Query         002185
Match_columns 955
No_of_seqs    146 out of 247
Neff          2.9 
Searched_HMMs 46136
Date          Thu Mar 28 18:27:14 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/002185.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/002185hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF01102 Glycophorin_A:  Glycop  97.7 3.7E-05   8E-10   74.2   3.9   38  872-909    58-95  (122)
  2 PTZ00382 Variant-specific surf  97.3 7.8E-05 1.7E-09   69.0   1.2   35  871-905    59-93  (96)
  3 PF03302 VSP:  Giardia variant-  96.2  0.0022 4.7E-08   71.6   2.1   36  871-906   360-395 (397)
  4 PF05808 Podoplanin:  Podoplani  96.1  0.0016 3.4E-08   65.9   0.0   40  871-910   122-161 (162)
  5 PF01034 Syndecan:  Syndecan do  95.2  0.0053 1.2E-07   54.2   0.1   32  879-910    10-41  (64)
  6 PF05454 DAG1:  Dystroglycan (D  94.9  0.0069 1.5E-07   65.9   0.0   92  735-829     3-102 (290)
  7 PF12877 DUF3827:  Domain of un  94.8    0.13 2.8E-06   61.2   9.8   47  767-813   191-239 (684)
  8 PF04478 Mid2:  Mid2 like cell   93.8   0.018   4E-07   58.0   0.2   18  875-892    46-63  (154)
  9 PF01299 Lamp:  Lysosome-associ  92.0   0.074 1.6E-06   57.2   1.6   32  878-909   270-301 (306)
 10 PF07213 DAP10:  DAP10 membrane  91.9    0.11 2.3E-06   47.9   2.3   38  873-911    29-66  (79)
 11 PF13908 Shisa:  Wnt and FGF in  91.3    0.13 2.8E-06   51.4   2.3   16  875-890    76-91  (179)
 12 PF15102 TMEM154:  TMEM154 prot  91.3    0.13 2.8E-06   51.8   2.3   37  875-911    53-89  (146)
 13 PF02439 Adeno_E3_CR2:  Adenovi  90.7    0.33 7.1E-06   39.6   3.6   29  881-909     6-34  (38)
 14 PF12273 RCR:  Chitin synthesis  90.2    0.37   8E-06   46.3   4.2   13  916-928    33-45  (130)
 15 PF12768 Rax2:  Cortical protei  90.1    0.31 6.6E-06   53.0   4.1   31  872-902   221-251 (281)
 16 PF08693 SKG6:  Transmembrane a  89.0    0.14   3E-06   41.9   0.4    8  900-907    32-39  (40)
 17 PF04689 S1FA:  DNA binding pro  88.7    0.77 1.7E-05   41.3   4.7   35  871-906     6-40  (69)
 18 PF02480 Herpes_gE:  Alphaherpe  88.4    0.14   3E-06   58.6   0.0   38  875-912   349-386 (439)
 19 PF10873 DUF2668:  Protein of u  87.3    0.59 1.3E-05   47.4   3.6   27  873-899    56-82  (155)
 20 PF02009 Rifin_STEVOR:  Rifin/s  84.5    0.71 1.5E-05   50.9   2.8   23  888-910   264-286 (299)
 21 PF12301 CD99L2:  CD99 antigen   82.9     1.3 2.9E-05   45.5   3.8   35  871-907   108-142 (169)
 22 PF13908 Shisa:  Wnt and FGF in  82.8    0.97 2.1E-05   45.3   2.8   26  874-899    71-96  (179)
 23 PF01034 Syndecan:  Syndecan do  82.4    0.41 8.9E-06   42.7  -0.0   43  872-915     7-49  (64)
 24 PHA03265 envelope glycoprotein  82.2    0.78 1.7E-05   51.9   2.0   32  876-907   345-376 (402)
 25 PF06024 DUF912:  Nucleopolyhed  81.3    0.48   1E-05   44.4   0.1   35  876-910    60-94  (101)
 26 PF14575 EphA2_TM:  Ephrin type  80.5    0.64 1.4E-05   41.8   0.5   18  880-897     2-19  (75)
 27 PF08374 Protocadherin:  Protoc  80.4     1.8   4E-05   46.3   3.9   19  878-896    38-56  (221)
 28 PF06697 DUF1191:  Protein of u  79.0     1.2 2.5E-05   49.0   2.0   26  872-897   207-233 (278)
 29 PF06365 CD34_antigen:  CD34/Po  77.5     3.1 6.7E-05   44.0   4.5   29  879-907   101-129 (202)
 30 PF05827 ATP-synt_S1:  Vacuolar  75.8      13 0.00028   39.6   8.7  100  729-829    67-176 (282)
 31 PF05393 Hum_adeno_E3A:  Human   71.9     5.3 0.00011   38.0   4.0   34  880-913    32-65  (94)
 32 PTZ00046 rifin; Provisional     71.7     3.4 7.3E-05   47.0   3.3   21  890-910   325-345 (358)
 33 TIGR01477 RIFIN variant surfac  71.1     3.5 7.7E-05   46.7   3.3   29  882-910   311-340 (353)
 34 PF03229 Alpha_GJ:  Alphavirus   69.3     6.3 0.00014   39.1   4.1   33  875-907    80-112 (126)
 35 PHA03283 envelope glycoprotein  67.9     3.7 8.1E-05   48.6   2.7   44  878-922   399-442 (542)
 36 TIGR01478 STEVOR variant surfa  67.7     4.9 0.00011   44.7   3.4    6  727-732    44-49  (295)
 37 PTZ00370 STEVOR; Provisional    66.1     5.5 0.00012   44.3   3.4   15  889-903   263-277 (296)
 38 PLN03150 hypothetical protein;  64.0     5.3 0.00012   47.3   3.0   33  874-907   540-572 (623)
 39 PF01102 Glycophorin_A:  Glycop  63.5     7.8 0.00017   38.3   3.5   41  873-913    55-96  (122)
 40 PF14575 EphA2_TM:  Ephrin type  62.8     6.9 0.00015   35.3   2.8   25  883-907     2-26  (75)
 41 PRK08455 fliL flagellar basal   62.6     9.7 0.00021   39.3   4.2   28  880-907    19-46  (182)
 42 PF05568 ASFV_J13L:  African sw  62.2     6.6 0.00014   40.4   2.9   28  881-908    32-59  (189)
 43 PF12877 DUF3827:  Domain of un  61.5     9.7 0.00021   46.3   4.5   70  872-947   264-334 (684)
 44 PF15050 SCIMP:  SCIMP protein   60.5     9.2  0.0002   38.3   3.4   38  880-918     9-46  (133)
 45 KOG4818 Lysosomal-associated m  60.3     8.6 0.00019   43.9   3.6   31  876-906   324-354 (362)
 46 PF14610 DUF4448:  Protein of u  60.1     4.3 9.3E-05   41.3   1.2   25  877-901   156-180 (189)
 47 PF14828 Amnionless:  Amnionles  59.8      42 0.00091   39.1   9.0   20  879-898   339-358 (437)
 48 PF12259 DUF3609:  Protein of u  59.7     6.4 0.00014   44.6   2.5   29  880-908   299-327 (361)
 49 KOG0196 Tyrosine kinase, EPH (  59.3      15 0.00033   46.0   5.6   13  780-792   472-484 (996)
 50 PF12768 Rax2:  Cortical protei  59.1       9 0.00019   42.0   3.4   38  872-910   225-262 (281)
 51 PF05084 GRA6:  Granule antigen  57.9      12 0.00027   39.1   4.0   29  884-913   153-181 (215)
 52 PF15345 TMEM51:  Transmembrane  56.8     7.9 0.00017   42.0   2.5   26  880-907    60-85  (233)
 53 PF12191 stn_TNFRSF12A:  Tumour  56.8     3.8 8.3E-05   40.9   0.2   13  884-896    84-96  (129)
 54 PF15099 PIRT:  Phosphoinositid  55.2       7 0.00015   39.2   1.7   35  878-912    80-115 (129)
 55 PF04478 Mid2:  Mid2 like cell   53.6     3.1 6.7E-05   42.6  -1.0   23  871-894    46-68  (154)
 56 PF15330 SIT:  SHP2-interacting  53.1      15 0.00033   35.4   3.5   28  885-912     4-31  (107)
 57 PF15069 FAM163:  FAM163 family  53.1      13 0.00029   37.8   3.3   13  877-889     5-17  (143)
 58 PF12273 RCR:  Chitin synthesis  52.4      10 0.00022   36.6   2.3   13  896-908    16-28  (130)
 59 PF10577 UPF0560:  Uncharacteri  49.6      16 0.00035   45.3   3.8   29  876-905   271-299 (807)
 60 PF05545 FixQ:  Cbb3-type cytoc  49.1      17 0.00038   30.0   2.8   21  885-905    13-33  (49)
 61 PF15176 LRR19-TM:  Leucine-ric  46.7      25 0.00054   34.3   3.8   27  872-898    12-38  (102)
 62 PF15065 NCU-G1:  Lysosomal tra  45.9     6.3 0.00014   44.7  -0.3   36  872-907   312-348 (350)
 63 PF13584 BatD:  Oxygen toleranc  44.4      24 0.00053   40.1   4.0   18  726-743   283-300 (484)
 64 PHA03286 envelope glycoprotein  43.5      18 0.00038   42.7   2.8   50  876-927   389-438 (492)
 65 PF05283 MGC-24:  Multi-glycosy  43.5      20 0.00042   37.8   2.9   31  872-907   155-185 (186)
 66 PF06809 NPDC1:  Neural prolife  42.0      28 0.00061   39.6   3.9   33  876-909   195-228 (341)
 67 KOG3637 Vitronectin receptor,   41.7      27  0.0006   44.5   4.2   29  874-902   975-1003(1030)
 68 PF11770 GAPT:  GRB2-binding ad  40.4      11 0.00025   38.7   0.6   26  882-908    11-36  (158)
 69 PF14991 MLANA:  Protein melan-  40.3     8.6 0.00019   38.0  -0.3   24  878-901    24-47  (118)
 70 PRK05696 fliL flagellar basal   39.7      33 0.00072   34.7   3.7   25  877-902    18-42  (170)
 71 PF10661 EssA:  WXG100 protein   39.6      30 0.00064   35.0   3.3   23  883-905   120-142 (145)
 72 PTZ00382 Variant-specific surf  39.2     8.6 0.00019   36.2  -0.4   38  873-910    57-95  (96)
 73 PF00558 Vpu:  Vpu protein;  In  38.7      34 0.00073   32.1   3.3   26  879-906     5-30  (81)
 74 KOG3514 Neurexin III-alpha [Si  38.1      23  0.0005   45.4   2.8   30  880-909  1514-1543(1591)
 75 PF02439 Adeno_E3_CR2:  Adenovi  36.2      35 0.00077   28.2   2.6   30  878-908     7-36  (38)
 76 PF04971 Lysis_S:  Lysis protei  36.1      30 0.00064   31.7   2.4   22  876-897    31-52  (68)
 77 PTZ00214 high cysteine membran  35.6       3 6.6E-05   51.4  -5.0   27  871-897   771-797 (800)
 78 PHA03281 envelope glycoprotein  35.4      46   0.001   40.3   4.5   29  874-902   549-578 (642)
 79 KOG3054 Uncharacterized conser  34.9      39 0.00085   37.5   3.6   24  886-909     6-29  (299)
 80 PHA03291 envelope glycoprotein  33.7      56  0.0012   37.9   4.6   73  871-949   279-352 (401)
 81 PRK06287 cobalt transport prot  33.5      47   0.001   32.1   3.5   13  886-898    82-94  (107)
 82 PF05083 LST1:  LST-1 protein;   32.0      36 0.00077   31.5   2.3   23  886-908     2-24  (74)
 83 PF02158 Neuregulin:  Neureguli  31.9      15 0.00033   42.4   0.0   18  879-896    11-28  (404)
 84 PF07178 TraL:  TraL protein;    31.9      40 0.00087   31.3   2.7   28  879-906    30-57  (95)
 85 PF02480 Herpes_gE:  Alphaherpe  31.4      16 0.00034   42.5   0.0   49  873-922   351-399 (439)
 86 PF05337 CSF-1:  Macrophage col  31.2      16 0.00035   40.7   0.0   30  884-915   231-260 (285)
 87 PRK00523 hypothetical protein;  31.1      55  0.0012   30.3   3.3   25  881-905     4-28  (72)
 88 PRK07021 fliL flagellar basal   30.7      52  0.0011   33.1   3.5   28  877-905    15-42  (162)
 89 PF12669 P12:  Virus attachment  30.7      53  0.0011   28.7   3.0    9  900-908    18-26  (58)
 90 PF07253 Gypsy:  Gypsy protein;  30.1      49  0.0011   39.3   3.6   37  883-919   420-456 (472)
 91 PF02529 PetG:  Cytochrome B6-F  29.5      69  0.0015   26.5   3.2   15  879-893     5-19  (37)
 92 PF05478 Prominin:  Prominin;    28.4      33 0.00072   42.3   2.0   34  875-908    89-122 (806)
 93 PF08374 Protocadherin:  Protoc  27.5      23  0.0005   38.3   0.4   14  880-893    36-49  (221)
 94 PF03302 VSP:  Giardia variant-  27.3      26 0.00057   40.0   0.8   36  875-910   360-396 (397)
 95 PLN00113 leucine-rich repeat r  27.2      62  0.0013   39.5   3.9   12  878-889   629-640 (968)
 96 PF05568 ASFV_J13L:  African sw  27.1      50  0.0011   34.3   2.6   28  885-912    32-59  (189)
 97 PRK14748 kdpF potassium-transp  26.4      44 0.00096   26.3   1.6   12  892-903    13-24  (29)
 98 PRK06531 yajC preprotein trans  26.3      20 0.00043   35.1  -0.3   25  890-914     8-32  (113)
 99 PHA02669 hypothetical protein;  26.2      36 0.00079   35.8   1.5   11  938-948    46-56  (210)
100 KOG3653 Transforming growth fa  26.1 1.3E+02  0.0027   36.4   5.9   62  881-947   157-222 (534)
101 PF05393 Hum_adeno_E3A:  Human   26.0      87  0.0019   30.2   3.8   35  873-908    29-63  (94)
102 PF05961 Chordopox_A13L:  Chord  25.9      96  0.0021   28.6   3.9   12  934-945    55-66  (68)
103 PRK13707 conjugal transfer pil  25.7      51  0.0011   31.6   2.3   29  880-908    37-65  (101)
104 PF07204 Orthoreo_P10:  Orthore  25.5      37 0.00079   32.9   1.3   13  886-898    49-61  (98)
105 PF14986 DUF4514:  Domain of un  25.4      77  0.0017   28.3   3.1   28  878-907    22-49  (61)
106 KOG1094 Discoidin domain recep  24.8      56  0.0012   40.3   2.8   16  735-750   194-209 (807)
107 PF14654 Epiglycanin_C:  Mucin,  24.7      93   0.002   30.5   3.8   31  872-902    12-42  (106)
108 COG4736 CcoQ Cbb3-type cytochr  24.6      71  0.0015   28.6   2.8   25  885-910    13-37  (60)
109 COG4980 GvpP Gas vesicle prote  24.6      40 0.00087   33.4   1.4   19  876-894     4-22  (115)
110 PRK05886 yajC preprotein trans  24.1      50  0.0011   32.3   1.9   16  890-905     9-24  (109)
111 PF06040 Adeno_E3:  Adenovirus   24.1      30 0.00066   34.5   0.5   15  878-892    89-103 (127)
112 COG2181 NarI Nitrate reductase  23.8      68  0.0015   35.0   3.0   25  880-904    87-111 (228)
113 KOG3637 Vitronectin receptor,   23.2      63  0.0014   41.5   3.1   27  878-905   976-1002(1030)
114 PRK01658 holin-like protein; V  22.9      60  0.0013   32.0   2.2   31  878-908    89-119 (122)
115 KOG1025 Epidermal growth facto  22.9      49  0.0011   42.2   2.0   27  879-905   629-655 (1177)
116 KOG3540 Beta amyloid precursor  22.8      56  0.0012   39.2   2.3   33  873-907   543-575 (615)
117 PLN00113 leucine-rich repeat r  22.7      84  0.0018   38.4   3.9   31  877-907   625-655 (968)
118 PF04156 IncA:  IncA protein;    22.5      57  0.0012   32.7   2.1   17  891-907    49-65  (191)
119 PF03988 DUF347:  Repeat of Unk  22.5      98  0.0021   26.5   3.2   18  881-898    27-44  (55)
120 PF11446 DUF2897:  Protein of u  22.4      48  0.0011   29.0   1.3   17  876-892     4-20  (55)
121 TIGR01495 ETRAMP Plasmodium ri  22.3      72  0.0016   30.0   2.5   21  878-898    52-72  (85)
122 PF02699 YajC:  Preprotein tran  22.0      55  0.0012   29.9   1.7   20  887-906     4-23  (82)
123 PRK14750 kdpF potassium-transp  21.8      57  0.0012   25.7   1.4   12  891-902    12-23  (29)
124 PF05770 Ins134_P3_kin:  Inosit  21.8   2E+02  0.0042   32.5   6.1   51  748-799   248-298 (307)
125 PF04277 OAD_gamma:  Oxaloaceta  21.8      83  0.0018   27.7   2.7   21  882-902     9-29  (79)
126 COG3889 Predicted solute bindi  21.7      72  0.0016   40.1   3.0   24  882-906   848-871 (872)
127 PF13706 PepSY_TM_3:  PepSY-ass  21.3      86  0.0019   25.0   2.4   23  879-901     9-31  (37)
128 PF12669 P12:  Virus attachment  21.0      67  0.0014   28.1   1.9    8  903-910    18-25  (58)
129 PF06305 DUF1049:  Protein of u  20.8      68  0.0015   27.3   1.9   10  875-884    18-27  (68)
130 PF13268 DUF4059:  Protein of u  20.8      93   0.002   28.9   2.8   24  892-915    20-43  (72)
131 PF09472 MtrF:  Tetrahydrometha  20.8      60  0.0013   29.4   1.6   26  873-898    35-60  (64)
132 PHA03049 IMV membrane protein;  20.4 1.5E+02  0.0033   27.3   4.0   14  886-899     3-16  (68)
133 PF05399 EVI2A:  Ectropic viral  20.4      88  0.0019   34.1   3.0   21  877-897   128-149 (227)
134 PF08114 PMP1_2:  ATPase proteo  20.3 1.4E+02   0.003   25.4   3.5   10  875-884     6-15  (43)
135 PF05795 Plasmodium_Vir:  Plasm  20.2 1.2E+02  0.0025   32.3   3.9   22  876-898   277-298 (354)

No 1  
>PF01102 Glycophorin_A:  Glycophorin A;  InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=97.66  E-value=3.7e-05  Score=74.21  Aligned_cols=38  Identities=8%  Similarity=0.026  Sum_probs=30.6

Q ss_pred             cCCCCCcceehhhHHHHHHHHHHHHHHHHHHHhhcccc
Q 002185          872 KYGLSGGMIAIVVLSAFVAVVLCSAAAWVLLFKYKSHA  909 (955)
Q Consensus       872 KkgLSkGaIAGIVLGSVVlVVLLsAaa~LLLLRRRRR~  909 (955)
                      .++++.++|+||++|+++++|+++++++||++|+|||.
T Consensus        58 ~h~fs~~~i~~Ii~gv~aGvIg~Illi~y~irR~~Kk~   95 (122)
T PF01102_consen   58 VHRFSEPAIIGIIFGVMAGVIGIILLISYCIRRLRKKS   95 (122)
T ss_dssp             SSSSS-TCHHHHHHHHHHHHHHHHHHHHHHHHHHS---
T ss_pred             ccCccccceeehhHHHHHHHHHHHHHHHHHHHHHhccC
Confidence            56899999999999999999999999888887777664


No 2  
>PTZ00382 Variant-specific surface protein (VSP); Provisional
Probab=97.32  E-value=7.8e-05  Score=68.97  Aligned_cols=35  Identities=20%  Similarity=0.095  Sum_probs=26.1

Q ss_pred             ccCCCCCcceehhhHHHHHHHHHHHHHHHHHHHhh
Q 002185          871 QKYGLSGGMIAIVVLSAFVAVVLCSAAAWVLLFKY  905 (955)
Q Consensus       871 kKkgLSkGaIAGIVLGSVVlVVLLsAaa~LLLLRR  905 (955)
                      .+++++.|+|+||+||+++++.+|++++++++++|
T Consensus        59 ~~~~ls~gaiagi~vg~~~~v~~lv~~l~w~f~~r   93 (96)
T PTZ00382         59 NRSGLSTGAIAGISVAVVAVVGGLVGFLCWWFVCR   93 (96)
T ss_pred             CCCCcccccEEEEEeehhhHHHHHHHHHhheeEEe
Confidence            35789999999999999888877766654443333


