BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 002131
         (961 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3N28|A Chain A, Crystal Structure Of Probable Phosphoserine Phosphatase
           From Vibrio Cholerae, Unliganded Form
          Length = 335

 Score = 30.8 bits (68), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 5/64 (7%)

Query: 738 GFKRKIESLITSLQTMSALLHEKSSLVASKSQSLHEDVNLSGKLNDQTAGEIMRSELKAE 797
           G+K  I S        S  L E+ SL  ++S +L     +SGKL  Q  GE++ ++ KA+
Sbjct: 194 GWKVAIAS--GGFTYFSDYLKEQLSLDYAQSNTLE---IVSGKLTGQVLGEVVSAQTKAD 248

Query: 798 TLLT 801
            LLT
Sbjct: 249 ILLT 252


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.313    0.130    0.355 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 23,108,481
Number of Sequences: 62578
Number of extensions: 859775
Number of successful extensions: 1815
Number of sequences better than 100.0: 19
Number of HSP's better than 100.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 13
Number of HSP's that attempted gapping in prelim test: 1774
Number of HSP's gapped (non-prelim): 51
length of query: 961
length of database: 14,973,337
effective HSP length: 108
effective length of query: 853
effective length of database: 8,214,913
effective search space: 7007320789
effective search space used: 7007320789
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 56 (26.2 bits)