BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 002114
         (965 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound
          Length = 477

 Score = 30.4 bits (67), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 5/69 (7%)

Query: 658 EVESGGILVAVERVNKGYAIILYRGKNYERPACLRPKTLLTKRE--AMKRSLEAQRRQSL 715
           E    GI    ER N+G+ I+   GK ++    +R  +L+T R     KRS+E + ++  
Sbjct: 76  EFSGRGIFPLAERANRGFGIVFSNGKKWKE---IRRFSLMTLRNFGMGKRSIEDRVQEEA 132

Query: 716 KLHVLELTR 724
           +  V EL +
Sbjct: 133 RCLVEELRK 141


>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9
 pdb|1OG2|B Chain B, Structure Of Human Cytochrome P450 Cyp2c9
 pdb|1OG5|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9
 pdb|1OG5|B Chain B, Structure Of Human Cytochrome P450 Cyp2c9
          Length = 475

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 5/69 (7%)

Query: 658 EVESGGILVAVERVNKGYAIILYRGKNYERPACLRPKTLLTKRE--AMKRSLEAQRRQSL 715
           E    GI    ER N+G+ I+   GK ++    +R  +L+T R     KRS+E + ++  
Sbjct: 74  EFSGRGIFPLAERANRGFGIVFSNGKKWKE---IRRFSLMTLRNFGMGKRSIEDRVQEEA 130

Query: 716 KLHVLELTR 724
           +  V EL +
Sbjct: 131 RCLVEELRK 139


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.314    0.131    0.377 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 26,814,245
Number of Sequences: 62578
Number of extensions: 1081484
Number of successful extensions: 1680
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 1677
Number of HSP's gapped (non-prelim): 10
length of query: 965
length of database: 14,973,337
effective HSP length: 108
effective length of query: 857
effective length of database: 8,214,913
effective search space: 7040180441
effective search space used: 7040180441
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 56 (26.2 bits)