No 3  
>PF03302 VSP:  Giardia variant-specific surface protein;  InterPro: IPR005127 During infection, the intestinal protozoan parasite Giardia lamblia virus undergoes continuous antigenic variation which is determined by diversification of the parasite's major surface antigen, named VSP (variant surface protein).
Probab=96.23  E-value=0.0022  Score=71.59  Aligned_cols=36  Identities=25%  Similarity=0.126  Sum_probs=28.5

Q ss_pred             ccCCCCCcceehhhHHHHHHHHHHHHHHHHHHHhhc
Q 002185          871 QKYGLSGGMIAIVVLSAFVAVVLCSAAAWVLLFKYK  906 (955)
Q Consensus       871 kKkgLSkGaIAGIVLGSVVlVVLLsAaa~LLLLRRR  906 (955)
                      .|++||.|+||||+|++||+|..|++++.+|++-|+
T Consensus       360 n~s~LstgaIaGIsvavvvvVgglvGfLcWwf~crg  395 (397)
T PF03302_consen  360 NKSGLSTGAIAGISVAVVVVVGGLVGFLCWWFICRG  395 (397)
T ss_pred             ccccccccceeeeeehhHHHHHHHHHHHhhheeecc
Confidence            467999999999999999888888887655544433


No 4  
>PF05808 Podoplanin:  Podoplanin;  InterPro: IPR008783 This family consists of several mammalian podoplanin-like proteins which are thought to control specifically the unique shape of podocytes [].; GO: 0016021 integral to membrane; PDB: 3IET_X.
Probab=96.07  E-value=0.0016  Score=65.90  Aligned_cols=40  Identities=18%  Similarity=0.227  Sum_probs=0.0

Q ss_pred             ccCCCCCcceehhhHHHHHHHHHHHHHHHHHHHhhccccc
Q 002185          871 QKYGLSGGMIAIVVLSAFVAVVLCSAAAWVLLFKYKSHAC  910 (955)
Q Consensus       871 kKkgLSkGaIAGIVLGSVVlVVLLsAaa~LLLLRRRRR~s  910 (955)
                      +|.||+.+.+|||+||+++++.+|.++++++++|.+.|++
T Consensus       122 ek~GL~T~tLVGIIVGVLlaIG~igGIIivvvRKmSGRys  161 (162)
T PF05808_consen  122 EKDGLSTVTLVGIIVGVLLAIGFIGGIIIVVVRKMSGRYS  161 (162)
T ss_dssp             ----------------------------------------
T ss_pred             ccCCcceeeeeeehhhHHHHHHHHhheeeEEeehhccccC
Confidence            5789999999999999999999999988777666677765


No 5  
>PF01034 Syndecan:  Syndecan domain;  InterPro: IPR001050 The syndecans are transmembrane proteoglycans which are involved in the organisation of cytoskeleton and/or actin microfilaments, and have important roles as cell surface receptors during cell-cell and/or cell-matrix interactions [, ]. Structurally, these proteins consist of four separate domains:   A signal sequence; An extracellular domain (ectodomain) of variable length whose sequence is not evolutionary conserved in the various forms of syndecans. The ectodomain contains the sites of attachment of the heparan sulphate glycosaminoglycan side chains;  A transmembrane region;  A highly conserved cytoplasmic domain of about 30 to 35 residues, which could interact with cytoskeletal proteins.    The proteins known to belong to this family are:    Syndecan 1.  Syndecan 2 or fibroglycan.  Syndecan 3 or neuroglycan or N-syndecan.  Syndecan 4 or amphiglycan or ryudocan.  Drosophila syndecan.   Caenorhabditis elegans probable syndecan (F57C7.3).    Syndecan-4, a transmembrane heparan sulphate proteoglycan, is a coreceptor with integrins in cell adhesion. It has been suggested to form a ternary signalling complex with protein kinase Calpha and phosphatidylinositol 4,5-bisphosphate (PIP2). Structural studies have demonstrated that the cytoplasmic domain undergoes a conformational transition and forms a symmetric dimer in the presence of phospholipid activator PIP2, and whose overall structure in solution exhibits a twisted clamp shape having a cavity in the centre of dimeric interface. In addition, it has been observed that the syndecan-4 variable domain interacts, strongly, not only with fatty acyl groups but also the anionic head group of PIP2. These findings indicate that PIP2 promotes oligomerisation of the syndecan-4 cytoplasmic domain for transmembrane signalling and cell-matrix adhesion [, ].; GO: 0008092 cytoskeletal protein binding, 0016020 membrane; PDB: 1EJQ_B 1EJP_B 1YBO_C 1OBY_Q.
Probab=95.20  E-value=0.0053  Score=54.21  Aligned_cols=32  Identities=13%  Similarity=0.326  Sum_probs=0.7

Q ss_pred             ceehhhHHHHHHHHHHHHHHHHHHHhhccccc
Q 002185          879 MIAIVVLSAFVAVVLCSAAAWVLLFKYKSHAC  910 (955)
Q Consensus       879 aIAGIVLGSVVlVVLLsAaa~LLLLRRRRR~s  910 (955)
                      +++|+++|++++++++++++.|+++|.|||.+
T Consensus        10 vlaavIaG~Vvgll~ailLIlf~iyR~rkkdE   41 (64)
T PF01034_consen   10 VLAAVIAGGVVGLLFAILLILFLIYRMRKKDE   41 (64)
T ss_dssp             ---------------------------S----
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCC
Confidence            34455555555555555555566677666654


No 6  
>PF05454 DAG1:  Dystroglycan (Dystrophin-associated glycoprotein 1);  InterPro: IPR008465 Dystroglycan is one of the dystrophin-associated glycoproteins, which is encoded by a 5.5 kb transcript in Homo sapiens. The protein product is cleaved into two non-covalently associated subunits, [alpha] (N-terminal) and [beta] (C-terminal). In skeletal muscle the dystroglycan complex works as a transmembrane linkage between the extracellular matrix and the cytoskeleton [alpha]-dystroglycan is extracellular and binds to merosin ([alpha]-2 laminin) in the basement membrane, while [beta]-dystroglycan is a transmembrane protein and binds to dystrophin, which is a large rod-like cytoskeletal protein, absent in Duchenne muscular dystrophy patients. Dystrophin binds to intracellular actin cables. In this way, the dystroglycan complex, which links the extracellular matrix to the intracellular actin cables, is thought to provide structural integrity in muscle tissues. The dystroglycan complex is also known to serve as an agrin receptor in muscle, where it may regulate agrin-induced acetylcholine receptor clustering at the neuromuscular junction. There is also evidence which suggests the function of dystroglycan as a part of the signal transduction pathway because it is shown that Grb2, a mediator of the Ras-related signal pathway, can interact with the cytoplasmic domain of dystroglycan. In general, aberrant expression of dystrophin-associated protein complex underlies the pathogenesis of Duchenne muscular dystrophy, Becker muscular dystrophy and severe childhood autosomal recessive muscular dystrophy. Interestingly, no genetic disease has been described for either [alpha]- or [beta]-dystroglycan. Dystroglycan is widely distributed in non-muscle tissues as well as in muscle tissues. During epithelial morphogenesis of kidney, the dystroglycan complex is shown to act as a receptor for the basement membrane. Dystroglycan expression in Mus musculus brain and neural retina has also been reported. However, the physiological role of dystroglycan in non-muscle tissues has remained unclear [].; PDB: 1EG4_P.
Probab=94.94  E-value=0.0069  Score=65.92  Aligned_cols=92  Identities=11%  Similarity=0.047  Sum_probs=0.0

Q ss_pred             EEEEEeccccCCc---chHHHHHHHHHhccC-cccccEEEeceecCCCCCcEEEEEEeecCCcccchHHHHHHHHHhccC
Q 002185          735 VGLRLSVALYTFF---PLVSELAGEIAAGVF-MKQSQVRIIGANAAEQPDKTVVLTDLVPLGEKFDNTTAFLTYQRFWHK  810 (955)
Q Consensus       735 V~LRLRSPSFSfF---Py~SELEsELASgL~-L~vSQV~I~Nf~wesgPrkL~VtLdLFPsGdsFNnTEAsrI~srL~nq  810 (955)
                      +.++|+...-+|.   -+...|-+.||..|| -+.++|.|.++.  .|.-.+.|+=+-.+. +.=++.++.++..+|...
T Consensus         3 F~~~l~~d~~~f~~dv~~ki~lVekLA~~~GD~nts~ItV~sIt--~gstiVtwtNnTLp~-~~CP~eeI~~L~~~L~~~   79 (290)
T PF05454_consen    3 FSATLDIDYESFNNDVQRKILLVEKLARLFGDRNTSSITVRSIT--SGSTIVTWTNNTLPT-SPCPKEEIEKLRKRLVDD   79 (290)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             eEEEEcCCHHHhhhhHHHHHHHHHHHHHHhCCCCCCeEEEEEec--CCCEEEEEEcCCCCC-CCCCHHHHHHHHHHHhcC
Confidence            3445554422222   334458888898886 557899999987  221112332222221 223345566666655554


Q ss_pred             eeecC---CCCcC-CeeeeEEeC
Q 002185          811 QVVIK---SSYFG-DYEVLYVRY  829 (955)
Q Consensus       811 tV~i~---PSlFG-PYELL~ftY  829 (955)
                      .-...   -..|| .|.|.++++
T Consensus        80 ~g~~~~~f~~am~pef~V~svsv  102 (290)
T PF05454_consen   80 DGKPSQEFVRAMGPEFKVKSVSV  102 (290)
T ss_dssp             -----------------------
T ss_pred             CCCcCHHHHHHhCCCCceeEEEE
Confidence            32111   12355 466667665


No 7  
>PF12877 DUF3827:  Domain of unknown function (DUF3827);  InterPro: IPR024606 The function of the proteins in this entry is not currently known, but one of the human proteins (Q9HCM3 from SWISSPROT) has been implicated in pilocytic astrocytomas [, , ]. In the majority of cases of pilocytic astrocytomas a tandem duplication produces an in-frame fusion of the gene encoding this protein and the BRAF oncogene. The resulting fusion protein has constitutive BRAF kinase activity and is capable of transforming cells. 
Probab=94.81  E-value=0.13  Score=61.23  Aligned_cols=47  Identities=15%  Similarity=0.163  Sum_probs=35.2

Q ss_pred             cEEEeceecCCCCC-cEEEEEEee-cCCcccchHHHHHHHHHhccCeee
Q 002185          767 QVRIIGANAAEQPD-KTVVLTDLV-PLGEKFDNTTAFLTYQRFWHKQVV  813 (955)
Q Consensus       767 QV~I~Nf~wesgPr-kL~VtLdLF-PsGdsFNnTEAsrI~srL~nqtV~  813 (955)
                      -|.+.+.....|.+ -++++-.+- ..|+.+..+++-++...+..|++.
T Consensus       191 tVQmV~~sRl~G~~nP~EL~YyV~~~~G~pl~a~~AA~~Ln~ld~Q~~A  239 (684)
T PF12877_consen  191 TVQMVNMSRLEGPDNPVELTYYVEGQNGKPLPAVTAAKDLNLLDSQRMA  239 (684)
T ss_pred             EEEEEEeeeccCCCCceEEEEEEEcCCCcCCcHHHHHHHHhccCHHHHH
Confidence            34455555555443 477776677 689999999999999999999884


No 8  
>PF04478 Mid2:  Mid2 like cell wall stress sensor;  InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region. The remainder of the protein sequence is serine-rich and of low complexity, and is therefore impossible to align accurately. Mid2 is thought to act as a mechanosensor of cell wall stress. The C-terminal cytoplasmic region of Mid2 is known to interact with Rom2, a guanine nucleotide exchange factor (GEF) for Rho1, which is part of the cell wall integrity signalling pathway [].
Probab=93.80  E-value=0.018  Score=58.03  Aligned_cols=18  Identities=11%  Similarity=0.080  Sum_probs=12.3

Q ss_pred             CCCcceehhhHHHHHHHH
Q 002185          875 LSGGMIAIVVLSAFVAVV  892 (955)
Q Consensus       875 LSkGaIAGIVLGSVVlVV  892 (955)
                      -++.+|||+|||..+.+|
T Consensus        46 knknIVIGvVVGVGg~il   63 (154)
T PF04478_consen   46 KNKNIVIGVVVGVGGPIL   63 (154)
T ss_pred             CCccEEEEEEecccHHHH
Confidence            355789999998544443


No 9  
>PF01299 Lamp:  Lysosome-associated membrane glycoprotein (Lamp);  InterPro: IPR002000 Lysosome-associated membrane glycoproteins (lamp) [] are integral membrane proteins, specific to lysosomes, and whose exact biological function is not yet clear. Structurally, the lamp proteins consist of two internally homologous lysosome-luminal domains separated by a proline-rich hinge region; at the C-terminal extremity there is a transmembrane region (TM) followed by a very short cytoplasmic tail (C). In each of the duplicated domains, there are two conserved disulphide bonds. This structure is schematically represented in the figure below.   +-----+ +-----+ +-----+ +-----+ | | | | | | | | xCxxxxxCxxxxxxxxxxxxCxxxxxCxxxxxxxxxCxxxxxCxxxxxxxxxxxxCxxxxxCxxxxxxxx +--------------------------++Hinge++--------------------------++TM++C+  In mammals, there are two closely related types of lamp: lamp-1 and lamp-2, which form major components of the lysosome membrane. In chicken lamp-1 is known as LEP100.  Also included in this entry is the macrophage protein CD68 (or macrosialin) [] is a heavily glycosylated integral membrane protein whose structure consists of a mucin-like domain followed by a proline-rich hinge; a single lamp-like domain; a transmembrane region and a short cytoplasmic tail.   Similar to CD68, mammalian lamp-3, which is expressed in lymphoid organs, dendritic cells and in lung, contains all the C-terminal regions but lacks the N-terminal lamp-like region []. In a lamp-family protein from nematodes [] only the part C-terminal to the hinge is conserved. ; GO: 0016020 membrane
Probab=91.99  E-value=0.074  Score=57.24  Aligned_cols=32  Identities=16%  Similarity=0.088  Sum_probs=24.0

Q ss_pred             cceehhhHHHHHHHHHHHHHHHHHHHhhcccc
Q 002185          878 GMIAIVVLSAFVAVVLCSAAAWVLLFKYKSHA  909 (955)
Q Consensus       878 GaIAGIVLGSVVlVVLLsAaa~LLLLRRRRR~  909 (955)
                      ..||-|+||+++++|+|++++.||+.|||++.
T Consensus       270 ~~~vPIaVG~~La~lvlivLiaYli~Rrr~~~  301 (306)
T PF01299_consen  270 SDLVPIAVGAALAGLVLIVLIAYLIGRRRSRA  301 (306)
T ss_pred             cchHHHHHHHHHHHHHHHHHHhheeEeccccc
Confidence            57888999988877777777777776666654


No 10 
>PF07213 DAP10:  DAP10 membrane protein;  InterPro: IPR009861 This family consists of several mammalian DAP10 membrane proteins. In activated mouse natural killer (NK) cells, the NKG2D receptor associates with two intracellular adaptors, DAP10 and DAP12, which trigger phosphatidyl inositol 3 kinase (PI3K) and Syk family protein tyrosine kinases, respectively. It has been suggested that the DAP10-PI3K pathway is sufficient to initiate NKG2D-mediated killing of target cells [].
Probab=91.90  E-value=0.11  Score=47.85  Aligned_cols=38  Identities=24%  Similarity=0.309  Sum_probs=29.5

Q ss_pred             CCCCCcceehhhHHHHHHHHHHHHHHHHHHHhhcccccc
Q 002185          873 YGLSGGMIAIVVLSAFVAVVLCSAAAWVLLFKYKSHACQ  911 (955)
Q Consensus       873 kgLSkGaIAGIVLGSVVlVVLLsAaa~LLLLRRRRR~sq  911 (955)
                      ..++.|+.+|||+|=+++.+++++++++|. |.|+|.+|
T Consensus        29 ~~ls~g~LaGiV~~D~vlTLLIv~~vy~ca-r~r~r~~~   66 (79)
T PF07213_consen   29 YPLSPGLLAGIVAADAVLTLLIVLVVYYCA-RPRRRPTQ   66 (79)
T ss_pred             cccCHHHHHHHHHHHHHHHHHHHHHHHhhc-ccccCCcc
Confidence            568999999999999999999888876664 44444443


No 11 
>PF13908 Shisa:  Wnt and FGF inhibitory regulator
Probab=91.31  E-value=0.13  Score=51.41  Aligned_cols=16  Identities=19%  Similarity=0.285  Sum_probs=8.3

Q ss_pred             CCCcceehhhHHHHHH
Q 002185          875 LSGGMIAIVVLSAFVA  890 (955)
Q Consensus       875 LSkGaIAGIVLGSVVl  890 (955)
                      +..++|+||++|+|++
T Consensus        76 ~~~~iivgvi~~Vi~I   91 (179)
T PF13908_consen   76 FITGIIVGVICGVIAI   91 (179)
T ss_pred             ceeeeeeehhhHHHHH
Confidence            3445566655554443


No 12 
>PF15102 TMEM154:  TMEM154 protein family
Probab=91.29  E-value=0.13  Score=51.78  Aligned_cols=37  Identities=11%  Similarity=0.222  Sum_probs=21.8

Q ss_pred             CCCcceehhhHHHHHHHHHHHHHHHHHHHhhcccccc
Q 002185          875 LSGGMIAIVVLSAFVAVVLCSAAAWVLLFKYKSHACQ  911 (955)
Q Consensus       875 LSkGaIAGIVLGSVVlVVLLsAaa~LLLLRRRRR~sq  911 (955)
                      .....|+.|+|..|+++++|+.+++++++.||||.++
T Consensus        53 ~q~efiLmIlIP~VLLvlLLl~vV~lv~~~kRkr~K~   89 (146)
T PF15102_consen   53 SQLEFILMILIPLVLLVLLLLSVVCLVIYYKRKRTKQ   89 (146)
T ss_pred             CCcceEEEEeHHHHHHHHHHHHHHHheeEEeecccCC
Confidence            3445577777777777666666655554444444433


No 13 
>PF02439 Adeno_E3_CR2:  Adenovirus E3 region protein CR2;  InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host []. This region called CR1 (conserved region 1) [] is found three times in Human adenovirus 19 (a subgroup D adenovirus) 49 kDa protein in the E3 region. CR1 is also found in the 20.1 Kd protein of subgroup B adenoviruses. The function of this 80 amino acid region is unknown. This region is probably a divergent immunoglobulin domain.
Probab=90.71  E-value=0.33  Score=39.56  Aligned_cols=29  Identities=14%  Similarity=0.305  Sum_probs=17.5

Q ss_pred             ehhhHHHHHHHHHHHHHHHHHHHhhcccc
Q 002185          881 AIVVLSAFVAVVLCSAAAWVLLFKYKSHA  909 (955)
Q Consensus       881 AGIVLGSVVlVVLLsAaa~LLLLRRRRR~  909 (955)
                      ++|++|.++++++++..+++++.++||.+
T Consensus         6 IaIIv~V~vg~~iiii~~~~YaCcykk~~   34 (38)
T PF02439_consen    6 IAIIVAVVVGMAIIIICMFYYACCYKKHR   34 (38)
T ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHcccc
Confidence            46666777777666666555545555433


No 14 
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=90.18  E-value=0.37  Score=46.27  Aligned_cols=13  Identities=23%  Similarity=0.074  Sum_probs=6.8

Q ss_pred             CCCCccCccCCCc
Q 002185          916 PQSLQTSHVKPSV  928 (955)
Q Consensus       916 ~~pFaSs~~K~SG  928 (955)
                      .--...|+...++
T Consensus        33 P~~gt~w~~pp~~   45 (130)
T PF12273_consen   33 PIYGTRWMAPPSY   45 (130)
T ss_pred             CcCCceecCCCCC
Confidence            3345666664444


No 15 
>PF12768 Rax2:  Cortical protein marker for cell polarity
Probab=90.13  E-value=0.31  Score=52.97  Aligned_cols=31  Identities=19%  Similarity=0.295  Sum_probs=22.2

Q ss_pred             cCCCCCcceehhhHHHHHHHHHHHHHHHHHH
Q 002185          872 KYGLSGGMIAIVVLSAFVAVVLCSAAAWVLL  902 (955)
Q Consensus       872 KkgLSkGaIAGIVLGSVVlVVLLsAaa~LLL  902 (955)
                      ++++++|.+|+|.+++.+++++|++++.+++
T Consensus       221 ~~~l~~G~VVlIslAiALG~v~ll~l~Gii~  251 (281)
T PF12768_consen  221 GKKLSRGFVVLISLAIALGTVFLLVLIGIIL  251 (281)
T ss_pred             cccccceEEEEEehHHHHHHHHHHHHHHHHH
Confidence            5899999999998887666655555544443


