24-275
View the alignment between query and template
View the model in PyMOL
Template: 4FMZ, chain A
Confidence level:very confident
Coverage over the Query: 19-346
View the alignment between query and template
View the model in PyMOL
Template: 4FMZ, chain A
Confidence level:very confident
Coverage over the Query: 45-257,284-394
View the alignment between query and template
View the model in PyMOL
Template: 2Z81, chain A
Confidence level:very confident
Coverage over the Query: 4-259,278-519
View the alignment between query and template
View the model in PyMOL
Template: 1ZIW, chain A
Confidence level:very confident
Coverage over the Query: 3-595
View the alignment between query and template
View the model in PyMOL
Template: 1ZIW, chain A
Confidence level:very confident
Coverage over the Query: 27-615
View the alignment between query and template
View the model in PyMOL
Template: 3VHE, chain A
Confidence level:very confident
Coverage over the Query: 797-972
View the alignment between query and template
View the model in PyMOL
Template: 3TL8, chain A
Confidence level:confident
Coverage over the Query: 681-972
View the alignment between query and template
View the model in PyMOL
Template: 3A79, chain A
Confidence level:probable
Coverage over the Query: 424-515,542-638
View the alignment between query and template
View the model in PyMOL