Citrus Sinensis ID: 002168

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------

MAPPPSKFNRAYDDKEAPPSSNLWVGNLSADTTDADLKELFGKFGALDKVTTYSSRSFAFVYFKRVEDAKAAKDALQGSDFRGNPIKIEFARPAKPSKHLWVGGISQTVSKEELEEGFLKFGNIEDFKFLKDGNTAFVEYSRLEDAAEALKNINGRQIGGEQLRVDFLRSQPSRREQWPNSHDARDGPIIGRGTGFSDNHSAYKRSHPQSSVGRNRDGPPSKILWVGYPPSVQMDEQMLHNAMILFGEIERIKSYPSRNYSFVEFRSVDEARRAKEGLQGRLFNDPRITIMFSSSELAPGKDYPGSYSGTKGPRSEMFFGDQIRPSQLDMLGPNQSMQPNNFAGHLQPADIRGPSMPMRSIGAHGGHETLLSGPDFKDFHSMQDPNAKNLDPNWRRPSPSPGIRTSPTQGIRQPLNHAPGSWDVYDANQFQRDSKRLRVDGSMPIDDATFPSRKIDDHGLVLDQSYGLGSITGGPASGAFVNVQGRNRLSPVASKVTAGGFGRNPIDSDFIWRGIIAKGGTPVCRARCVPFGKGIESELPEVVNCSARTGLDMLAKHYAEAIGFDIVFFLPDSEDDFASYTEFLRYLGSKNRAGVAKFDDGTTLFLVPPSDFLSKVLKVVGPERLYGVVLKLPQQAMVPPQTVDKQNIPPPHAEYGLTRPKEEHVLPVDYNRFSHDDSKVQSKMHFPHASEPLIAHSSSMDYGSNNAAAISQAGVKLTPELIATLTSLIPATKSAEVAPGSSSARPLLAEPHVQSIEQLGNHYNPQAQSLTHHYASMSSTPSHSAQMLLGNNQLQESTASLSQQGMVYSRPLPNFSIAPQAAPVAVSPPVHQQYQFAAPSNSQKGYGMMQGTEASTLYGSSVFQQPNNPTAVSNQVNLSQPQNVMTVSVDKVNLEHPNHVQQLQSVLSGAGQGTSDGEVDKNQRYQSTLQFAANLLLQIQQQQQTNSPAGRGTGNQQ

cccccccccccccccccccccEEEEccccccccHHHHHHHHcccccEEEEEEEccccEEEEEEccHHHHHHHHHHHccccccccEEEEEEccccccccEEEEccccccccHHHHHHHHcccccEEEEEEEEcccCEEEEEccHHHHHHHHHHcccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccHHHHHHHHcccccEEEEEEcccccCEEEEcccHHHHHHHHHHHccccccccCEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCECcccccHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHccccccEEEEEccccEEEECccccHHHcHHccccccEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccc

**********************LWVGNLSADTTDADLKELFGKFGALDKVTTYSSRSFAFVYFKRVEDAKAAKDALQGSDFRGNPIKIEFARPAKPSKHLWVGGISQTVSKEELEEGFLKFGNIEDFKFLKDGNTAFVEYSRLEDAAEALKNINGRQIGGEQLRV***************************************************DGPPSKILWVGYPPSVQMDEQMLHNAMILFGEIERIKSYPSRNYSFVEFRSVDEARRAKEGLQGRLFNDPRITIMF***********************************************************************************************************************************VY*****************************IDDHGLVLDQSYGLGSITGGPAS****************************IDSDFIWRGIIAKGGTPVCRARCVPFGKGIESELPEVVNCSARTGLDMLAKHYAEAIGFDIVFFLPDSEDDFASYTEFLRYLGSKNRAGVAKFDDGTTLFLVPPSDFLSKVLKVVGPERLYGVVLKLPQ********************************************************************************VKLTPELIATLTSLI***************************************************************************************************************************************************************************************************YQSTLQFAANLLL********************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Flowering time control protein FPA	Plays a role in the regulation of flowering time in the autonomous flowering pathway by decreasing FLOWERING LOCUS C mRNA levels. Required for RNA-mediated chromatin silencing of a range of loci in the genome. Cotranscriptionally recognizes aberrant RNA and marks it for silencing. Controls alternative cleavage and polyadenylation on pre-mRNAs and antisense RNAs. Acts redundantly with FCA to prevent the expression of distally polyadenylated antisense RNAs at the FLC locus.	probable	Q8LPQ9

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3MD3, chain A
Confidence level:very confident
Coverage over the Query: 98-174,217-294
View the alignment between query and template
View the model in PyMOL

Template: 3MD3, chain A
Confidence level:very confident
Coverage over the Query: 21-169
View the alignment between query and template
View the model in PyMOL

Template: 3PGW, chain A
Confidence level:very confident
Coverage over the Query: 94-183
View the alignment between query and template
View the model in PyMOL

Template: 1OW1, chain A
Confidence level:confident
Coverage over the Query: 510-619
View the alignment between query and template
View the model in PyMOL