No 16 
>PF08693 SKG6:  Transmembrane alpha-helix domain;  InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ]. This entry represents the highly conserved transmembrane alpha-helical domain found in these proteins [, ]. The full-length AXL2 protein has a negative regulatory function in cytokinesis [].
Probab=89.04  E-value=0.14  Score=41.93  Aligned_cols=8  Identities=0%  Similarity=0.347  Sum_probs=3.2

Q ss_pred             HHHHhhcc
Q 002185          900 VLLFKYKS  907 (955)
Q Consensus       900 LLLLRRRR  907 (955)
                      |+++|||+
T Consensus        32 l~~~~rR~   39 (40)
T PF08693_consen   32 LFFWYRRK   39 (40)
T ss_pred             hheEEecc
Confidence            34334443


No 17 
>PF04689 S1FA:  DNA binding protein S1FA;  InterPro: IPR006779  S1FA is an unusual small plant peptide of only 70 amino acids with a basic domain which contains a nuclear localization signal and a putative DNA binding helix. S1FA is highly conserved between dicotyledonous and monocotyledonous plants and may be a DNA-binding protein that specifically recognises the negative promoter element S1F [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=88.68  E-value=0.77  Score=41.30  Aligned_cols=35  Identities=23%  Similarity=0.495  Sum_probs=25.1

Q ss_pred             ccCCCCCcceehhhHHHHHHHHHHHHHHHHHHHhhc
Q 002185          871 QKYGLSGGMIAIVVLSAFVAVVLCSAAAWVLLFKYK  906 (955)
Q Consensus       871 kKkgLSkGaIAGIVLGSVVlVVLLsAaa~LLLLRRR  906 (955)
                      +.+|+|-|+|+-|+||+++++.++--.+ ++++.||
T Consensus         6 ~~KGlnPGlIVLlvV~g~ll~flvGnyv-lY~Yaqk   40 (69)
T PF04689_consen    6 EAKGLNPGLIVLLVVAGLLLVFLVGNYV-LYVYAQK   40 (69)
T ss_pred             cccCCCCCeEEeehHHHHHHHHHHHHHH-HHHHHhh
Confidence            4689999999999999877766554444 4444443


No 18 
>PF02480 Herpes_gE:  Alphaherpesvirus glycoprotein E;  InterPro: IPR003404 Glycoprotein E (gE) of Alphaherpesvirus forms a complex with glycoprotein I (gI), functioning as an immunoglobulin G (IgG) Fc binding protein. gE is involved in virus spread but is not essential for propagation [].; GO: 0016020 membrane; PDB: 2GJ7_F 2GIY_B.
Probab=88.40  E-value=0.14  Score=58.60  Aligned_cols=38  Identities=24%  Similarity=0.301  Sum_probs=0.0

Q ss_pred             CCCcceehhhHHHHHHHHHHHHHHHHHHHhhccccccc
Q 002185          875 LSGGMIAIVVLSAFVAVVLCSAAAWVLLFKYKSHACQA  912 (955)
Q Consensus       875 LSkGaIAGIVLGSVVlVVLLsAaa~LLLLRRRRR~sqa  912 (955)
                      ....+++++++|++++++++++++|+|++|||||+...
T Consensus       349 ~~~~~~l~vVlgvavlivVv~viv~vc~~~rrrR~~~~  386 (439)
T PF02480_consen  349 SRGAALLGVVLGVAVLIVVVGVIVWVCLRCRRRRRQRD  386 (439)
T ss_dssp             --------------------------------------
T ss_pred             CcccchHHHHHHHHHHHHHHHHHhheeeeehhcccccc
Confidence            34456777777888888888888888876666554433


No 19 
>PF10873 DUF2668:  Protein of unknown function (DUF2668);  InterPro: IPR022640  Members in this family of proteins are annotated as cysteine and tyrosine-rich protein 1, however currently no function is known []. 
Probab=87.30  E-value=0.59  Score=47.44  Aligned_cols=27  Identities=26%  Similarity=0.197  Sum_probs=21.4

Q ss_pred             CCCCCcceehhhHHHHHHHHHHHHHHH
Q 002185          873 YGLSGGMIAIVVLSAFVAVVLCSAAAW  899 (955)
Q Consensus       873 kgLSkGaIAGIVLGSVVlVVLLsAaa~  899 (955)
                      ..+++.+|+|||.|.|+++.++.++++
T Consensus        56 ~~lsgtAIaGIVfgiVfimgvva~i~i   82 (155)
T PF10873_consen   56 DVLSGTAIAGIVFGIVFIMGVVAGIAI   82 (155)
T ss_pred             cccccceeeeeehhhHHHHHHHHHHHH
Confidence            457899999999999888877766643


No 20 
>PF02009 Rifin_STEVOR:  Rifin/stevor family;  InterPro: IPR002858 Malaria is still a major cause of mortality in many areas of the world. Plasmodium falciparum causes the most severe human form of the disease and is responsible for most fatalities. Severe cases of malaria can occur when the parasite invades and then proliferates within red blood cell erythrocytes. The parasite produces many variant antigenic proteins, encoded by multigene families, which are present on the surface of the infected erythrocyte and play important roles in virulence. A crucial survival mechanism for the malaria parasite is its ability to evade the immune response by switching these variant surface antigens. The high virulence of P. falciparum relative to other malarial parasites is in large part due to the fact that in this organism many of these surface antigens mediate the binding of infected erythrocytes to the vascular endothelium (cytoadherence) and non-infected erythrocytes (rosetting). This can lead to the accumulation of infected cells in the vasculature of a variety of organs, blocking the blood flow and reducing the oxygen supply. Clinical symptoms of severe infection can include fever, progressive anaemia, multi-organ dysfunction and coma. For more information see []. Several multicopy gene families have been described in Plasmodium falciparum, including the stevor family of subtelomeric open reading frames and the rif interspersed repetitive elements. Both families contain three predicted transmembrane segments. It has been proposed that stevor and rif are members of a larger superfamily that code for variant surface antigens [].
Probab=84.47  E-value=0.71  Score=50.93  Aligned_cols=23  Identities=9%  Similarity=0.280  Sum_probs=14.5

Q ss_pred             HHHHHHHHHHHHHHHHhhccccc
Q 002185          888 FVAVVLCSAAAWVLLFKYKSHAC  910 (955)
Q Consensus       888 VVlVVLLsAaa~LLLLRRRRR~s  910 (955)
                      ++++++|+.+++||+||+||+++
T Consensus       264 aIliIVLIMvIIYLILRYRRKKK  286 (299)
T PF02009_consen  264 AILIIVLIMVIIYLILRYRRKKK  286 (299)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhh
Confidence            34445556666788888777544


No 21 
>PF12301 CD99L2:  CD99 antigen like protein 2;  InterPro: IPR022078  This family of proteins is found in eukaryotes. Proteins in this family are typically between 165 and 237 amino acids in length. CD99L2 and CD99 are involved in trans-endothelial migration of neutrophils in vitro and in the recruitment of neutrophils into inflamed peritoneum. 
Probab=82.89  E-value=1.3  Score=45.48  Aligned_cols=35  Identities=29%  Similarity=0.281  Sum_probs=19.9

Q ss_pred             ccCCCCCcceehhhHHHHHHHHHHHHHHHHHHHhhcc
Q 002185          871 QKYGLSGGMIAIVVLSAFVAVVLCSAAAWVLLFKYKS  907 (955)
Q Consensus       871 kKkgLSkGaIAGIVLGSVVlVVLLsAaa~LLLLRRRR  907 (955)
                      .......|+|+|||- +|+++ |+-++.-|+.++|||
T Consensus       108 ~~~~~~~g~IaGIvs-av~va-lvGAvsSyiaYqkKK  142 (169)
T PF12301_consen  108 QDGEAEAGTIAGIVS-AVVVA-LVGAVSSYIAYQKKK  142 (169)
T ss_pred             cccCcccchhhhHHH-HHHHH-HHHHHHHHHHHHhhc
Confidence            356678899999883 33322 333333455555554


No 22 
>PF13908 Shisa:  Wnt and FGF inhibitory regulator
Probab=82.80  E-value=0.97  Score=45.26  Aligned_cols=26  Identities=8%  Similarity=0.004  Sum_probs=19.9

Q ss_pred             CCCCcceehhhHHHHHHHHHHHHHHH
Q 002185          874 GLSGGMIAIVVLSAFVAVVLCSAAAW  899 (955)
Q Consensus       874 gLSkGaIAGIVLGSVVlVVLLsAaa~  899 (955)
                      ...++++++|++|+|+++|+++++++
T Consensus        71 ~p~~~~~~~iivgvi~~Vi~Iv~~Iv   96 (179)
T PF13908_consen   71 DPPIYFITGIIVGVICGVIAIVVLIV   96 (179)
T ss_pred             CccccceeeeeeehhhHHHHHHHhHh
Confidence            34578899999999998877765544


No 23 
>PF01034 Syndecan:  Syndecan domain;  InterPro: IPR001050 The syndecans are transmembrane proteoglycans which are involved in the organisation of cytoskeleton and/or actin microfilaments, and have important roles as cell surface receptors during cell-cell and/or cell-matrix interactions [, ]. Structurally, these proteins consist of four separate domains:   A signal sequence; An extracellular domain (ectodomain) of variable length whose sequence is not evolutionary conserved in the various forms of syndecans. The ectodomain contains the sites of attachment of the heparan sulphate glycosaminoglycan side chains;  A transmembrane region;  A highly conserved cytoplasmic domain of about 30 to 35 residues, which could interact with cytoskeletal proteins.    The proteins known to belong to this family are:    Syndecan 1.  Syndecan 2 or fibroglycan.  Syndecan 3 or neuroglycan or N-syndecan.  Syndecan 4 or amphiglycan or ryudocan.  Drosophila syndecan.   Caenorhabditis elegans probable syndecan (F57C7.3).    Syndecan-4, a transmembrane heparan sulphate proteoglycan, is a coreceptor with integrins in cell adhesion. It has been suggested to form a ternary signalling complex with protein kinase Calpha and phosphatidylinositol 4,5-bisphosphate (PIP2). Structural studies have demonstrated that the cytoplasmic domain undergoes a conformational transition and forms a symmetric dimer in the presence of phospholipid activator PIP2, and whose overall structure in solution exhibits a twisted clamp shape having a cavity in the centre of dimeric interface. In addition, it has been observed that the syndecan-4 variable domain interacts, strongly, not only with fatty acyl groups but also the anionic head group of PIP2. These findings indicate that PIP2 promotes oligomerisation of the syndecan-4 cytoplasmic domain for transmembrane signalling and cell-matrix adhesion [, ].; GO: 0008092 cytoskeletal protein binding, 0016020 membrane; PDB: 1EJQ_B 1EJP_B 1YBO_C 1OBY_Q.
Probab=82.36  E-value=0.41  Score=42.71  Aligned_cols=43  Identities=16%  Similarity=0.093  Sum_probs=2.3

Q ss_pred             cCCCCCcceehhhHHHHHHHHHHHHHHHHHHHhhcccccccccC
Q 002185          872 KYGLSGGMIAIVVLSAFVAVVLCSAAAWVLLFKYKSHACQAEEV  915 (955)
Q Consensus       872 KkgLSkGaIAGIVLGSVVlVVLLsAaa~LLLLRRRRR~sqa~e~  915 (955)
                      +...-.++|+|+|+|.++++++++.+ ++.+.||.+....-.|.
T Consensus         7 ~~~vlaavIaG~Vvgll~ailLIlf~-iyR~rkkdEGSY~l~e~   49 (64)
T PF01034_consen    7 RSEVLAAVIAGGVVGLLFAILLILFL-IYRMRKKDEGSYDLDEP   49 (64)
T ss_dssp             -------------------------------S------SS--S-
T ss_pred             cchHHHHHHHHHHHHHHHHHHHHHHH-HHHHHhcCCCCccCCCC
Confidence            44556999999999887777766555 57778888765544443


No 24 
>PHA03265 envelope glycoprotein D; Provisional
Probab=82.18  E-value=0.78  Score=51.91  Aligned_cols=32  Identities=9%  Similarity=0.051  Sum_probs=17.3

Q ss_pred             CCcceehhhHHHHHHHHHHHHHHHHHHHhhcc
Q 002185          876 SGGMIAIVVLSAFVAVVLCSAAAWVLLFKYKS  907 (955)
Q Consensus       876 SkGaIAGIVLGSVVlVVLLsAaa~LLLLRRRR  907 (955)
                      +-+..+||+||..++-++++++++|++|||||
T Consensus       345 ~~~~~~g~~ig~~i~glv~vg~il~~~~rr~k  376 (402)
T PHA03265        345 SNSTFVGISVGLGIAGLVLVGVILYVCLRRKK  376 (402)
T ss_pred             CCCcccceEEccchhhhhhhhHHHHHHhhhhh
Confidence            34445566655544444455555555566655


No 25 
>PF06024 DUF912:  Nucleopolyhedrovirus protein of unknown function (DUF912);  InterPro: IPR009261 This entry is represented by Autographa californica nuclear polyhedrosis virus (AcMNPV), Orf78; it is a family of uncharacterised viral proteins.
Probab=81.32  E-value=0.48  Score=44.44  Aligned_cols=35  Identities=20%  Similarity=0.377  Sum_probs=17.9

Q ss_pred             CCcceehhhHHHHHHHHHHHHHHHHHHHhhccccc
Q 002185          876 SGGMIAIVVLSAFVAVVLCSAAAWVLLFKYKSHAC  910 (955)
Q Consensus       876 SkGaIAGIVLGSVVlVVLLsAaa~LLLLRRRRR~s  910 (955)
                      ...+|++++|+.++++|+|.++.+|.++|.|++..
T Consensus        60 ~~~iili~lls~v~IlVily~IyYFVILRer~~~~   94 (101)
T PF06024_consen   60 NGNIILISLLSFVCILVILYAIYYFVILRERQKSI   94 (101)
T ss_pred             cccchHHHHHHHHHHHHHHhhheEEEEEecccccc
Confidence            33444444555555555555555555556555443


No 26 
>PF14575 EphA2_TM:  Ephrin type-A receptor 2 transmembrane domain; PDB: 3KUL_A 2XVD_A 2VX1_A 2VWV_A 2VX0_A 2VWY_A 2VWZ_A 2VWW_A 2VWU_A 2VWX_A ....
Probab=80.53  E-value=0.64  Score=41.81  Aligned_cols=18  Identities=6%  Similarity=0.165  Sum_probs=7.9

Q ss_pred             eehhhHHHHHHHHHHHHH
Q 002185          880 IAIVVLSAFVAVVLCSAA  897 (955)
Q Consensus       880 IAGIVLGSVVlVVLLsAa  897 (955)
                      |+++++++++++++++++
T Consensus         2 ii~~~~~g~~~ll~~v~~   19 (75)
T PF14575_consen    2 IIASIIVGVLLLLVLVII   19 (75)
T ss_dssp             HHHHHHHHHHHHHHHHHH
T ss_pred             EEehHHHHHHHHHHhhee
Confidence            344444444444444443


No 27 
>PF08374 Protocadherin:  Protocadherin;  InterPro: IPR013585 The structure of protocadherins is similar to that of classic cadherins (IPR002126 from INTERPRO), but they also have some unique features associated with the cytoplasmic domains. They are expressed in a variety of organisms and are found in high concentrations in the brain where they seem to be localised mainly at cell-cell contact sites. Their expression seems to be developmentally regulated []. 
Probab=80.41  E-value=1.8  Score=46.28  Aligned_cols=19  Identities=5%  Similarity=0.193  Sum_probs=9.3

Q ss_pred             cceehhhHHHHHHHHHHHH
Q 002185          878 GMIAIVVLSAFVAVVLCSA  896 (955)
Q Consensus       878 GaIAGIVLGSVVlVVLLsA  896 (955)
                      .+++|||.|+++++|+|++
T Consensus        38 ~I~iaiVAG~~tVILVI~i   56 (221)
T PF08374_consen   38 KIMIAIVAGIMTVILVIFI   56 (221)
T ss_pred             eeeeeeecchhhhHHHHHH
Confidence            3455555555444444433


No 28 
>PF06697 DUF1191:  Protein of unknown function (DUF1191);  InterPro: IPR010605 This family contains hypothetical plant proteins of unknown function.
Probab=79.03  E-value=1.2  Score=49.04  Aligned_cols=26  Identities=12%  Similarity=-0.170  Sum_probs=13.9

Q ss_pred             cCCCCCcc-eehhhHHHHHHHHHHHHH
Q 002185          872 KYGLSGGM-IAIVVLSAFVAVVLCSAA  897 (955)
Q Consensus       872 KkgLSkGa-IAGIVLGSVVlVVLLsAa  897 (955)
                      +++++.|. |+|+++|.++++++++++
T Consensus       207 ~~~~~~W~iv~g~~~G~~~L~ll~~lv  233 (278)
T PF06697_consen  207 RKRSWWWKIVVGVVGGVVLLGLLSLLV  233 (278)
T ss_pred             CCcceeEEEEEEehHHHHHHHHHHHHH
Confidence            55566676 445566655544443333


No 29 
>PF06365 CD34_antigen:  CD34/Podocalyxin family;  InterPro: IPR013836 This family consists of several mammalian CD34 antigen proteins. The CD34 antigen is a human leukocyte membrane protein expressed specifically by lymphohematopoietic progenitor cells. CD34 is a phosphoprotein. Activation of protein kinase C (PKC) has been found to enhance CD34 phosphorylation [, ]. This family contains several eukaryotic podocalyxin proteins. Podocalyxin is a major membrane protein of the glomerular epithelium and is thought to be involved in maintenance of the architecture of the foot processes and filtration slits characteristic of this unique epithelium by virtue of its high negative charge. Podocalyxin functions as an anti-adhesin that maintains an open filtration pathway between neighbouring foot processes in the glomerular epithelium by charge repulsion [].
Probab=77.52  E-value=3.1  Score=44.02  Aligned_cols=29  Identities=14%  Similarity=0.009  Sum_probs=15.0

Q ss_pred             ceehhhHHHHHHHHHHHHHHHHHHHhhcc
Q 002185          879 MIAIVVLSAFVAVVLCSAAAWVLLFKYKS  907 (955)
Q Consensus       879 aIAGIVLGSVVlVVLLsAaa~LLLLRRRR  907 (955)
                      ++|+||+.+.+++++++++++||+++||.
T Consensus       101 ~lI~lv~~g~~lLla~~~~~~Y~~~~Rrs  129 (202)
T PF06365_consen  101 TLIALVTSGSFLLLAILLGAGYCCHQRRS  129 (202)
T ss_pred             EEEehHHhhHHHHHHHHHHHHHHhhhhcc
Confidence            66666655544444444444455555544


No 30 
>PF05827 ATP-synt_S1:  Vacuolar ATP synthase subunit S1 (ATP6S1);  InterPro: IPR024722 This family consists of metazoan vacuolar ATP synthase subunit S1 proteins [] and fungal proteins belonging to the BIG family. In Candida albicans BIG is required for normal beta-1,6-glucan synthesis, hyphal morphogenesis, adhesion and virulence [].
Probab=75.82  E-value=13  Score=39.60  Aligned_cols=100  Identities=19%  Similarity=0.168  Sum_probs=53.1

Q ss_pred             cccceEEEEEEeccccCCcch-------HHHHHHHHHhccCcccccEEEeceecCC--CCCcEEEEEEeecCC-cccchH
Q 002185          729 CVWPMQVGLRLSVALYTFFPL-------VSELAGEIAAGVFMKQSQVRIIGANAAE--QPDKTVVLTDLVPLG-EKFDNT  798 (955)
Q Consensus       729 CVyPItV~LRLRSPSFSfFPy-------~SELEsELASgL~L~vSQV~I~Nf~wes--gPrkL~VtLdLFPsG-dsFNnT  798 (955)
                      |.+|.--.+...+.+...+++       .++|+++|.+..+..+..|.+.+.....  ..+.-.+.|++=+.. ..-++.
T Consensus        67 ~~~p~L~~~~~~s~s~~~~~~v~~~~~~~~~L~~~l~~~c~~~~~~v~~~~~~~~~~~~~~~~vi~V~l~~l~~~~~~R~  146 (282)
T PF05827_consen   67 SAFPNLRRYLYSSSSSLVLPAVESGWLDLSQLAEYLKEKCGASVVIVDVSDLSEDSFEEYKPRVIRVDLPPLPSSSESRK  146 (282)
T ss_pred             CcchHHHHHHhcCCcceeeeeEecCccCHHHHHHHHHHHhCcCceEEecCccccccccccCCcEEEEECCCCCCccccch
Confidence            777765544444433333333       3588899998887765556555543221  112223444454422 225566


