Citrus Sinensis ID: 002154


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------96
MVDAIISPLLEQLISVAVEEPKEQVRLVNGVGKEVEKLTSNLQAIQAVLHDAEKRQVKEETVRLWLDQLRGTSYDMEDVLGEWNTARLKLQINKKKVCSFFPAASCFGCKPIVLRRDIALKIKEINETLDNIAKQKDQFGFSVNGTKSNERADQRVPSISSIDESEIFGRQKEKNELVNRLLCESSKEQKGPRIISLVGMGGIGKTTLAQFAYNNDSVKRNFQKRIWVCVSEPFDEFRIARAIIEALKPGSAKELVEFQSLMQHIQEYVVEGEKFLLVLDDVWNEDYGKWEPFYNCLKSSPHGSKLLITTRKETVALIMGSTQVISVNELSEMECWSVFESLAFFGKSMQERENLEKIGWEIVRKCKGLPLAAKTIASLLLSKNTEKEWQNILESEIWELEAIEKGLLAPLLLSYKELPSKVKRCFSYCAVFLKDYEIRKHKLIELWMAQGYLSEKGAKEMEDIGEEYFNILARRSFFQDFDKGYDGEISTYKMHDIVHDFAQYLCRNECFALEIHSGSGEESAMSSFGETKILHLMLTLYKGASVPIPIWDNVKGLRGLRSLLVESDEYSWFSEVLPQLFDKLTCLRALKLEVRQPWWCQNFIKDIPENIEKLLHLKYLSLAHQEAIERLPEALCELYNLERLNVSGCSHLRELPRGIGKLRKLMYLYNAGTDSLRYLPAGIDELIRLRSVRKFVVGGGYDRACSLGSLKKLNLLRQCSIDGLGGVSDAGEARRAELEKKKNLFDLDLHFGHSRDGDEEQAGRRENEEDKDERLLEALGPPPNLKKLVIDEYRGRRNVVPINWIMSLTNLRDLSLNWWRNCEHLPPLGKLPSLEDLWIQGMKSVKRVGNEFLGVESDTDGSSVIAFPKLRRLRFVCMEELEEWDCGTAIKGEIIIMARLSSLSIVYCPKLKALPDHLLQKSTLQGFGIYHCPILEERYREKTGEDWPKIRHIPRIEIE
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccEEEEEEccccccHHHHHHHHHccHHHHHcccccEEEEEcccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHHHHcccccccEEEEEcccHHHHHHHcccccEEcccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHccccccccccccccHHHHccccccccccHHHHHHcccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccccccccccccccEEEEcHHHHHHHHHHHHccEEEEEccccccccccccccccccEEEEEEEECccccccccccccccccccEEEEEEcccccccccccHHHHHcccccEEEEEcccccccccccccccccccccccccccccccccccccccccHHHHccccccEEccccccccccccHHccccccccEEEcccccccccccccccccccccccccEECcccccccccccccccccccccccccccccccccccccccccccccccccEEEECccccccccHHcccccccccHHHHHHHccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccEEcccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccEEEEcccHHHHHHHccccccccccccccccEEEc
MVDAIISPLLEQLISVAVEEPKEQVRLVNGVGKEVEKLTSNLQAIQAVLHDAEKRQVKEETVRLWLDQLRGTSYDMEDVLGEWNTARLKLQINKKKVCSFFPAASCFGCKPIVLRRDIALKIKEINETLDNIAKQKDQF*************************SEIFGRQKEKNELVNRLLCESSKEQKGPRIISLVGMGGIGKTTLAQFAYNNDSVKRNFQKRIWVCVSEPFDEFRIARAIIEALKPGSAKELVEFQSLMQHIQEYVVEGEKFLLVLDDVWNEDYGKWEPFYNCLKSSPHGSKLLITTRKETVALIMGSTQVISVNELSEMECWSVFESLAFFGKSMQERENLEKIGWEIVRKCKGLPLAAKTIASLLLSKNTEKEWQNILESEIWELEAIEKGLLAPLLLSYKELPSKVKRCFSYCAVFLKDYEIRKHKLIELWMAQGYLSEKGAKEMEDIGEEYFNILARRSFFQDFDKGYDGEISTYKMHDIVHDFAQYLCRNECFALEIHS**********FGETKILHLMLTLYKGASVPIPIWDNVKGLRGLRSLLVESDEYSWFSEVLPQLFDKLTCLRALKLEVRQPWWCQNFIKDIPENIEKLLHLKYLSLAHQEAIERLPEALCELYNLERLNVSGCSHLRELPRGIGKLRKLMYLYNAGTDSLRYLPAGIDELIRLRSVRKFVVGGGYDRACSLGSLKKLNLLRQCSIDGLGGVSDAGEARRAELEKKKNLFDLDLHFGHSRDGDE*********EDKDERLLEALGPPPNLKKLVIDEYRGRRNVVPINWIMSLTNLRDLSLNWWRNCEHLPPLGKLPSLEDLWIQGMKSVKRVGNEFLGVESDTDGSSVIAFPKLRRLRFVCMEELEEWDCGTAIKGEIIIMARLSSLSIVYCPKLKALPDHLLQKSTLQGFGIYHCPILEERYREKTGEDWPKIRHIPRIEIE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVDAIISPLLEQLISVAVEEPKEQVRLVNGVGKExxxxxxxxxxxxxxxxxxxxxQVKEETVRLWLDQLRGTSYDMEDVLGEWNTARLKLQINKKKVCSFFPAASCFGCKPIVLRRDIALKIKEINETLDNIAKQKDQFGFSVNGTKSNERADQRVPSISSIDESEIFGRQKEKNELVNRLLCESSKEQKGPRIISLVGMGGIGKTTLAQFAYNNDSVKRNFQKRIWVCVSEPFDEFRIARAIIEALKPGSAKELVEFQSLMQHIQEYVVEGEKFLLVLDDVWNEDYGKWEPFYNCLKSSPHGSKLLITTRKETVALIMGSTQVISVNELSEMECWSVFESLAFFGKSMQERENLEKIGWEIVRKCKGLPLAAKTIASLLLSKNTEKEWQNILESEIWELEAIEKGLLAPLLLSYKELPSKVKRCFSYCAVFLKDYEIRKHKLIELWMAQGYLSEKGAKEMEDIGEEYFNILARRSFFQDFDKGYDGEISTYKMHDIVHDFAQYLCRNECFALEIHSGSGEESAMSSFGETKILHLMLTLYKGASVPIPIWDNVKGLRGLRSLLVESDEYSWFSEVLPQLFDKLTCLRALKLEVRQPWWCQNFIKDIPENIEKLLHLKYLSLAHQEAIERLPEALCELYNLERLNVSGCSHLRELPRGIGKLRKLMYLYNAGTDSLRYLPAGIDELIRLRSVRKFVVGGGYDRACSLGSLKKLNLLRQCSIDGLGGVSDAGEARRAELEKKKNLFDLDLHFGHSRDGDEEQAGRRENEEDKDERLLEALGPPPNLKKLVIDEYRGRRNVVPINWIMSLTNLRDLSLNWWRNCEHLPPLGKLPSLEDLWIQGMKSVKRVGNEFLGVESDTDGSSVIAFPKLRRLRFVCMEELEEWDCGTAIKGEIIIMARLSSLSIVYCPKLKALPDHLLQKSTLQGFGIYHCPILEERYREKTGEDWPKIRHIPRIEIE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative disease resistance RPP13-like protein 1 Potential disease resistance protein.probableQ9LRR4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4ECO, chain A
Confidence level:very confident
Coverage over the Query: 577-933
View the alignment between query and template
View the model in PyMOL
Template: 1O6V, chain A
Confidence level:very confident
Coverage over the Query: 532-756,776-850,864-934
View the alignment between query and template
View the model in PyMOL
Template: 3SFZ, chain A
Confidence level:very confident
Coverage over the Query: 161-450,462-509
View the alignment between query and template
View the model in PyMOL
Template: 3OGK, chain B
Confidence level:very confident
Coverage over the Query: 531-753,771-933
View the alignment between query and template
View the model in PyMOL
Template: 2A5Y, chain B
Confidence level:very confident
Coverage over the Query: 168-511
View the alignment between query and template
View the model in PyMOL
Template: 3RGZ, chain A
Confidence level:confident
Coverage over the Query: 531-757,775-943
View the alignment between query and template
View the model in PyMOL
Template: 3QFL, chain A
Confidence level:confident
Coverage over the Query: 4-89
View the alignment between query and template
View the model in PyMOL