Q ss_pred             HHHHHHHHhccCeeecCCCCcCCeeeeEEeC
Q 002185          799 TAFLTYQRFWHKQVVIKSSYFGDYEVLYVRY  829 (955)
Q Consensus       799 EAsrI~srL~nqtV~i~PSlFGPYELL~ftY  829 (955)
                      ++++=.+.+..+-+...++-. +|.+||...
T Consensus       147 ~~L~~nD~~l~~vl~~l~s~~-~ytvIyts~  176 (282)
T PF05827_consen  147 EALSDNDEFLRKVLSKLPSPD-PYTVIYTST  176 (282)
T ss_pred             hhhhhhhHHHHHHHHhcCCCC-cEEEEEEcc
Confidence            666555544444333345555 798888764


No 31 
>PF05393 Hum_adeno_E3A:  Human adenovirus early E3A glycoprotein;  InterPro: IPR008652 This family consists of several early glycoproteins (E3A), from human adenovirus type 2.; GO: 0016021 integral to membrane
Probab=71.88  E-value=5.3  Score=38.04  Aligned_cols=34  Identities=6%  Similarity=0.088  Sum_probs=18.7

Q ss_pred             eehhhHHHHHHHHHHHHHHHHHHHhhcccccccc
Q 002185          880 IAIVVLSAFVAVVLCSAAAWVLLFKYKSHACQAE  913 (955)
Q Consensus       880 IAGIVLGSVVlVVLLsAaa~LLLLRRRRR~sqa~  913 (955)
                      -+||-.++|.++.+|+.+.||.+.++|||.++..
T Consensus        32 ~Lgm~~lvI~~iFil~VilwfvCC~kRkrsRrPI   65 (94)
T PF05393_consen   32 NLGMWFLVICGIFILLVILWFVCCKKRKRSRRPI   65 (94)
T ss_pred             ccchhHHHHHHHHHHHHHHHHHHHHHhhhccCCc
Confidence            3444455555555565666666566565555443


No 32 
>PTZ00046 rifin; Provisional
Probab=71.74  E-value=3.4  Score=46.98  Aligned_cols=21  Identities=14%  Similarity=0.319  Sum_probs=14.1

Q ss_pred             HHHHHHHHHHHHHHhhccccc
Q 002185          890 AVVLCSAAAWVLLFKYKSHAC  910 (955)
Q Consensus       890 lVVLLsAaa~LLLLRRRRR~s  910 (955)
                      ++++|+.+++||+||+||+.+
T Consensus       325 vVIVLIMvIIYLILRYRRKKK  345 (358)
T PTZ00046        325 VVIVLIMVIIYLILRYRRKKK  345 (358)
T ss_pred             HHHHHHHHHHHHHHHhhhcch
Confidence            334455667788888887654


No 33 
>TIGR01477 RIFIN variant surface antigen, rifin family. This model represents the rifin branch of the rifin/stevor family (pfam02009) of predicted variant surface antigens as found in Plasmodium falciparum. This model is based on a set of rifin sequences kindly provided by Matt Berriman from the Sanger Center. This is a global model and assesses a penalty for incomplete sequence. Additional fragmentary sequences may be found with the fragment model and a cutoff of 20 bits.
Probab=71.05  E-value=3.5  Score=46.73  Aligned_cols=29  Identities=10%  Similarity=0.269  Sum_probs=17.2

Q ss_pred             hhhHHHHH-HHHHHHHHHHHHHHhhccccc
Q 002185          882 IVVLSAFV-AVVLCSAAAWVLLFKYKSHAC  910 (955)
Q Consensus       882 GIVLGSVV-lVVLLsAaa~LLLLRRRRR~s  910 (955)
                      +|++++++ ++++|+.+++||+||+||+.+
T Consensus       311 ~IiaSiIAIvvIVLIMvIIYLILRYRRKKK  340 (353)
T TIGR01477       311 PIIASIIAILIIVLIMVIIYLILRYRRKKK  340 (353)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhhhcch
Confidence            34444333 334455667788888887654


No 34 
>PF03229 Alpha_GJ:  Alphavirus glycoprotein J;  InterPro: IPR004913 The exact function of the herpesvirus glycoprotein J is unknown, but it appears to play a role in the inhibition of apotosis of the host cell [].; GO: 0019050 suppression by virus of host apoptosis
Probab=69.30  E-value=6.3  Score=39.15  Aligned_cols=33  Identities=18%  Similarity=0.152  Sum_probs=21.8

Q ss_pred             CCCcceehhhHHHHHHHHHHHHHHHHHHHhhcc
Q 002185          875 LSGGMIAIVVLSAFVAVVLCSAAAWVLLFKYKS  907 (955)
Q Consensus       875 LSkGaIAGIVLGSVVlVVLLsAaa~LLLLRRRR  907 (955)
                      .-.+.|++.|||++.++++.++.+.+++.|++|
T Consensus        80 ~p~d~aLp~VIGGLcaL~LaamGA~~LLrR~cR  112 (126)
T PF03229_consen   80 PPVDFALPLVIGGLCALTLAAMGAGALLRRCCR  112 (126)
T ss_pred             CCcccchhhhhhHHHHHHHHHHHHHHHHHHHHH
Confidence            445678899999987776655555555544444


No 35 
>PHA03283 envelope glycoprotein E; Provisional
Probab=67.91  E-value=3.7  Score=48.58  Aligned_cols=44  Identities=16%  Similarity=0.274  Sum_probs=29.4

Q ss_pred             cceehhhHHHHHHHHHHHHHHHHHHHhhcccccccccCCCCCccC
Q 002185          878 GMIAIVVLSAFVAVVLCSAAAWVLLFKYKSHACQAEEVPQSLQTS  922 (955)
Q Consensus       878 GaIAGIVLGSVVlVVLLsAaa~LLLLRRRRR~sqa~e~~~pFaSs  922 (955)
                      .++++++||++++++++.+++|.|+ |+|++.++.-++-|+|...
T Consensus       399 ~l~~~~~~~~~~~~~~~~l~vw~c~-~~r~~~~~~y~ilnpf~~v  442 (542)
T PHA03283        399 YLAFLLAIICTCAALLVALVVWGCI-LYRRSNRKPYEVLNPFETV  442 (542)
T ss_pred             cchhHHHHHHHHHHHHHHHhhhhee-eehhhcCCcccccCCCccc
Confidence            4456677888888777777777774 5444445556777888664


No 36 
>TIGR01478 STEVOR variant surface antigen, stevor family. This model represents the stevor branch of the rifin/stevor family (pfam02009) of predicted variant surface antigens as found in Plasmodium falciparum. This model is based on a set of stevor sequences kindly provided by Matt Berriman from the Sanger Center. This is a global model and assesses a penalty for incomplete sequence. Additional fragmentary sequences may be found with the fragment model and a cutoff of 8 bits.
Probab=67.74  E-value=4.9  Score=44.66  Aligned_cols=6  Identities=17%  Similarity=0.175  Sum_probs=3.6

Q ss_pred             cccccc
Q 002185          727 CGCVWP  732 (955)
Q Consensus       727 C~CVyP  732 (955)
                      |.|-.|
T Consensus        44 ~Ecel~   49 (295)
T TIGR01478        44 AEIQRP   49 (295)
T ss_pred             hhhccc
Confidence            666555


No 37 
>PTZ00370 STEVOR; Provisional
Probab=66.08  E-value=5.5  Score=44.34  Aligned_cols=15  Identities=13%  Similarity=0.337  Sum_probs=5.5

Q ss_pred             HHHHHHHHHHHHHHH
Q 002185          889 VAVVLCSAAAWVLLF  903 (955)
Q Consensus       889 VlVVLLsAaa~LLLL  903 (955)
                      |++++.++++++++|
T Consensus       263 vllil~vvliilYiw  277 (296)
T PTZ00370        263 VLLILAVVLIILYIW  277 (296)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            333333333333333


No 38 
>PLN03150 hypothetical protein; Provisional
Probab=64.04  E-value=5.3  Score=47.32  Aligned_cols=33  Identities=21%  Similarity=0.199  Sum_probs=20.4

Q ss_pred             CCCCcceehhhHHHHHHHHHHHHHHHHHHHhhcc
Q 002185          874 GLSGGMIAIVVLSAFVAVVLCSAAAWVLLFKYKS  907 (955)
Q Consensus       874 gLSkGaIAGIVLGSVVlVVLLsAaa~LLLLRRRR  907 (955)
                      +++.+.|++|++|++++++++++++ ++++|||+
T Consensus       540 ~~~~~~~i~~~~~~~~~~l~~~~~~-~~~~~~r~  572 (623)
T PLN03150        540 HLSVGAKIGIAFGVSVAFLFLVICA-MCWWKRRQ  572 (623)
T ss_pred             cCCCceEEEEEhHHHHHHHHHHHHH-hhheeehh
Confidence            3457788888888887655554444 34344444


No 39 
>PF01102 Glycophorin_A:  Glycophorin A;  InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=63.49  E-value=7.8  Score=38.28  Aligned_cols=41  Identities=5%  Similarity=0.054  Sum_probs=19.5

Q ss_pred             CCCCCcceehhhHHHHHHHHH-HHHHHHHHHHhhcccccccc
Q 002185          873 YGLSGGMIAIVVLSAFVAVVL-CSAAAWVLLFKYKSHACQAE  913 (955)
Q Consensus       873 kgLSkGaIAGIVLGSVVlVVL-LsAaa~LLLLRRRRR~sqa~  913 (955)
                      ..+..++=.+.++|.++++++ ++++++|++|..||++++..
T Consensus        55 ~ql~h~fs~~~i~~Ii~gv~aGvIg~Illi~y~irR~~Kk~~   96 (122)
T PF01102_consen   55 SQLVHRFSEPAIIGIIFGVMAGVIGIILLISYCIRRLRKKSS   96 (122)
T ss_dssp             -SSSSSSS-TCHHHHHHHHHHHHHHHHHHHHHHHHHHS----
T ss_pred             cccccCccccceeehhHHHHHHHHHHHHHHHHHHHHHhccCC
Confidence            445556666666666666644 44444444455555555543


No 40 
>PF14575 EphA2_TM:  Ephrin type-A receptor 2 transmembrane domain; PDB: 3KUL_A 2XVD_A 2VX1_A 2VWV_A 2VX0_A 2VWY_A 2VWZ_A 2VWW_A 2VWU_A 2VWX_A ....
Probab=62.83  E-value=6.9  Score=35.33  Aligned_cols=25  Identities=16%  Similarity=0.357  Sum_probs=17.9

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHhhcc
Q 002185          883 VVLSAFVAVVLCSAAAWVLLFKYKS  907 (955)
Q Consensus       883 IVLGSVVlVVLLsAaa~LLLLRRRR  907 (955)
                      |++++++++++|+++++++++.+||
T Consensus         2 ii~~~~~g~~~ll~~v~~~~~~~rr   26 (75)
T PF14575_consen    2 IIASIIVGVLLLLVLVIIVIVCFRR   26 (75)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHCCCTT
T ss_pred             EEehHHHHHHHHHHhheeEEEEEee
Confidence            6777888888888877776654444


No 41 
>PRK08455 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=62.57  E-value=9.7  Score=39.34  Aligned_cols=28  Identities=21%  Similarity=0.367  Sum_probs=16.8

Q ss_pred             eehhhHHHHHHHHHHHHHHHHHHHhhcc
Q 002185          880 IAIVVLSAFVAVVLCSAAAWVLLFKYKS  907 (955)
Q Consensus       880 IAGIVLGSVVlVVLLsAaa~LLLLRRRR  907 (955)
                      ++.|+||.++++++..++++|+++..+.
T Consensus        19 l~~iIi~~~llll~~~G~~~~~~~~~~~   46 (182)
T PRK08455         19 LLIIIIGVVVLLLLIVGVIAMLLMGSKE   46 (182)
T ss_pred             eEEehHHHHHHHHHHHHHHHHHHhcCCC
Confidence            3334446666666666777777665443


No 42 
>PF05568 ASFV_J13L:  African swine fever virus J13L protein;  InterPro: IPR008385 This family consists of several African swine fever virus (ASFV) j13L proteins [, , ].
Probab=62.20  E-value=6.6  Score=40.44  Aligned_cols=28  Identities=7%  Similarity=0.172  Sum_probs=18.5

Q ss_pred             ehhhHHHHHHHHHHHHHHHHHHHhhccc
Q 002185          881 AIVVLSAFVAVVLCSAAAWVLLFKYKSH  908 (955)
Q Consensus       881 AGIVLGSVVlVVLLsAaa~LLLLRRRRR  908 (955)
                      ..|+||.+++++++++++.+|-.||||+
T Consensus        32 ~tILiaIvVliiiiivli~lcssRKkKa   59 (189)
T PF05568_consen   32 YTILIAIVVLIIIIIVLIYLCSSRKKKA   59 (189)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhhHHH
Confidence            4567777777777777666665555554


No 43 
>PF12877 DUF3827:  Domain of unknown function (DUF3827);  InterPro: IPR024606 The function of the proteins in this entry is not currently known, but one of the human proteins (Q9HCM3 from SWISSPROT) has been implicated in pilocytic astrocytomas [, , ]. In the majority of cases of pilocytic astrocytomas a tandem duplication produces an in-frame fusion of the gene encoding this protein and the BRAF oncogene. The resulting fusion protein has constitutive BRAF kinase activity and is capable of transforming cells. 
Probab=61.53  E-value=9.7  Score=46.29  Aligned_cols=70  Identities=16%  Similarity=0.018  Sum_probs=31.8

Q ss_pred             cCCCCCcceehhhHHHHHHHHHHHHHHHHHHHhhcccccccccCCCCCccCccCCCccccccccchHHHHH-HHhcc
Q 002185          872 KYGLSGGMIAIVVLSAFVAVVLCSAAAWVLLFKYKSHACQAEEVPQSLQTSHVKPSVVLIRLPCHLDLALQ-LIQGL  947 (955)
Q Consensus       872 KkgLSkGaIAGIVLGSVVlVVLLsAaa~LLLLRRRRR~sqa~e~~~pFaSs~~K~SG~~~~ls~~~dl~~q-~~qg~  947 (955)
                      ....+.|+|||+++..++++++|+.+. ++ ++||+|..=   .++.|.....|.-=-+.++. -||.|.| |||-+
T Consensus       264 s~~~NlWII~gVlvPv~vV~~Iiiil~-~~-LCRk~K~eF---qpDa~~niqqR~K~q~psVq-GFD~AKqHlGQ~~  334 (684)
T PF12877_consen  264 SPPNNLWIIAGVLVPVLVVLLIIIILY-WK-LCRKNKLEF---QPDAMSNIQQRQKPQAPSVQ-GFDYAKQHLGQHG  334 (684)
T ss_pred             CCCCCeEEEehHhHHHHHHHHHHHHHH-HH-HhcccccCC---CchhhhhcccccccCCCCcc-cccHHHHHhcccc
Confidence            345688999998654444333333322 22 233333221   23444433222221122222 4788866 55544


No 44 
>PF15050 SCIMP:  SCIMP protein
Probab=60.47  E-value=9.2  Score=38.27  Aligned_cols=38  Identities=8%  Similarity=0.157  Sum_probs=21.0

Q ss_pred             eehhhHHHHHHHHHHHHHHHHHHHhhcccccccccCCCC
Q 002185          880 IAIVVLSAFVAVVLCSAAAWVLLFKYKSHACQAEEVPQS  918 (955)
Q Consensus       880 IAGIVLGSVVlVVLLsAaa~LLLLRRRRR~sqa~e~~~p  918 (955)
                      +++.+++ ++++-+.++++.||+.|+..|.-+..+...+
T Consensus         9 WiiLAVa-II~vS~~lglIlyCvcR~~lRqGkkweiakp   46 (133)
T PF15050_consen    9 WIILAVA-IILVSVVLGLILYCVCRWQLRQGKKWEIAKP   46 (133)
T ss_pred             HHHHHHH-HHHHHHHHHHHHHHHHHHHHHccccceeccc
Confidence            3333443 4445555666778877766655555554433


No 45 
>KOG4818 consensus Lysosomal-associated membrane protein [General function prediction only]
Probab=60.31  E-value=8.6  Score=43.90  Aligned_cols=31  Identities=10%  Similarity=0.085  Sum_probs=20.4

Q ss_pred             CCcceehhhHHHHHHHHHHHHHHHHHHHhhc
Q 002185          876 SGGMIAIVVLSAFVAVVLCSAAAWVLLFKYK  906 (955)
Q Consensus       876 SkGaIAGIVLGSVVlVVLLsAaa~LLLLRRR  906 (955)
                      -.-+++=||||++++.+++++++.+||-|||
T Consensus       324 d~siv~PivVg~~l~gl~~~vliaylIgrr~  354 (362)
T KOG4818|consen  324 DLNIVLPIAVGAILAGLVLVVLIAYLIGRRR  354 (362)
T ss_pred             ccceecchHHHHHHHHHHHHHHHHhheehee
Confidence            3445666778877777777777777764333


No 46 
>PF14610 DUF4448:  Protein of unknown function (DUF4448)
Probab=60.06  E-value=4.3  Score=41.25  Aligned_cols=25  Identities=16%  Similarity=0.239  Sum_probs=14.5

Q ss_pred             CcceehhhHHHHHHHHHHHHHHHHH
Q 002185          877 GGMIAIVVLSAFVAVVLCSAAAWVL  901 (955)
Q Consensus       877 kGaIAGIVLGSVVlVVLLsAaa~LL  901 (955)
                      ++..+.|+|=.++++++++++++++
T Consensus       156 ~~~~laI~lPvvv~~~~~~~~~~~~  180 (189)
T PF14610_consen  156 GKYALAIALPVVVVVLALIMYGFFF  180 (189)
T ss_pred             cceeEEEEccHHHHHHHHHHHhhhe
Confidence            5556666666666665555554444


No 47 
>PF14828 Amnionless:  Amnionless
Probab=59.79  E-value=42  Score=39.11  Aligned_cols=20  Identities=20%  Similarity=0.253  Sum_probs=13.8

Q ss_pred             ceehhhHHHHHHHHHHHHHH
Q 002185          879 MIAIVVLSAFVAVVLCSAAA  898 (955)
Q Consensus       879 aIAGIVLGSVVlVVLLsAaa  898 (955)
                      .|+++++|++++++++++++
T Consensus       339 ~v~~~vl~~Lllv~ll~~~~  358 (437)
T PF14828_consen  339 TVVGIVLGCLLLVALLFGVI  358 (437)
T ss_pred             eeeeehHHHHHHHHHHHHhh
Confidence            68888888877665555543


No 48 
>PF12259 DUF3609:  Protein of unknown function (DUF3609);  InterPro: IPR022048  This domain family is found in eukaryotes and viruses, and is typically between 348 and 360 amino acids in length. 
Probab=59.68  E-value=6.4  Score=44.58  Aligned_cols=29  Identities=21%  Similarity=0.363  Sum_probs=19.3

Q ss_pred             eehhhHHHHHHHHHHHHHHHHHHHhhccc
Q 002185          880 IAIVVLSAFVAVVLCSAAAWVLLFKYKSH  908 (955)
Q Consensus       880 IAGIVLGSVVlVVLLsAaa~LLLLRRRRR  908 (955)
                      ++..|.|++++++++++++||+.+.+||+
T Consensus       299 ~~i~v~~~~vli~vl~~~~~~~~~~~~~~  327 (361)
T PF12259_consen  299 VHIAVCGAIVLIIVLISLAWLYRTFRRRQ  327 (361)
T ss_pred             EEEehhHHHHHHHHHHHHHhheeehHHHH
Confidence            44456777777788888888875544443


No 49 
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms]
Probab=59.35  E-value=15  Score=45.96  Aligned_cols=13  Identities=0%  Similarity=-0.412  Sum_probs=10.3

Q ss_pred             CcEEEEEEeecCC
Q 002185          780 DKTVVLTDLVPLG  792 (955)
Q Consensus       780 rkL~VtLdLFPsG  792 (955)
                      ..|+..|+.|..+
T Consensus       472 ~ildYEvky~ek~  484 (996)
T KOG0196|consen  472 VILDYEVKYYEKD  484 (996)
T ss_pred             cceeEEEEEeecc
Confidence            3589999999954


No 50 
>PF12768 Rax2:  Cortical protein marker for cell polarity
Probab=59.07  E-value=9  Score=42.00  Aligned_cols=38  Identities=11%  Similarity=0.093  Sum_probs=27.1

Q ss_pred             cCCCCCcceehhhHHHHHHHHHHHHHHHHHHHhhccccc
Q 002185          872 KYGLSGGMIAIVVLSAFVAVVLCSAAAWVLLFKYKSHAC  910 (955)
Q Consensus       872 KkgLSkGaIAGIVLGSVVlVVLLsAaa~LLLLRRRRR~s  910 (955)
                      .+++=-.+-++|+||++++++++ ++++.+++|||+++.
T Consensus       225 ~~G~VVlIslAiALG~v~ll~l~-Gii~~~~~r~~~~~~  262 (281)
T PF12768_consen  225 SRGFVVLISLAIALGTVFLLVLI-GIILAYIRRRRQGYV  262 (281)
T ss_pred             cceEEEEEehHHHHHHHHHHHHH-HHHHHHHHhhhccCc
Confidence            45666778889999888766654 666777788766544


No 51 
>PF05084 GRA6:  Granule antigen protein (GRA6);  InterPro: IPR008119  Toxoplasma gondii is an obligate intracellular apicomplexan protozoan parasite, with a complex lifestyle involving varied hosts []. It has two phases of growth: an intestinal phase in feline hosts, and an extra-intestinal phase in other mammals. Oocysts from infected cats develop into tachyzoites, and eventually, bradyzoites and zoitocysts in the extraintestinal host []. Transmission of the parasite occurs through contact with infected cats or raw/undercooked meat; in immunocompromised individuals, it can cause severe and often lethal toxoplasmosis. Acute infection in healthy humans can sometimes also cause tissue damage [].  The protozoan utilises a variety of secretory and antigenic proteins to invade a host and gain access to the intracellular environment []. These originate from distinct organelles in the T. gondii cell termed micronemes, rhoptries, and dense granules. They are released at specific times during invasion to ensure the proteins are allocated to their correct target destinations []. Dense granule antigens (GRAs) are released from the T. gondii tachyzoite while still encapsulated in a host vacuole. Gra6, one of these moieties, is associated with the parasitophorous vacuole []. It possesses a hydrophobic central region flanked by two hydrophilic domains, and is present as a single copy gene in the Toxoplasma gondii genome []. Gra6 shares a similar function with Gra2, in that it is rapidly targeted to a network of membranous tubules that connect with the vacuolar membrane []. Indeed, these two proteins, together with Gra4, form a multimeric complex that stabilises the parasite within the vacuole.
Probab=57.88  E-value=12  Score=39.12  Aligned_cols=29  Identities=17%  Similarity=0.397  Sum_probs=18.6

Q ss_pred             hHHHHHHHHHHHHHHHHHHHhhcccccccc
Q 002185          884 VLSAFVAVVLCSAAAWVLLFKYKSHACQAE  913 (955)
Q Consensus       884 VLGSVVlVVLLsAaa~LLLLRRRRR~sqa~  913 (955)
                      +||++++++.+.++.|++ +||+.|++..+
T Consensus       153 ~IG~~VlA~~VA~L~~~F-~RR~~rrsppe  181 (215)
T PF05084_consen  153 LIGAVVLAVSVAMLTWFF-LRRTGRRSPPE  181 (215)
T ss_pred             HHHHHHHHHHHHHHHHHH-HHhhccCCCCC
Confidence            456777777777777777 45555555443


No 52 
>PF15345 TMEM51:  Transmembrane protein 51
Probab=56.84  E-value=7.9  Score=41.95  Aligned_cols=26  Identities=15%  Similarity=0.207  Sum_probs=13.7

Q ss_pred             eehhhHHHHHHHHHHHHHHHHHHHhhcc
Q 002185          880 IAIVVLSAFVAVVLCSAAAWVLLFKYKS  907 (955)
Q Consensus       880 IAGIVLGSVVlVVLLsAaa~LLLLRRRR  907 (955)
                      ||-++||+  ++++|++.+|++++.|||
T Consensus        60 VAyVLVG~--Gv~LLLLSICL~IR~KRr   85 (233)
T PF15345_consen   60 VAYVLVGS--GVALLLLSICLSIRDKRR   85 (233)
T ss_pred             EEEehhhH--HHHHHHHHHHHHHHHHHH
Confidence            33334555  555555666777554443


No 53 
>PF12191 stn_TNFRSF12A:  Tumour necrosis factor receptor stn_TNFRSF12A_TNFR domain;  InterPro: IPR022316 The tumour necrosis factor (TNF) receptor (TNFR) superfamily comprises more than 20 type-I transmembrane proteins. Family members are defined based on similarity in their extracellular domain - a region that contains many cysteine residues arranged in a specific repetitive pattern []. The cysteines allow formation of an extended rod-like structure, responsible for ligand binding []. Upon receptor activation, different intracellular signalling complexes are assembled for different members of the TNFR superfamily, depending on their intracellular domains and sequences []. Activation of TNFRs can therefore induce a range of disparate effects, including cell proliferation, differentiation, survival, or apoptotic cell death, depending upon the receptor involved []. TNFRs are widely distributed and play important roles in many crucial biological processes, such as lymphoid and neuronal development, innate and adaptive immunity, and maintenance of cellular homeostasis []. Drugs that manipulate their signalling have potential roles in the prevention and treatment of many diseases, such as viral infections, coronary heart disease, transplant rejection, and immune disease []. TNF receptor 12 (also known as TWEAK receptor, and fibroblast growth factor-inducible-14 (Fn14)) has been implicated in endothelial cell growth and migration []. The receptor may also play a role in cell-matrix interactions [].; PDB: 2KN0_A 2RPJ_A 2KMZ_A 2EQP_A.
Probab=56.82  E-value=3.8  Score=40.93  Aligned_cols=13  Identities=15%  Similarity=0.018  Sum_probs=0.0

Q ss_pred             hHHHHHHHHHHHH
Q 002185          884 VLSAFVAVVLCSA  896 (955)
Q Consensus       884 VLGSVVlVVLLsA  896 (955)
                      .++++++++.+++
T Consensus        84 sal~v~lVl~lls   96 (129)
T PF12191_consen   84 SALSVVLVLALLS   96 (129)
T ss_dssp             -------------
T ss_pred             hHHHHHHHHHHHH
Confidence            3334444433333


No 54 
>PF15099 PIRT:  Phosphoinositide-interacting protein family
Probab=55.23  E-value=7  Score=39.17  Aligned_cols=35  Identities=26%  Similarity=0.278  Sum_probs=20.0

Q ss_pred             cceehhh-HHHHHHHHHHHHHHHHHHHhhccccccc
Q 002185          878 GMIAIVV-LSAFVAVVLCSAAAWVLLFKYKSHACQA  912 (955)
Q Consensus       878 GaIAGIV-LGSVVlVVLLsAaa~LLLLRRRRR~sqa  912 (955)
                      .-|+|.+ ++.-+++++|.+++|..++|||+++++.
T Consensus        80 ~~~~G~vlLs~GLmlL~~~alcW~~~~rkK~~kr~e  115 (129)
T PF15099_consen   80 ISIFGPVLLSLGLMLLACSALCWKPIIRKKKKKRRE  115 (129)
T ss_pred             hhhehHHHHHHHHHHHHhhhheehhhhHhHHHHhhh
Confidence            3466666 4444444555557777766666555444


No 55 
>PF04478 Mid2:  Mid2 like cell wall stress sensor;  InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region. The remainder of the protein sequence is serine-rich and of low complexity, and is therefore impossible to align accurately. Mid2 is thought to act as a mechanosensor of cell wall stress. The C-terminal cytoplasmic region of Mid2 is known to interact with Rom2, a guanine nucleotide exchange factor (GEF) for Rho1, which is part of the cell wall integrity signalling pathway [].
Probab=53.61  E-value=3.1  Score=42.61  Aligned_cols=23  Identities=13%  Similarity=0.121  Sum_probs=15.0

Q ss_pred             ccCCCCCcceehhhHHHHHHHHHH
Q 002185          871 QKYGLSGGMIAIVVLSAFVAVVLC  894 (955)
Q Consensus       871 kKkgLSkGaIAGIVLGSVVlVVLL  894 (955)
                      +.+.+=.|++|||-+..++ ++++
T Consensus        46 knknIVIGvVVGVGg~ill-~il~   68 (154)
T PF04478_consen   46 KNKNIVIGVVVGVGGPILL-GILA   68 (154)
T ss_pred             CCccEEEEEEecccHHHHH-HHHH
Confidence            3456788999997665554 4444


No 56 
>PF15330 SIT:  SHP2-interacting transmembrane adaptor protein, SIT
Probab=53.15  E-value=15  Score=35.45  Aligned_cols=28  Identities=29%  Similarity=0.343  Sum_probs=12.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhccccccc
Q 002185          885 LSAFVAVVLCSAAAWVLLFKYKSHACQA  912 (955)
Q Consensus       885 LGSVVlVVLLsAaa~LLLLRRRRR~sqa  912 (955)
                      ++.++++++|++++.++.||.++|.++.
T Consensus         4 l~il~llLll~l~asl~~wr~~~rq~k~   31 (107)
T PF15330_consen    4 LGILALLLLLSLAASLLAWRMKQRQKKA   31 (107)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhhccc
Confidence            3344444444444444445554444333


No 57 
>PF15069 FAM163:  FAM163 family
Probab=53.06  E-value=13  Score=37.81  Aligned_cols=13  Identities=15%  Similarity=0.156  Sum_probs=6.5

Q ss_pred             CcceehhhHHHHH
Q 002185          877 GGMIAIVVLSAFV  889 (955)
Q Consensus       877 kGaIAGIVLGSVV  889 (955)
                      +.+|.|.+|+.|+
T Consensus         5 TvVItGgILAtVI   17 (143)
T PF15069_consen    5 TVVITGGILATVI   17 (143)
T ss_pred             eEEEechHHHHHH
Confidence            3456665554333


No 58 
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=52.44  E-value=10  Score=36.56  Aligned_cols=13  Identities=0%  Similarity=-0.118  Sum_probs=5.2

Q ss_pred             HHHHHHHHhhccc
Q 002185          896 AAAWVLLFKYKSH  908 (955)
Q Consensus       896 Aaa~LLLLRRRRR  908 (955)
                      +++++|+.|||+|
T Consensus        16 ~~~~~~~~rRR~r   28 (130)
T PF12273_consen   16 LFLFYCHNRRRRR   28 (130)
T ss_pred             HHHHHHHHHHHhh
Confidence            3333444444433


No 59 
>PF10577 UPF0560:  Uncharacterised protein family UPF0560;  InterPro: IPR018890  This family of proteins has no known function. 
Probab=49.60  E-value=16  Score=45.34  Aligned_cols=29  Identities=7%  Similarity=0.079  Sum_probs=12.4

Q ss_pred             CCcceehhhHHHHHHHHHHHHHHHHHHHhh
Q 002185          876 SGGMIAIVVLSAFVAVVLCSAAAWVLLFKY  905 (955)
Q Consensus       876 SkGaIAGIVLGSVVlVVLLsAaa~LLLLRR  905 (955)
                      .+.++.+|. |+++++|+|++.+++|+.||
T Consensus       271 HT~fLl~IL-G~~~livl~lL~vLl~yCrr  299 (807)
T PF10577_consen  271 HTVFLLAIL-GGTALIVLILLCVLLCYCRR  299 (807)
T ss_pred             HHHHHHHHH-HHHHHHHHHHHHHHHHhhhc
Confidence            344455544 44444444444333443333


No 60 
>PF05545 FixQ:  Cbb3-type cytochrome oxidase component FixQ;  InterPro: IPR008621 This family consists of several Cbb3-type cytochrome oxidase components (FixQ/CcoQ). FixQ is found in nitrogen fixing bacteria. Since nitrogen fixation is an energy-consuming process, effective symbioses depend on operation of a respiratory chain with a high affinity for O2, closely coupled to ATP production. This requirement is fulfilled by a special three-subunit terminal oxidase (cytochrome terminal oxidase cbb3), which was first identified in Bradyrhizobium japonicum as the product of the fixNOQP operon [].
Probab=49.07  E-value=17  Score=29.98  Aligned_cols=21  Identities=5%  Similarity=-0.078  Sum_probs=10.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHhh
Q 002185          885 LSAFVAVVLCSAAAWVLLFKY  905 (955)
Q Consensus       885 LGSVVlVVLLsAaa~LLLLRR  905 (955)
                      ++.+++.++.+++++++++++
T Consensus        13 ~~~v~~~~~F~gi~~w~~~~~   33 (49)
T PF05545_consen   13 IGTVLFFVFFIGIVIWAYRPR   33 (49)
T ss_pred             HHHHHHHHHHHHHHHHHHccc
Confidence            344555555555554444433


No 61 
>PF15176 LRR19-TM:  Leucine-rich repeat family 19 TM domain
Probab=46.72  E-value=25  Score=34.26  Aligned_cols=27  Identities=33%  Similarity=0.311  Sum_probs=19.5

Q ss_pred             cCCCCCcceehhhHHHHHHHHHHHHHH
Q 002185          872 KYGLSGGMIAIVVLSAFVAVVLCSAAA  898 (955)
Q Consensus       872 KkgLSkGaIAGIVLGSVVlVVLLsAaa  898 (955)
                      +.+-+.-..||+||+++++.+++++++
T Consensus        12 ~~g~sW~~LVGVv~~al~~SlLIalaa   38 (102)
T PF15176_consen   12 EGGRSWPFLVGVVVTALVTSLLIALAA   38 (102)
T ss_pred             CCCcccHhHHHHHHHHHHHHHHHHHHH
Confidence            446678888998888877776665554


No 62 
>PF15065 NCU-G1:  Lysosomal transcription factor, NCU-G1
Probab=45.86  E-value=6.3  Score=44.65  Aligned_cols=36  Identities=17%  Similarity=0.164  Sum_probs=21.3

Q ss_pred             cCCCCCcceehhhHHH-HHHHHHHHHHHHHHHHhhcc
Q 002185          872 KYGLSGGMIAIVVLSA-FVAVVLCSAAAWVLLFKYKS  907 (955)
Q Consensus       872 KkgLSkGaIAGIVLGS-VVlVVLLsAaa~LLLLRRRR  907 (955)
                      ...+|.-+|++|++|- +-++++|++.+++|++|+|+
T Consensus       312 ~d~~S~lvi~i~~vgLG~P~l~li~Ggl~v~~~r~r~  348 (350)
T PF15065_consen  312 VDSFSPLVIMIMAVGLGVPLLLLILGGLYVCLRRRRK  348 (350)
T ss_pred             ccchhHHHHHHHHHHhhHHHHHHHHhhheEEEecccc
Confidence            4678888888888774 33444455555455444443


No 63 
>PF13584 BatD:  Oxygen tolerance
Probab=44.38  E-value=24  Score=40.07  Aligned_cols=18  Identities=11%  Similarity=-0.056  Sum_probs=13.6

Q ss_pred             CcccccceEEEEEEeccc
Q 002185          726 PCGCVWPMQVGLRLSVAL  743 (955)
Q Consensus       726 pC~CVyPItV~LRLRSPS  743 (955)
                      ...-.-|++..++++.-+
T Consensus       283 ~~~~Ge~vt~ti~i~g~G  300 (484)
T PF13584_consen  283 EVKVGEPVTRTITISGEG  300 (484)
T ss_pred             cccCCCeEEEEEEEEEEc
Confidence            466677888888888763


No 64 
>PHA03286 envelope glycoprotein E; Provisional
Probab=43.54  E-value=18  Score=42.70  Aligned_cols=50  Identities=16%  Similarity=0.117  Sum_probs=22.8

Q ss_pred             CCcceehhhHHHHHHHHHHHHHHHHHHHhhcccccccccCCCCCccCccCCC
Q 002185          876 SGGMIAIVVLSAFVAVVLCSAAAWVLLFKYKSHACQAEEVPQSLQTSHVKPS  927 (955)
Q Consensus       876 SkGaIAGIVLGSVVlVVLLsAaa~LLLLRRRRR~sqa~e~~~pFaSs~~K~S  927 (955)
                      ...+|..+++|++++ |++.++.+.+++|||||++ ..+.-+.+-...+.++
T Consensus       389 ~~~l~~s~~~~~~~~-~~~~~~~~~~~~~r~~~~r-~~~~~~~~~ky~~lp~  438 (492)
T PHA03286        389 YSLLVSSMAAGAILV-VLLFALCIAGLYRRRRRHR-TNGYFQAYPKYMSLPS  438 (492)
T ss_pred             HHHHHHHHHHHHHHH-HHHHHHHhHhHhhhhhhhh-cccccccCcccccCCC
Confidence            333444445544433 3333444455566554433 3344455555544444


No 65 
>PF05283 MGC-24:  Multi-glycosylated core protein 24 (MGC-24);  InterPro: IPR007947 CD164 is a mucin-like receptor, or sialomucin, with specificity in receptor/ ligand interactions that depends on the structural characteristics of the mucin-like receptor. Its functions include mediating, or regulating, haematopoietic progenitor cell adhesion and the negative regulation of their growth and/or-differentiation. It exists in the native state as a disulphide- linked homodimer of two 80-85kDa subunits. It is usually expressed by CD34+ and CD341o/- haematopoietic stem cells and associated microenvironmental cells. It contains, in its extracellular region, two mucin domains (I and II) linked by a non-mucin domain, which has been predicted to contain intra- disulphide bridges. This receptor may play a key role in haematopoiesis by facilitating the adhesion of human CD34+ cells to bone marrow stroma and by negatively regulating CD34+ CD341o/- haematopoietic progenitor cell proliferation. These effects involve the CD164 class I and/or II epitopes recognised by the monoclonal antibodies (mAbs) 105A5 and 103B2/9E10. These epitopes are carbohydrate-dependent and are located on the N-terminal mucin domain I [, ]. It has been found that murine MGC-24v and rat endolyn share significant sequence similarities with human CD164. However, CD164 lacks the consensus glycosaminoglycan (GAG)-attachment site found in MGC-24; it is possible that GAG-association is responsible for the high molecular weight of the epithelial-derived MGC-24 glycoprotein [].  Genomic structure studies have placed CD164 within the mucin-subgroup that comprises multiple exons, and demonstrate the diverse chromosomal distribution of this family of molecules. Molecules with such multiple exons may have sophisticated regulatory mechanisms that involve not only post-translational modifications of the oligosaccharide side chains, but also differential exon usage. Although differences in the intron and exon sizes are seen between the mouse and human genes, the predicted proteins are similar in size and structure, maintaining functionally important motifs that regulate cell proliferation or subcellular distribution [].  CD164 is a gene whose expression depends on differential usage of poly- adenylation sites within the 3'-UTR. The conserved distribution of the 3.2- and 1.2-kb CD164 transcripts between mouse and human suggests that (i) a mechanism may exist to regulate tissue-specific polyadenylation, and (ii) differences in polyadenylation are important for the expression and function of CD164 in different tissues. Two other aspects of the structure of CD164 are of particular interest. First, it shares one of several conserved features of a cytokine-binding pocket - in this respect, it is notable that evidence exists for a class of cell-surface sialomucin modulators that directly interact with growth factor receptors to regulate their response to physiological ligands. Second, its cytoplasmic tail contains a C-terminal YHTL motif found in many endocytic membrane proteins or receptors. These Tyr-based motifs bind to adaptor proteins, which mediate the sorting of membrane proteins into transport vesicles from the plasma membrane to the endosomes, and between intracellular compartments. 
Probab=43.51  E-value=20  Score=37.82  Aligned_cols=31  Identities=16%  Similarity=0.250  Sum_probs=19.5

Q ss_pred             cCCCCCcceehhhHHHHHHHHHHHHHHHHHHHhhcc
Q 002185          872 KYGLSGGMIAIVVLSAFVAVVLCSAAAWVLLFKYKS  907 (955)
Q Consensus       872 KkgLSkGaIAGIVLGSVVlVVLLsAaa~LLLLRRRR  907 (955)
                      ++++..+-.    ||+|||++.|++|+ |++||+.|
T Consensus       155 ~s~FD~~SF----iGGIVL~LGv~aI~-ff~~KF~k  185 (186)
T PF05283_consen  155 KSTFDAASF----IGGIVLTLGVLAII-FFLYKFCK  185 (186)
T ss_pred             CCCCchhhh----hhHHHHHHHHHHHH-HHHhhhcc
Confidence            444554444    46888888887876 44467654


No 66 
>PF06809 NPDC1:  Neural proliferation differentiation control-1 protein (NPDC1);  InterPro: IPR009635 This family consists of several neural proliferation differentiation control-1 (NPDC1) proteins. NPDC1 plays a role in the control of neural cell proliferation and differentiation. It has been suggested that NPDC1 may be involved in the development of several secretion glands. This family also contains the C-terminal region of the Caenorhabditis elegans protein CAB-1 (Q93249 from SWISSPROT) which is known to interact with AEX-3 [].; GO: 0016021 integral to membrane
Probab=42.04  E-value=28  Score=39.58  Aligned_cols=33  Identities=9%  Similarity=0.218  Sum_probs=15.8

Q ss_pred             CCc-ceehhhHHHHHHHHHHHHHHHHHHHhhcccc
Q 002185          876 SGG-MIAIVVLSAFVAVVLCSAAAWVLLFKYKSHA  909 (955)
Q Consensus       876 SkG-aIAGIVLGSVVlVVLLsAaa~LLLLRRRRR~  909 (955)
                      +.+ ++|.|++.++++++++++ +.|||+|-.|..
T Consensus       195 ~d~l~lv~Iv~~cvaG~aAliv-a~~cW~Rlqr~~  228 (341)
T PF06809_consen  195 GDGLTLVLIVVCCVAGAAALIV-AGYCWYRLQREI  228 (341)
T ss_pred             CCCeeeehhHHHHHHHHHHHHH-hhheEEEecccc
Confidence            444 334444445555544444 446666554433


No 67 
>KOG3637 consensus Vitronectin receptor, alpha subunit [Extracellular structures]
Probab=41.70  E-value=27  Score=44.55  Aligned_cols=29  Identities=17%  Similarity=0.197  Sum_probs=17.4

Q ss_pred             CCCCcceehhhHHHHHHHHHHHHHHHHHH
Q 002185          874 GLSGGMIAIVVLSAFVAVVLCSAAAWVLL  902 (955)
Q Consensus       874 gLSkGaIAGIVLGSVVlVVLLsAaa~LLL  902 (955)
                      .+..++||+.+||+++++++|+.++|=|-
T Consensus       975 ~vp~wiIi~svl~GLLlL~llv~~LwK~G 1003 (1030)
T KOG3637|consen  975 PVPLWIIILSVLGGLLLLALLVLLLWKCG 1003 (1030)
T ss_pred             ccceeeehHHHHHHHHHHHHHHHHHHhcC
Confidence            36777777766666655555555555443


No 68 
>PF11770 GAPT:  GRB2-binding adapter (GAPT);  InterPro: IPR021082  This entry represents a family of transmembrane proteins which bind the growth factor receptor-bound protein 2 (GRB2) in B cells []. In contrast to other transmembrane adaptor proteins, GAPT, which this entry represents, is not phosphorylated upon BCR ligation. It associates with GRB2 constitutively through its proline-rich region []. 
Probab=40.43  E-value=11  Score=38.74  Aligned_cols=26  Identities=8%  Similarity=0.188  Sum_probs=11.1

Q ss_pred             hhhHHHHHHHHHHHHHHHHHHHhhccc
Q 002185          882 IVVLSAFVAVVLCSAAAWVLLFKYKSH  908 (955)
Q Consensus       882 GIVLGSVVlVVLLsAaa~LLLLRRRRR  908 (955)
                      +|+||..+++|+| +.++-|+|.||+|
T Consensus        11 ~i~igi~Ll~lLl-~cgiGcvwhwkhr   36 (158)
T PF11770_consen   11 AISIGISLLLLLL-LCGIGCVWHWKHR   36 (158)
T ss_pred             HHHHHHHHHHHHH-HHhcceEEEeecc
Confidence            4555554444332 2223344444443


No 69 
>PF14991 MLANA:  Protein melan-A; PDB: 2GTZ_F 2GT9_F 3MRO_P 2GUO_C 3MRQ_P 2GTW_C 3L6F_C 3MRP_P.
Probab=40.26  E-value=8.6  Score=38.04  Aligned_cols=24  Identities=13%  Similarity=0.113  Sum_probs=1.9

Q ss_pred             cceehhhHHHHHHHHHHHHHHHHH
Q 002185          878 GMIAIVVLSAFVAVVLCSAAAWVL  901 (955)
Q Consensus       878 GaIAGIVLGSVVlVVLLsAaa~LL  901 (955)
                      --.+||.|=.|++.++|++..|+|
T Consensus        24 EEAaGIGiL~VILgiLLliGCWYc   47 (118)
T PF14991_consen   24 EEAAGIGILIVILGILLLIGCWYC   47 (118)
T ss_dssp             ----SSS-----------------
T ss_pred             HHhccceeHHHHHHHHHHHhheee
Confidence            335666654555555555555555


No 70 
>PRK05696 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=39.70  E-value=33  Score=34.69  Aligned_cols=25  Identities=24%  Similarity=0.515  Sum_probs=11.1

Q ss_pred             CcceehhhHHHHHHHHHHHHHHHHHH
Q 002185          877 GGMIAIVVLSAFVAVVLCSAAAWVLL  902 (955)
Q Consensus       877 kGaIAGIVLGSVVlVVLLsAaa~LLL  902 (955)
                      +.+|+.|++ ++++++++.+++||++
T Consensus        18 kkliiii~~-~~lll~~~g~~~~f~l   42 (170)
T PRK05696         18 KKLIIIIVI-GVLLALGGGGAAWFFM   42 (170)
T ss_pred             eeEEeeHHH-HHHHHHHHHHHHHhhh
Confidence            333444443 3344444445555553


No 71 
>PF10661 EssA:  WXG100 protein secretion system (Wss), protein EssA;  InterPro: IPR018920  The Wss (WXG100 protein secretion system) in Staphylococcus aureus seems to be encoded by a locus of eight ORFs, called ess (eSAT-6 secretion system) []. This locus encodes, amongst several other proteins, EssA, a protein predicted to possess one transmembrane domain. Due to its predicted membrane location and its absolute requirement for WXG100 protein secretion, it has been speculated that EssA could form a secretion apparatus in conjunction with YukC and YukAB. Proteins homologous to EssA, YukC, EsaA and YukD were absent from mycobacteria [].   Members of this family are associated with type VII secretion of WXG100 family targets in the Firmicutes, but not in the Actinobacteria. This highly divergent protein family consists largely of a central region of highly polar low-complexity sequence containing occasional LF motifs in weak repeats about 17 residues in length, flanked by hydrophobic N- and C-terminal regions. 
Probab=39.64  E-value=30  Score=34.98  Aligned_cols=23  Identities=9%  Similarity=0.244  Sum_probs=12.0

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHhh
Q 002185          883 VVLSAFVAVVLCSAAAWVLLFKY  905 (955)
Q Consensus       883 IVLGSVVlVVLLsAaa~LLLLRR  905 (955)
                      +++|+++++|+++++++|.++|+
T Consensus       120 ~i~~~i~g~ll~i~~giy~~~r~  142 (145)
T PF10661_consen  120 TILLSIGGILLAICGGIYVVLRK  142 (145)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            34444444545555555666664


No 72 
>PTZ00382 Variant-specific surface protein (VSP); Provisional
Probab=39.23  E-value=8.6  Score=36.20  Aligned_cols=38  Identities=16%  Similarity=0.059  Sum_probs=25.5

Q ss_pred             CCCCCcceehhhHHHHHHHHHHH-HHHHHHHHhhccccc
Q 002185          873 YGLSGGMIAIVVLSAFVAVVLCS-AAAWVLLFKYKSHAC  910 (955)
Q Consensus       873 kgLSkGaIAGIVLGSVVlVVLLs-Aaa~LLLLRRRRR~s  910 (955)
                      +..+.++-.|+++|+++++++++ +++.|++|.+..|++
T Consensus        57 st~~~~ls~gaiagi~vg~~~~v~~lv~~l~w~f~~r~k   95 (96)
T PTZ00382         57 GANRSGLSTGAIAGISVAVVAVVGGLVGFLCWWFVCRGK   95 (96)
T ss_pred             ccCCCCcccccEEEEEeehhhHHHHHHHHHhheeEEeec
Confidence            44557788888888777766555 555566666666643


No 73 
>PF00558 Vpu:  Vpu protein;  InterPro: IPR008187 The Human immunodeficiency virus 1 (HIV-1) Vpu protein acts in the degradation of CD4 in the endoplasmic reticulum and in the enhancement of virion release from the plasma membrane of infected cells [].; GO: 0019076 release of virus from host; PDB: 2JPX_A 1PI8_A 2GOH_A 2GOF_A 1PI7_A 1PJE_A 1VPU_A 2K7Y_A.
Probab=38.65  E-value=34  Score=32.14  Aligned_cols=26  Identities=8%  Similarity=0.300  Sum_probs=8.5

Q ss_pred             ceehhhHHHHHHHHHHHHHHHHHHHhhc
Q 002185          879 MIAIVVLSAFVAVVLCSAAAWVLLFKYK  906 (955)
Q Consensus       879 aIAGIVLGSVVlVVLLsAaa~LLLLRRR  906 (955)
                      .|++|++.+++  +++..++|.+.++..
T Consensus         5 ~i~~iialiv~--~iiaIvvW~iv~ieY   30 (81)
T PF00558_consen    5 EILAIIALIVA--LIIAIVVWTIVYIEY   30 (81)
T ss_dssp             ---HHHHHHHH--HHHHHHHHHHH----
T ss_pred             HHHHHHHHHHH--HHHHHHHHHHHHHHH
Confidence            34554443333  333445565544333


No 74 
>KOG3514 consensus Neurexin III-alpha [Signal transduction mechanisms]
Probab=38.08  E-value=23  Score=45.45  Aligned_cols=30  Identities=20%  Similarity=0.390  Sum_probs=19.0

Q ss_pred             eehhhHHHHHHHHHHHHHHHHHHHhhcccc
Q 002185          880 IAIVVLSAFVAVVLCSAAAWVLLFKYKSHA  909 (955)
Q Consensus       880 IAGIVLGSVVlVVLLsAaa~LLLLRRRRR~  909 (955)
                      +.|+|+|.++++++|++++.+++.++|.|.
T Consensus      1514 ttGmVvGIvaAaaLcILilL~am~kyRnrd 1543 (1591)
T KOG3514|consen 1514 TTGMVVGIVAAAALCILILLYAMYKYRNRD 1543 (1591)
T ss_pred             ccchhhHHHHHHHHHHHHHHhhcccccccc
Confidence            456666666666777776666666666554


No 75 
>PF02439 Adeno_E3_CR2:  Adenovirus E3 region protein CR2;  InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host []. This region called CR1 (conserved region 1) [] is found three times in Human adenovirus 19 (a subgroup D adenovirus) 49 kDa protein in the E3 region. CR1 is also found in the 20.1 Kd protein of subgroup B adenoviruses. The function of this 80 amino acid region is unknown. This region is probably a divergent immunoglobulin domain.
Probab=36.22  E-value=35  Score=28.24  Aligned_cols=30  Identities=17%  Similarity=0.269  Sum_probs=18.2

Q ss_pred             cceehhhHHHHHHHHHHHHHHHHHHHhhccc
Q 002185          878 GMIAIVVLSAFVAVVLCSAAAWVLLFKYKSH  908 (955)
Q Consensus       878 GaIAGIVLGSVVlVVLLsAaa~LLLLRRRRR  908 (955)
                      ++|+|+++|.++ +++|...-..|..|.|+.
T Consensus         7 aIIv~V~vg~~i-iii~~~~YaCcykk~~~~   36 (38)
T PF02439_consen    7 AIIVAVVVGMAI-IIICMFYYACCYKKHRRQ   36 (38)
T ss_pred             hHHHHHHHHHHH-HHHHHHHHHHHHcccccc
Confidence            466666665544 455555555777877754


No 76 
>PF04971 Lysis_S:  Lysis protein S ;  InterPro: IPR007054 The lysis S protein is a cytotoxic protein forming holes in membranes causing cell lysis. The action of Lysis S is independent of the proportion of acidic phospholipids in the membrane [].
Probab=36.12  E-value=30  Score=31.68  Aligned_cols=22  Identities=14%  Similarity=-0.002  Sum_probs=14.1

Q ss_pred             CCcceehhhHHHHHHHHHHHHH
Q 002185          876 SGGMIAIVVLSAFVAVVLCSAA  897 (955)
Q Consensus       876 SkGaIAGIVLGSVVlVVLLsAa  897 (955)
                      +.+..|||+.|.+++++.++..
T Consensus        31 ~qW~aIGvi~gi~~~~lt~ltN   52 (68)
T PF04971_consen   31 SQWAAIGVIGGIFFGLLTYLTN   52 (68)
T ss_pred             ccchhHHHHHHHHHHHHHHHhH
Confidence            4566678777666666666554


No 77 
>PTZ00214 high cysteine membrane protein Group 4; Provisional
Probab=35.55  E-value=3  Score=51.37  Aligned_cols=27  Identities=7%  Similarity=-0.071  Sum_probs=20.0

Q ss_pred             ccCCCCCcceehhhHHHHHHHHHHHHH
Q 002185          871 QKYGLSGGMIAIVVLSAFVAVVLCSAA  897 (955)
Q Consensus       871 kKkgLSkGaIAGIVLGSVVlVVLLsAa  897 (955)
                      .+++++.|+|+||+|.+|++|.+|+++
T Consensus       771 ~~~~~~~~~i~~~~v~~~~vv~~lvg~  797 (800)
T PTZ00214        771 ELAKKRTAAIAGGTVAGVLVIGVLVGF  797 (800)
T ss_pred             cccccccceeEEEEEEEeeeeeeeeeE
Confidence            357899999999998766665555553


No 78 
>PHA03281 envelope glycoprotein E; Provisional
Probab=35.37  E-value=46  Score=40.30  Aligned_cols=29  Identities=17%  Similarity=0.085  Sum_probs=15.5

Q ss_pred             CCCCcceehhhHHH-HHHHHHHHHHHHHHH
Q 002185          874 GLSGGMIAIVVLSA-FVAVVLCSAAAWVLL  902 (955)
Q Consensus       874 gLSkGaIAGIVLGS-VVlVVLLsAaa~LLL  902 (955)
                      +.+.-+|-++.+|+ .+++++|++++.+|+
T Consensus       549 ~~~p~~~y~~l~~~~a~~~ll~l~~~~~c~  578 (642)
T PHA03281        549 GTFPFKRYAAITGGFAALALLCLAIALICT  578 (642)
T ss_pred             CCCCeEeehhhhhhhHHHHHHHHHHHHHHH
Confidence            33444555555554 455556666666663


No 79 
>KOG3054 consensus Uncharacterized conserved protein [Function unknown]
Probab=34.87  E-value=39  Score=37.49  Aligned_cols=24  Identities=29%  Similarity=0.398  Sum_probs=13.9

Q ss_pred             HHHHHHHHHHHHHHHHHHhhcccc
Q 002185          886 SAFVAVVLCSAAAWVLLFKYKSHA  909 (955)
Q Consensus       886 GSVVlVVLLsAaa~LLLLRRRRR~  909 (955)
                      +.+|++++|++++.|++|++++..
T Consensus         6 ~vlVaa~llV~~i~l~l~~r~raA   29 (299)
T KOG3054|consen    6 AVLVAAALLVAVILLFLWKRRRAA   29 (299)
T ss_pred             HHHHHHHHHHHHHHHHHHHhhccc
Confidence            455666666666666655555433


No 80 
>PHA03291 envelope glycoprotein I; Provisional
Probab=33.74  E-value=56  Score=37.85  Aligned_cols=73  Identities=14%  Similarity=0.132  Sum_probs=35.3

Q ss_pred             ccCCCCCcceehhhHHHHHHHHHHHHH-HHHHHHhhcccccccccCCCCCccCccCCCccccccccchHHHHHHHhcccc
Q 002185          871 QKYGLSGGMIAIVVLSAFVAVVLCSAA-AWVLLFKYKSHACQAEEVPQSLQTSHVKPSVVLIRLPCHLDLALQLIQGLLR  949 (955)
Q Consensus       871 kKkgLSkGaIAGIVLGSVVlVVLLsAa-a~LLLLRRRRR~sqa~e~~~pFaSs~~K~SG~~~~ls~~~dl~~q~~qg~~~  949 (955)
                      .+..++.--||-|+|=+.+++.++++- +|++..|+|||++.....   +.+-   ..++.+.--.|---+++|++-|-|
T Consensus       279 sr~~Lt~~qiiQiAIPasii~cV~lGSC~Ccl~R~~rRr~r~~~~I---Y~P~---~p~~~s~sAvNEaA~ArLg~eL~~  352 (401)
T PHA03291        279 SRYELTVTQIIQIAIPASIIACVFLGSCACCLHRRCRRRRRRPARI---YRPP---SPVAPSISAVNEAALARLGDELKR  352 (401)
T ss_pred             hhhhhhhhhhheeccchHHHHHhhhhhhhhhhhhhhhcccCCcCcc---cCCC---CCCccchhhhhHHHHHHHHHHHhc
Confidence            356777778888887665554444443 333333334333322222   2220   011222112344456788887765


No 81 
>PRK06287 cobalt transport protein CbiN; Validated
Probab=33.48  E-value=47  Score=32.05  Aligned_cols=13  Identities=23%  Similarity=0.294  Sum_probs=5.6

Q ss_pred             HHHHHHHHHHHHH
Q 002185          886 SAFVAVVLCSAAA  898 (955)
Q Consensus       886 GSVVlVVLLsAaa  898 (955)
                      +++++++++++++
T Consensus        82 sgiiGv~i~l~l~   94 (107)
T PRK06287         82 AMVIGTLLVLALA   94 (107)
T ss_pred             HHHHHHHHHHHHH
Confidence            3444444444443


No 82 
>PF05083 LST1:  LST-1 protein;  InterPro: IPR007775 B144/LST1 is a gene encoded in the human major histocompatibility complex that produces multiple forms of alternatively spliced mRNA and encodes peptides fewer than 100 amino acids in length. B144/LST1 is strongly expressed in dendritic cells. Transfection of B144/LST1 into a variety of cells induces morphologic changes including the production of long, thin filopodia []. A possible role in modulating immune responses. Induces morphological changes including production of filopodia and microspikes when overexpressed in a variety of cell types and may be involved in dendritic cell maturation. Isoform 1 and isoform 2 have an inhibitory effect on lymphocyte proliferation [, ]. ; GO: 0000902 cell morphogenesis, 0006955 immune response, 0016020 membrane
Probab=31.97  E-value=36  Score=31.53  Aligned_cols=23  Identities=4%  Similarity=0.105  Sum_probs=13.8

Q ss_pred             HHHHHHHHHHHHHHHHHHhhccc
Q 002185          886 SAFVAVVLCSAAAWVLLFKYKSH  908 (955)
Q Consensus       886 GSVVlVVLLsAaa~LLLLRRRRR  908 (955)
                      |++.+++++++.+++|++-||.+
T Consensus         2 ggllll~vvll~~clC~lsrRvk   24 (74)
T PF05083_consen    2 GGLLLLAVVLLSACLCRLSRRVK   24 (74)
T ss_pred             cchhhHHHHHHHHHHHHHHhhhh
Confidence            55555555556667787755543


No 83 
>PF02158 Neuregulin:  Neuregulin family;  InterPro: IPR002154 Neuregulins are a sub-family of EGF-like molecules that have been shown to play multiple essential roles in vertebrate embryogenesis including: cardiac development, Schwann cell and oligodendrocyte differentiation, some aspects of neuronal development, as well as the formation of neuromuscular synapses [, ]. Included in the family are heregulin; neu differentiation factor; acetylcholine receptor synthesis stimulator; glial growth factor; and sensory and motor-neuron derived factor []. Multiple family members are generated by alternate splicing or by use of several cell type-specific transcription initiation sites. In general, they bind to and activate the erbB family of receptor tyrosine kinases (erbB2 (HER2), erbB3 (HER3), and erbB4 (HER4)), functioning both as heterodimers and homodimers.  The transmembrane forms of neuregulin 1 (NRG1) are present within synaptic vesicles, including those containing glutamate []. After exocytosis, NRG1 is in the presynaptic membrane, where the ectodomain of NRG1 may be cleaved off. The ectodomain then migrates across the synaptic cleft and binds to and activates a member of the EGF-receptor family on the postsynaptic membrane. This has been shown to increase the expression of certain glutamate-receptor subunits. NRG1 appears to signal for glutamate-receptor subunit expression, localisation, and /or phosphorylation facilitating subsequent glutamate transmission.   The NRG1 gene has been identified as a potential gene determining susceptibility to schizophrenia by a combination of genetic linkage and association approaches []. ; GO: 0005102 receptor binding, 0009790 embryo development; PDB: 1HRE_A 1HAE_A 1HAF_A 1HRF_A.
Probab=31.94  E-value=15  Score=42.39  Aligned_cols=18  Identities=17%  Similarity=0.408  Sum_probs=0.0

Q ss_pred             ceehhhHHHHHHHHHHHH
Q 002185          879 MIAIVVLSAFVAVVLCSA  896 (955)
Q Consensus       879 aIAGIVLGSVVlVVLLsA  896 (955)
                      .|.||+||.+|+-++|++
T Consensus        11 TITgIcvaLlVVGi~Cvv   28 (404)
T PF02158_consen   11 TITGICVALLVVGIVCVV   28 (404)
T ss_dssp             ------------------
T ss_pred             hhhhhhHHHHHHHHHHHH
Confidence            478888877666666654


No 84 
>PF07178 TraL:  TraL protein;  InterPro: IPR009838 This entry represents bacterial TraL proteins. TraL is a predicted peripheral membrane protein involved in bacterial sex pilus assembly []. TraL is part of the type IV secretion system for conjugative plasmid transfer []. The exact function of TraL is unknown.; GO: 0000746 conjugation, 0019867 outer membrane
Probab=31.89  E-value=40  Score=31.33  Aligned_cols=28  Identities=14%  Similarity=0.282  Sum_probs=11.9

Q ss_pred             ceehhhHHHHHHHHHHHHHHHHHHHhhc
Q 002185          879 MIAIVVLSAFVAVVLCSAAAWVLLFKYK  906 (955)
Q Consensus       879 aIAGIVLGSVVlVVLLsAaa~LLLLRRR  906 (955)
                      .++||++|..+..+++.+++++++.|.|
T Consensus        30 ~~~gi~~~~~~~g~i~g~~~~~~~~k~K   57 (95)
T PF07178_consen   30 FVIGILSGHFLIGLILGIVLWWGYRKFK   57 (95)
T ss_pred             HHHHHHHhhHHHHHHHHHHHHHHHHHHH
Confidence            3455555554333333333333333333


No 85 
>PF02480 Herpes_gE:  Alphaherpesvirus glycoprotein E;  InterPro: IPR003404 Glycoprotein E (gE) of Alphaherpesvirus forms a complex with glycoprotein I (gI), functioning as an immunoglobulin G (IgG) Fc binding protein. gE is involved in virus spread but is not essential for propagation [].; GO: 0016020 membrane; PDB: 2GJ7_F 2GIY_B.
Probab=31.43  E-value=16  Score=42.47  Aligned_cols=49  Identities=8%  Similarity=-0.082  Sum_probs=0.0

Q ss_pred             CCCCCcceehhhHHHHHHHHHHHHHHHHHHHhhcccccccccCCCCCccC
Q 002185          873 YGLSGGMIAIVVLSAFVAVVLCSAAAWVLLFKYKSHACQAEEVPQSLQTS  922 (955)
Q Consensus       873 kgLSkGaIAGIVLGSVVlVVLLsAaa~LLLLRRRRR~sqa~e~~~pFaSs  922 (955)
                      ..+-.++++|+++ +++++++++.+++.+.+|||++.+........+.+.
T Consensus       351 ~~~~l~vVlgvav-livVv~viv~vc~~~rrrR~~~~~~~~~~~~~YtsL  399 (439)
T PF02480_consen  351 GAALLGVVLGVAV-LIVVVGVIVWVCLRCRRRRRQRDKILNPFSPVYTSL  399 (439)
T ss_dssp             --------------------------------------------------
T ss_pred             ccchHHHHHHHHH-HHHHHHHHhheeeeehhcccccccccCcCCCccccC
Confidence            3344444445444 555555566666788888877764444444555443


No 86 
>PF05337 CSF-1:  Macrophage colony stimulating factor-1 (CSF-1);  InterPro: IPR008001 Colony stimulating factor 1 (CSF-1) is a homodimeric polypeptide growth factor whose primary function is to regulate the survival, proliferation, differentiation, and function of cells of the mononuclear phagocytic lineage. This lineage includes mononuclear phagocytic precursors, blood monocytes, tissue macrophages, osteoclasts, and microglia of the brain, all of which possess cell surface receptors for CSF-1. The protein has also been linked with male fertility [] and mutations in the Csf-1 gene have been found to cause osteopetrosis and failure of tooth eruption [].; GO: 0005125 cytokine activity, 0008083 growth factor activity, 0016021 integral to membrane; PDB: 3EJJ_A.
Probab=31.16  E-value=16  Score=40.66  Aligned_cols=30  Identities=10%  Similarity=0.329  Sum_probs=0.0

Q ss_pred             hHHHHHHHHHHHHHHHHHHHhhcccccccccC
Q 002185          884 VLSAFVAVVLCSAAAWVLLFKYKSHACQAEEV  915 (955)
Q Consensus       884 VLGSVVlVVLLsAaa~LLLLRRRRR~sqa~e~  915 (955)
                      .|-+|++|+  ++++.|++||||+|.++..++
T Consensus       231 LVPSiILVL--LaVGGLLfYr~rrRs~~e~q~  260 (285)
T PF05337_consen  231 LVPSIILVL--LAVGGLLFYRRRRRSHREPQT  260 (285)
T ss_dssp             --------------------------------
T ss_pred             cccchhhhh--hhccceeeecccccccccccc
Confidence            344444433  344446666777666555433


No 87 
>PRK00523 hypothetical protein; Provisional
Probab=31.14  E-value=55  Score=30.29  Aligned_cols=25  Identities=8%  Similarity=0.012  Sum_probs=10.4

Q ss_pred             ehhhHHHHHHHHHHHHHHHHHHHhh
Q 002185          881 AIVVLSAFVAVVLCSAAAWVLLFKY  905 (955)
Q Consensus       881 AGIVLGSVVlVVLLsAaa~LLLLRR  905 (955)
                      .|++|+.+++++++-+++.|++-|+
T Consensus         4 ~~l~I~l~i~~li~G~~~Gffiark   28 (72)
T PRK00523          4 IGLALGLGIPLLIVGGIIGYFVSKK   28 (72)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3444444333333333334444444


No 88 
>PRK07021 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=30.73  E-value=52  Score=33.07  Aligned_cols=28  Identities=7%  Similarity=0.030  Sum_probs=11.8

Q ss_pred             CcceehhhHHHHHHHHHHHHHHHHHHHhh
Q 002185          877 GGMIAIVVLSAFVAVVLCSAAAWVLLFKY  905 (955)
Q Consensus       877 kGaIAGIVLGSVVlVVLLsAaa~LLLLRR  905 (955)
                      +..|+.|++.+++++++..+..||+ +++
T Consensus        15 kkkl~ii~l~~l~l~~~g~gg~~~~-~~~   42 (162)
T PRK07021         15 KRKLWLIILILLLLAAAAGAGYSWW-LSK   42 (162)
T ss_pred             ccchhHHHHHHHHHHHHHHHHHHHH-hhc
Confidence            4444444443444433333333444 444


No 89 
>PF12669 P12:  Virus attachment protein p12 family
Probab=30.66  E-value=53  Score=28.70  Aligned_cols=9  Identities=22%  Similarity=0.121  Sum_probs=3.8

Q ss_pred             HHHHhhccc
Q 002185          900 VLLFKYKSH  908 (955)
Q Consensus       900 LLLLRRRRR  908 (955)
                      ..++|++|+
T Consensus        18 r~~~k~~K~   26 (58)
T PF12669_consen   18 RKFIKDKKK   26 (58)
T ss_pred             HHHHHHhhc
Confidence            344444443


No 90 
>PF07253 Gypsy:  Gypsy protein;  InterPro: IPR009882 This family consists of several Gypsy/Env proteins from Drosophila and Ceratitis fruit fly species. Gypsy is an endogenous retrovirus of Drosophila melanogaster. Phylogenetic studies suggest that occasional horizontal transfer events of gypsy occur between Drosophila species. Gypsy possesses infective properties associated with the products of the envelope gene that might be at the origin of these interspecies transfers [].
Probab=30.13  E-value=49  Score=39.26  Aligned_cols=37  Identities=14%  Similarity=0.376  Sum_probs=23.8

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHhhcccccccccCCCCC
Q 002185          883 VVLSAFVAVVLCSAAAWVLLFKYKSHACQAEEVPQSL  919 (955)
Q Consensus       883 IVLGSVVlVVLLsAaa~LLLLRRRRR~sqa~e~~~pF  919 (955)
                      +++|+++.+.++.+++++++.|+||...+..+....|
T Consensus       420 l~~gv~l~~~Ii~~i~~~~~~r~~r~~~~~~~~~~~~  456 (472)
T PF07253_consen  420 LVFGVLLSIMIIIIIALILMLRKKRQKAQIQQSIKTI  456 (472)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhhhhhhhhhhhhcc
Confidence            4567777677777777777777777666665444333


No 91 
>PF02529 PetG:  Cytochrome B6-F complex subunit 5;  InterPro: IPR003683 This family consists of cytochrome b6/f complex subunit 5 (PetG). The cytochrome bf complex, found in green plants, eukaryotic algae and cyanobacteria, connects photosystem I to photosystem II in the electron transport chain, functioning as a plastoquinol:plastocyanin/cytochrome c6 oxidoreductase []. The purified complex from the unicellular alga Chlamydomonas reinhardtii contains seven subunits; namely four high molecular weight subunits (cytochrome f, Rieske iron-sulphur protein, cytochrome b6, and subunit IV) and three approximately miniproteins (PetG, PetL, and PetX) []. Stoichiometry measurements are consistent with every subunit being present as two copies per b6/f dimer. The absence of PetG affects either the assembly or stability of the cytochrome bf complex in C. reinhardtii [].; GO: 0009512 cytochrome b6f complex; PDB: 1Q90_G 2ZT9_G 1VF5_G 2D2C_G 2E74_G 2E75_G 2E76_G.
Probab=29.46  E-value=69  Score=26.54  Aligned_cols=15  Identities=13%  Similarity=0.264  Sum_probs=9.6

Q ss_pred             ceehhhHHHHHHHHH
Q 002185          879 MIAIVVLSAFVAVVL  893 (955)
Q Consensus       879 aIAGIVLGSVVlVVL  893 (955)
                      +..|||+|.+...++
T Consensus         5 lL~GiVlGli~vtl~   19 (37)
T PF02529_consen    5 LLSGIVLGLIPVTLA   19 (37)
T ss_dssp             HHHHHHHHHHHHHHH
T ss_pred             hhhhHHHHhHHHHHH
Confidence            346888887665443


No 92 
>PF05478 Prominin:  Prominin;  InterPro: IPR008795 The prominins are an emerging family of proteins that, among the multispan membrane proteins, display a novel topology. Mouse and Homo sapiens prominin and (Mus musculus) prominin-like 1 (PROML1) are predicted to contain five membrane spanning domains, with an N-terminal domain exposed to the extracellular space followed by four, alternating small cytoplasmic and large extracellular, loops and a cytoplasmic C-terminal domain []. The exact function of prominin is unknown although in humans defects in PROM1, the gene coding for prominin, cause retinal degeneration [].; GO: 0016021 integral to membrane
Probab=28.43  E-value=33  Score=42.32  Aligned_cols=34  Identities=6%  Similarity=0.112  Sum_probs=25.9

Q ss_pred             CCCcceehhhHHHHHHHHHHHHHHHHHHHhhccc
Q 002185          875 LSGGMIAIVVLSAFVAVVLCSAAAWVLLFKYKSH  908 (955)
Q Consensus       875 LSkGaIAGIVLGSVVlVVLLsAaa~LLLLRRRRR  908 (955)
                      .-.|.||.+++|.++++++-+..++||+.|++++
T Consensus        89 ~~~g~~v~~~i~ll~~il~P~vg~~fCcCRCc~~  122 (806)
T PF05478_consen   89 YEWGFLVCAVIGLLFIILMPLVGLCFCCCRCCGN  122 (806)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhccccCCC
Confidence            4467788888988888877777778888776654


No 93 
>PF08374 Protocadherin:  Protocadherin;  InterPro: IPR013585 The structure of protocadherins is similar to that of classic cadherins (IPR002126 from INTERPRO), but they also have some unique features associated with the cytoplasmic domains. They are expressed in a variety of organisms and are found in high concentrations in the brain where they seem to be localised mainly at cell-cell contact sites. Their expression seems to be developmentally regulated []. 
Probab=27.46  E-value=23  Score=38.34  Aligned_cols=14  Identities=0%  Similarity=0.221  Sum_probs=6.0

Q ss_pred             eehhhHHHHHHHHH
Q 002185          880 IAIVVLSAFVAVVL  893 (955)
Q Consensus       880 IAGIVLGSVVlVVL  893 (955)
                      .+-|++|+|+++++
T Consensus        36 ~~~I~iaiVAG~~t   49 (221)
T PF08374_consen   36 YVKIMIAIVAGIMT   49 (221)
T ss_pred             ceeeeeeeecchhh
Confidence            33444444444433


No 94 
>PF03302 VSP:  Giardia variant-specific surface protein;  InterPro: IPR005127 During infection, the intestinal protozoan parasite Giardia lamblia virus undergoes continuous antigenic variation which is determined by diversification of the parasite's major surface antigen, named VSP (variant surface protein).
Probab=27.34  E-value=26  Score=39.96  Aligned_cols=36  Identities=17%  Similarity=0.122  Sum_probs=25.9

Q ss_pred             CCCcceehhhHHHHHHHHHHHH-HHHHHHHhhccccc
Q 002185          875 LSGGMIAIVVLSAFVAVVLCSA-AAWVLLFKYKSHAC  910 (955)
Q Consensus       875 LSkGaIAGIVLGSVVlVVLLsA-aa~LLLLRRRRR~s  910 (955)
                      -..|+-.|+|+|+.|++|++++ +|-||.||+--|.+
T Consensus       360 n~s~LstgaIaGIsvavvvvVgglvGfLcWwf~crgk  396 (397)
T PF03302_consen  360 NKSGLSTGAIAGISVAVVVVVGGLVGFLCWWFICRGK  396 (397)
T ss_pred             ccccccccceeeeeehhHHHHHHHHHHHhhheeeccc
Confidence            4457899999998777665555 77788888765543


No 95 
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional
Probab=27.23  E-value=62  Score=39.53  Aligned_cols=12  Identities=25%  Similarity=0.310  Sum_probs=5.2

Q ss_pred             cceehhhHHHHH
Q 002185          878 GMIAIVVLSAFV  889 (955)
Q Consensus       878 GaIAGIVLGSVV  889 (955)
                      ++++++++|+++
T Consensus       629 ~~~~~~~~~~~~  640 (968)
T PLN00113        629 WFYITCTLGAFL  640 (968)
T ss_pred             eeehhHHHHHHH
Confidence            344444444433


No 96 
>PF05568 ASFV_J13L:  African swine fever virus J13L protein;  InterPro: IPR008385 This family consists of several African swine fever virus (ASFV) j13L proteins [, , ].
Probab=27.07  E-value=50  Score=34.35  Aligned_cols=28  Identities=21%  Similarity=0.303  Sum_probs=19.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhccccccc
Q 002185          885 LSAFVAVVLCSAAAWVLLFKYKSHACQA  912 (955)
Q Consensus       885 LGSVVlVVLLsAaa~LLLLRRRRR~sqa  912 (955)
                      .-.+++++++++++|++++.+.+|++++
T Consensus        32 ~tILiaIvVliiiiivli~lcssRKkKa   59 (189)
T PF05568_consen   32 YTILIAIVVLIIIIIVLIYLCSSRKKKA   59 (189)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhhHHH
Confidence            3356666777777888887777766665


No 97 
>PRK14748 kdpF potassium-transporting ATPase subunit F; Provisional
Probab=26.42  E-value=44  Score=26.32  Aligned_cols=12  Identities=17%  Similarity=-0.061  Sum_probs=4.9

Q ss_pred             HHHHHHHHHHHH
Q 002185          892 VLCSAAAWVLLF  903 (955)
Q Consensus       892 VLLsAaa~LLLL  903 (955)
                      ++|++-.++.++
T Consensus        13 ~lLlgYLvyALi   24 (29)
T PRK14748         13 FLLLGYLVYALI   24 (29)
T ss_pred             HHHHHHHHHHHh
Confidence            334444444433


No 98 
>PRK06531 yajC preprotein translocase subunit YajC; Validated
Probab=26.33  E-value=20  Score=35.15  Aligned_cols=25  Identities=12%  Similarity=0.133  Sum_probs=12.4

Q ss_pred             HHHHHHHHHHHHHHhhccccccccc
Q 002185          890 AVVLCSAAAWVLLFKYKSHACQAEE  914 (955)
Q Consensus       890 lVVLLsAaa~LLLLRRRRR~sqa~e  914 (955)
                      .+++++++.||+++.+|||.++..+
T Consensus         8 ~~vv~~~i~yf~iRPQkKr~Ke~~e   32 (113)
T PRK06531          8 MFVVMLGLIFFMQRQQKKQAQERQN   32 (113)
T ss_pred             HHHHHHHHHHheechHHHHHHHHHH
Confidence            3444545555554455555554544


No 99 
>PHA02669 hypothetical protein; Provisional
Probab=26.16  E-value=36  Score=35.83  Aligned_cols=11  Identities=55%  Similarity=0.540  Sum_probs=6.6

Q ss_pred             HHHHHHHhccc
Q 002185          938 DLALQLIQGLL  948 (955)
Q Consensus       938 dl~~q~~qg~~  948 (955)
                      .|+-||+.|-|
T Consensus        46 kLatQLGnGt~   56 (210)
T PHA02669         46 KLATQLGNGTL   56 (210)
T ss_pred             HHHHHhcCCcc
Confidence            46666666654


No 100
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms]
Probab=26.11  E-value=1.3e+02  Score=36.42  Aligned_cols=62  Identities=18%  Similarity=0.110  Sum_probs=26.9

Q ss_pred             ehhhHHHHHHHHHHHHHHHHHHHhhcccccccccCCCCCccCccCCCcccccccc----chHHHHHHHhcc
Q 002185          881 AIVVLSAFVAVVLCSAAAWVLLFKYKSHACQAEEVPQSLQTSHVKPSVVLIRLPC----HLDLALQLIQGL  947 (955)
Q Consensus       881 AGIVLGSVVlVVLLsAaa~LLLLRRRRR~sqa~e~~~pFaSs~~K~SG~~~~ls~----~~dl~~q~~qg~  947 (955)
                      +-|.+|.+.++++|++.+ |+.+|++|-.+...|   .+ -...-.+|.+.+..+    ++.|+-+++.|.
T Consensus       157 al~~~~~v~~l~~lvi~~-~~~~r~~k~~~~~~e---~~-~~p~~d~~~~~sspl~~l~pl~l~eli~~Gr  222 (534)
T KOG3653|consen  157 ALIPLLLVSLLAALVILA-FLGYRQRKNAREEIE---PV-LIPLEDSGPAPSSPLLELDPLQLLELIGRGR  222 (534)
T ss_pred             hHHHHHHHHHHHHHHHHH-HHHHHHhhcccccCc---cC-cccCCCCCCCCCcccccCCchhhHHHhhcCc
Confidence            333344455444444443 444566554432211   11 112344555555333    344555555553


No 101
>PF05393 Hum_adeno_E3A:  Human adenovirus early E3A glycoprotein;  InterPro: IPR008652 This family consists of several early glycoproteins (E3A), from human adenovirus type 2.; GO: 0016021 integral to membrane
Probab=25.97  E-value=87  Score=30.24  Aligned_cols=35  Identities=17%  Similarity=0.072  Sum_probs=25.7

Q ss_pred             CCCCCcceehhhHHHHHHHHHHHHHHHHHHHhhccc
Q 002185          873 YGLSGGMIAIVVLSAFVAVVLCSAAAWVLLFKYKSH  908 (955)
Q Consensus       873 kgLSkGaIAGIVLGSVVlVVLLsAaa~LLLLRRRRR  908 (955)
                      ...+.|++.++|.|.++++|+|=.+.|+. +||.||
T Consensus        29 ~~~~Lgm~~lvI~~iFil~VilwfvCC~k-RkrsRr   63 (94)
T PF05393_consen   29 NWPNLGMWFLVICGIFILLVILWFVCCKK-RKRSRR   63 (94)
T ss_pred             CCCccchhHHHHHHHHHHHHHHHHHHHHH-hhhccC
Confidence            34577788888888888888887776665 666554


No 102
>PF05961 Chordopox_A13L:  Chordopoxvirus A13L protein;  InterPro: IPR009236 This family consists of A13L proteins from the Chordopoxviruses. A13L or p8 is one of the three most abundant membrane proteins of the intracellular mature Vaccinia virus [].
Probab=25.93  E-value=96  Score=28.57  Aligned_cols=12  Identities=33%  Similarity=0.478  Sum_probs=6.5

Q ss_pred             ccchHHHHHHHh
Q 002185          934 PCHLDLALQLIQ  945 (955)
Q Consensus       934 s~~~dl~~q~~q  945 (955)
                      +.||+-+-.|.-
T Consensus        55 ~~Hl~SfYkLFs   66 (68)
T PF05961_consen   55 PDHLSSFYKLFS   66 (68)
T ss_pred             HHHHHHHHHHhc
Confidence            456665555543


No 103
>PRK13707 conjugal transfer pilus assembly protein TraL; Provisional
Probab=25.67  E-value=51  Score=31.56  Aligned_cols=29  Identities=14%  Similarity=0.156  Sum_probs=11.5

Q ss_pred             eehhhHHHHHHHHHHHHHHHHHHHhhccc
Q 002185          880 IAIVVLSAFVAVVLCSAAAWVLLFKYKSH  908 (955)
Q Consensus       880 IAGIVLGSVVlVVLLsAaa~LLLLRRRRR  908 (955)
                      ++||+.|-++..+++.+++|+.+.|-|++
T Consensus        37 ~~Gi~~~~~l~g~i~g~~~~~~~r~lK~g   65 (101)
T PRK13707         37 GWGITTSKYLFGIIAAVLVWFGIRKLKKG   65 (101)
T ss_pred             HHHHHHchHHHHHHHHHHHHHHHHHHHcC
Confidence            44444443333333333333343333433


No 104
>PF07204 Orthoreo_P10:  Orthoreovirus membrane fusion protein p10;  InterPro: IPR009854 This family consists of several Orthoreovirus membrane fusion protein p10 sequences. p10 is thought to be a multifunctional protein that plays a key role in virus-host interaction [].
Probab=25.47  E-value=37  Score=32.93  Aligned_cols=13  Identities=8%  Similarity=0.281  Sum_probs=6.4

Q ss_pred             HHHHHHHHHHHHH
Q 002185          886 SAFVAVVLCSAAA  898 (955)
Q Consensus       886 GSVVlVVLLsAaa  898 (955)
                      |++++++++++++
T Consensus        49 GG~iLilIii~Lv   61 (98)
T PF07204_consen   49 GGLILILIIIALV   61 (98)
T ss_pred             chhhhHHHHHHHH
Confidence            4555555554443


No 105
>PF14986 DUF4514:  Domain of unknown function (DUF4514)
Probab=25.43  E-value=77  Score=28.30  Aligned_cols=28  Identities=7%  Similarity=-0.013  Sum_probs=18.3

Q ss_pred             cceehhhHHHHHHHHHHHHHHHHHHHhhcc
Q 002185          878 GMIAIVVLSAFVAVVLCSAAAWVLLFKYKS  907 (955)
Q Consensus       878 GaIAGIVLGSVVlVVLLsAaa~LLLLRRRR  907 (955)
                      -+|+|+++|..+.+..|.+  -+|++||.-
T Consensus        22 Ya~IGtalGvaisAgFLaL--KicmIrkhl   49 (61)
T PF14986_consen   22 YAIIGTALGVAISAGFLAL--KICMIRKHL   49 (61)
T ss_pred             eeeehhHHHHHHHHHHHHH--HHHHHHHhh
Confidence            3788888887766655544  356666544


No 106
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms]
Probab=24.76  E-value=56  Score=40.33  Aligned_cols=16  Identities=19%  Similarity=0.044  Sum_probs=8.9

Q ss_pred             EEEEEeccccCCcchH
Q 002185          735 VGLRLSVALYTFFPLV  750 (955)
Q Consensus       735 V~LRLRSPSFSfFPy~  750 (955)
                      -+++|..-+|.|+.|.
T Consensus       194 q~~~l~~i~l~Ds~yd  209 (807)
T KOG1094|consen  194 QGMYLSAIYLNDSTYD  209 (807)
T ss_pred             ccccccceeecccccc
Confidence            4455555556666554


No 107
>PF14654 Epiglycanin_C:  Mucin, catalytic, TM and cytoplasmic tail region
Probab=24.72  E-value=93  Score=30.53  Aligned_cols=31  Identities=19%  Similarity=0.119  Sum_probs=25.2

Q ss_pred             cCCCCCcceehhhHHHHHHHHHHHHHHHHHH
Q 002185          872 KYGLSGGMIAIVVLSAFVAVVLCSAAAWVLL  902 (955)
Q Consensus       872 KkgLSkGaIAGIVLGSVVlVVLLsAaa~LLL  902 (955)
                      +..+--+-|+-|.|.++++++-|++.+.||+
T Consensus        12 sGsL~PWeIfLItLasVvvavGl~aGLfFcv   42 (106)
T PF14654_consen   12 SGSLKPWEIFLITLASVVVAVGLFAGLFFCV   42 (106)
T ss_pred             CCCccchHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            4567778899999988888888888877885


No 108
>COG4736 CcoQ Cbb3-type cytochrome oxidase, subunit 3 [Posttranslational modification, protein turnover, chaperones]
Probab=24.63  E-value=71  Score=28.59  Aligned_cols=25  Identities=4%  Similarity=0.049  Sum_probs=13.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhccccc
Q 002185          885 LSAFVAVVLCSAAAWVLLFKYKSHAC  910 (955)
Q Consensus       885 LGSVVlVVLLsAaa~LLLLRRRRR~s  910 (955)
                      +|.+++.+++++++ ++++|+++|..
T Consensus        13 ~~t~~~~l~fiavi-~~ayr~~~K~~   37 (60)
T COG4736          13 WGTIAFTLFFIAVI-YFAYRPGKKGE   37 (60)
T ss_pred             HHHHHHHHHHHHHH-HHHhcccchhh
Confidence            45555555555554 44455555543


No 109
>COG4980 GvpP Gas vesicle protein [General function prediction only]
Probab=24.59  E-value=40  Score=33.36  Aligned_cols=19  Identities=0%  Similarity=0.172  Sum_probs=14.2

Q ss_pred             CCcceehhhHHHHHHHHHH
Q 002185          876 SGGMIAIVVLSAFVAVVLC  894 (955)
Q Consensus       876 SkGaIAGIVLGSVVlVVLL  894 (955)
                      .+.+++||.||+++++++-
T Consensus         4 ~~~~l~G~liGgiiGa~aa   22 (115)
T COG4980           4 GKDFLFGILIGGIIGAAAA   22 (115)
T ss_pred             cchHHHHHHHHHHHHHHHH
Confidence            3567889999988876654


No 110
>PRK05886 yajC preprotein translocase subunit YajC; Validated
Probab=24.07  E-value=50  Score=32.28  Aligned_cols=16  Identities=6%  Similarity=-0.014  Sum_probs=8.0

Q ss_pred             HHHHHHHHHHHHHHhh
Q 002185          890 AVVLCSAAAWVLLFKY  905 (955)
Q Consensus       890 lVVLLsAaa~LLLLRR  905 (955)
                      .+++++++.||+++|.
T Consensus         9 ~lv~i~~i~yF~~iRP   24 (109)
T PRK05886          9 PFLLIMGGFMYFASRR   24 (109)
T ss_pred             HHHHHHHHHHHHHccH
Confidence            3344445556665543


No 111
>PF06040 Adeno_E3:  Adenovirus E3 protein;  InterPro: IPR009266 This family consists of several Adenovirus E3 proteins. The E3 protein does not seem to be essential for virus replication in cultured cells suggesting that the protein may function in virus-host interactions [].
Probab=24.06  E-value=30  Score=34.53  Aligned_cols=15  Identities=33%  Similarity=0.363  Sum_probs=10.8

Q ss_pred             cceehhhHHHHHHHH
Q 002185          878 GMIAIVVLSAFVAVV  892 (955)
Q Consensus       878 GaIAGIVLGSVVlVV  892 (955)
                      -+|.|+|+|+.++++
T Consensus        89 ~l~LGvV~GG~i~vL  103 (127)
T PF06040_consen   89 YLILGVVAGGLIAVL  103 (127)
T ss_pred             hhhHHHHhccHHHHH
Confidence            467788888776665


No 112
>COG2181 NarI Nitrate reductase gamma subunit [Energy production and conversion]
Probab=23.80  E-value=68  Score=35.01  Aligned_cols=25  Identities=20%  Similarity=0.313  Sum_probs=18.5

Q ss_pred             eehhhHHHHHHHHHHHHHHHHHHHh
Q 002185          880 IAIVVLSAFVAVVLCSAAAWVLLFK  904 (955)
Q Consensus       880 IAGIVLGSVVlVVLLsAaa~LLLLR  904 (955)
                      ++.|++|+++++++|++++.++++|
T Consensus        87 ~~ai~~G~iaGv~~liG~~~L~~RR  111 (228)
T COG2181          87 LMAIVLGGIAGVLTLIGLTLLLLRR  111 (228)
T ss_pred             ceeeehhhHHHHHHHHHHHHHHHHH
Confidence            4566788999999998887555433


No 113
>KOG3637 consensus Vitronectin receptor, alpha subunit [Extracellular structures]
Probab=23.23  E-value=63  Score=41.48  Aligned_cols=27  Identities=26%  Similarity=0.341  Sum_probs=18.4

Q ss_pred             cceehhhHHHHHHHHHHHHHHHHHHHhh
Q 002185          878 GMIAIVVLSAFVAVVLCSAAAWVLLFKY  905 (955)
Q Consensus       878 GaIAGIVLGSVVlVVLLsAaa~LLLLRR  905 (955)
                      .-|-.|++++++++++|+++ +++|||+
T Consensus       976 vp~wiIi~svl~GLLlL~ll-v~~LwK~ 1002 (1030)
T KOG3637|consen  976 VPLWIIILSVLGGLLLLALL-VLLLWKC 1002 (1030)
T ss_pred             cceeeehHHHHHHHHHHHHH-HHHHHhc
Confidence            34677777777777666555 5776888


No 114
>PRK01658 holin-like protein; Validated
Probab=22.95  E-value=60  Score=31.97  Aligned_cols=31  Identities=23%  Similarity=0.172  Sum_probs=14.6

Q ss_pred             cceehhhHHHHHHHHHHHHHHHHHHHhhccc
Q 002185          878 GMIAIVVLSAFVAVVLCSAAAWVLLFKYKSH  908 (955)
Q Consensus       878 GaIAGIVLGSVVlVVLLsAaa~LLLLRRRRR  908 (955)
                      ..|+++++.+.++++++.+.+.-++.||++|
T Consensus        89 ~~il~~ivvsT~l~l~vtg~~~~~l~~~~~~  119 (122)
T PRK01658         89 ISLFLVVVISTFVVMIVTGYLTQLLAKRKER  119 (122)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhhcc
Confidence            4455555545555555555443333444443


No 115
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms]
Probab=22.93  E-value=49  Score=42.19  Aligned_cols=27  Identities=11%  Similarity=0.159  Sum_probs=16.9

Q ss_pred             ceehhhHHHHHHHHHHHHHHHHHHHhh
Q 002185          879 MIAIVVLSAFVAVVLCSAAAWVLLFKY  905 (955)
Q Consensus       879 aIAGIVLGSVVlVVLLsAaa~LLLLRR  905 (955)
                      .++++++|++++++++.+...+++.||
T Consensus       629 ~~~~~viG~~Ll~~~~~~~~~~~~~~r  655 (1177)
T KOG1025|consen  629 ATAIAVIGGLLLAFFVFLGFSLYMCRR  655 (1177)
T ss_pred             hhHHHHHHHHHHHHHHHHHHHHhhhhh
Confidence            566777887777766665554554443


No 116
>KOG3540 consensus Beta amyloid precursor protein [General function prediction only]
Probab=22.80  E-value=56  Score=39.18  Aligned_cols=33  Identities=12%  Similarity=0.253  Sum_probs=21.6

Q ss_pred             CCCCCcceehhhHHHHHHHHHHHHHHHHHHHhhcc
Q 002185          873 YGLSGGMIAIVVLSAFVAVVLCSAAAWVLLFKYKS  907 (955)
Q Consensus       873 kgLSkGaIAGIVLGSVVlVVLLsAaa~LLLLRRRR  907 (955)
                      -+.|.++|+|..+++++++.+|++.  |+++|+|+
T Consensus       543 ~~~s~~av~gllv~~~~i~tvivis--l~mlrkr~  575 (615)
T KOG3540|consen  543 VGRSASAVIGLLVSAVFIATVIVIS--LVMLRKRQ  575 (615)
T ss_pred             ccccHHHHHHHHHHHHHHHHHHHHH--HHHHcccc
Confidence            4668889999888777766555443  44455443


No 117
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional
Probab=22.72  E-value=84  Score=38.44  Aligned_cols=31  Identities=10%  Similarity=0.051  Sum_probs=18.2

Q ss_pred             CcceehhhHHHHHHHHHHHHHHHHHHHhhcc
Q 002185          877 GGMIAIVVLSAFVAVVLCSAAAWVLLFKYKS  907 (955)
Q Consensus       877 kGaIAGIVLGSVVlVVLLsAaa~LLLLRRRR  907 (955)
                      ...+..++++++++++++++++++++++|||
T Consensus       625 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  655 (968)
T PLN00113        625 TPSWWFYITCTLGAFLVLALVAFGFVFIRGR  655 (968)
T ss_pred             cceeeeehhHHHHHHHHHHHHHHHHHHHHhh
Confidence            3467777776666666666655555444433


No 118
>PF04156 IncA:  IncA protein;  InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion. The inclusion is nonfusogenic with lysosomes but intercepts lipids from a host cell exocytic pathway. Initiation of chlamydial development is concurrent with modification of the inclusion membrane by a set of C. trachomatis-encoded proteins collectively designated Incs. One of these Incs, IncA (Inclusion membrane protein A), is functionally associated with the homotypic fusion of inclusions [].
Probab=22.49  E-value=57  Score=32.73  Aligned_cols=17  Identities=12%  Similarity=0.108  Sum_probs=8.3

Q ss_pred             HHHHHHHHHHHHHhhcc
Q 002185          891 VVLCSAAAWVLLFKYKS  907 (955)
Q Consensus       891 VVLLsAaa~LLLLRRRR  907 (955)
                      .++|++++++|+++++.
T Consensus        49 g~vL~~~g~~~~~~~~~   65 (191)
T PF04156_consen   49 GVVLLSLGLLCLLSKRP   65 (191)
T ss_pred             HHHHHHHHHHHHHHccc
Confidence            34455555555444443


No 119
>PF03988 DUF347:  Repeat of Unknown Function (DUF347) ;  InterPro: IPR007136 This repeat is found as four tandem repeats in a family of bacterial membrane proteins. Each repeat contains two transmembrane regions and a conserved tryptophan.
Probab=22.47  E-value=98  Score=26.54  Aligned_cols=18  Identities=11%  Similarity=0.117  Sum_probs=9.3

Q ss_pred             ehhhHHHHHHHHHHHHHH
Q 002185          881 AIVVLSAFVAVVLCSAAA  898 (955)
Q Consensus       881 AGIVLGSVVlVVLLsAaa  898 (955)
                      .|-.+++++.++++++++
T Consensus        27 lg~~~~~~~~~~~l~~~~   44 (55)
T PF03988_consen   27 LGYLISTLIFAALLAVVL   44 (55)
T ss_pred             ccHHHHHHHHHHHHHHHH
Confidence            444555555555554443


No 120
>PF11446 DUF2897:  Protein of unknown function (DUF2897);  InterPro: IPR021550  This is a bacterial family of uncharacterised proteins. 
Probab=22.43  E-value=48  Score=28.99  Aligned_cols=17  Identities=18%  Similarity=0.411  Sum_probs=9.5

Q ss_pred             CCcceehhhHHHHHHHH
Q 002185          876 SGGMIAIVVLSAFVAVV  892 (955)
Q Consensus       876 SkGaIAGIVLGSVVlVV  892 (955)
                      ..++|+.||+|.|++=+
T Consensus         4 ~~wlIIviVlgvIigNi   20 (55)
T PF11446_consen    4 NPWLIIVIVLGVIIGNI   20 (55)
T ss_pred             hhhHHHHHHHHHHHhHH
Confidence            44566666666555433


No 121
>TIGR01495 ETRAMP Plasmodium ring stage membrane protein ETRAMP. These genes have been shown to be found in the sub-telomeric regions of both P. falciparum and P. yoelii chromosomes.
Probab=22.28  E-value=72  Score=30.02  Aligned_cols=21  Identities=5%  Similarity=-0.137  Sum_probs=10.4

Q ss_pred             cceehhhHHHHHHHHHHHHHH
Q 002185          878 GMIAIVVLSAFVAVVLCSAAA  898 (955)
Q Consensus       878 GaIAGIVLGSVVlVVLLsAaa  898 (955)
                      .+|.+|+.|..+++.+.+|++
T Consensus        52 i~iS~ias~la~lv~t~~G~g   72 (85)
T TIGR01495        52 ILYSSIASGLALLVGAGVGLG   72 (85)
T ss_pred             eehHHHHHHHHHHHHHHHHHh
Confidence            444555555444444555544


No 122
>PF02699 YajC:  Preprotein translocase subunit;  InterPro: IPR003849 Secretion across the inner membrane in some Gram-negative bacteria occurs via the preprotein translocase pathway. Proteins are produced in the cytoplasm as precursors, and require a chaperone subunit to direct them to the translocase component []. From there, the mature proteins are either targeted to the outer membrane, or remain as periplasmic proteins []. The translocase protein subunits are encoded on the bacterial chromosome.  The translocase itself comprises 7 proteins, including a chaperone (SecB), ATPase (SecA), an integral membrane complex (SecY, SecE and SecG), and two additional membrane proteins that promote the release of the mature peptide into the periplasm (SecD and SecF) []. Other cytoplasmic/periplasmic proteins play a part in preprotein translocase activity, namely YidC and YajC []. The latter is bound in a complex to SecD and SecF, and plays a part in stabilising and regulating secretion through the SecYEG integral membrane component via SecA [].  Homologues of the YajC gene have been found in a range of pathogenic and commensal microbes. Brucella abortis YajC- and SecD-like proteins were shown to stimulate a Th1 cell-mediated immune response in mice, and conferred protection when challenged with B.abortis []. Therefore, these proteins may have an antigenic role as well as a secretory one in virulent bacteria []. A number of previously uncharacterised "hypothetical" proteins also show similarity to E.coli YajC, suggesting that this family is wider than first thought [].  More recently, the precise interactions between the E.coli SecYEG complex, SecD, SecF, YajC and YidC have been studied []. Rather than acting individually, the four proteins form a heterotetrameric complex and associate with the SecYEG heterotrimeric complex []. The SecF and YajC subunits link the complex to the integral membrane translocase. ; PDB: 2RDD_B.
Probab=21.98  E-value=55  Score=29.93  Aligned_cols=20  Identities=10%  Similarity=0.316  Sum_probs=9.7

Q ss_pred             HHHHHHHHHHHHHHHHHhhc
Q 002185          887 AFVAVVLCSAAAWVLLFKYK  906 (955)
Q Consensus       887 SVVlVVLLsAaa~LLLLRRR  906 (955)
                      .++.+++++++.+|+++|..
T Consensus         4 ~li~lv~~~~i~yf~~~rpq   23 (82)
T PF02699_consen    4 MLIPLVIIFVIFYFLMIRPQ   23 (82)
T ss_dssp             HHHHHHHHHHHHHHHTHHHH
T ss_pred             HHHHHHHHHHHHhhheecHH
Confidence            34444455555555555433


No 123
>PRK14750 kdpF potassium-transporting ATPase subunit F; Provisional
Probab=21.83  E-value=57  Score=25.75  Aligned_cols=12  Identities=25%  Similarity=0.052  Sum_probs=4.7

Q ss_pred             HHHHHHHHHHHH
Q 002185          891 VVLCSAAAWVLL  902 (955)
Q Consensus       891 VVLLsAaa~LLL  902 (955)
                      +++|++-.++.+
T Consensus        12 v~lLl~YLvYAL   23 (29)
T PRK14750         12 VLLLLGYLVYAL   23 (29)
T ss_pred             HHHHHHHHHHHH
Confidence            333434333443


No 124
>PF05770 Ins134_P3_kin:  Inositol 1, 3, 4-trisphosphate 5/6-kinase;  InterPro: IPR008656 This entry represents inositol-tetrakisphosphate 1-kinase which is also called inositol 1,3,4-trisphosphate 5/6-kinase. Inositol-tetrakisphosphate 1-kinase can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3. This enzyme phosphorylates Ins(3,4,5,6)P4 at position 1 to form Ins(1,3,4,5,6)P5. This reaction is thought to have regulatory importance, since Ins(3,4,5,6)P4 is an inhibitor of plasma membrane Ca(2+)-activated Cl(-) channels, while Ins(1,3,4,5,6)P5 is not. It also phosphorylates Ins(1,3,4)P3 on O-5 and O-6 to form Ins(1,3,4,6)P4, an essential molecule in the hexakisphosphate (InsP6) pathway [, , , , ].; GO: 0000287 magnesium ion binding, 0005524 ATP binding, 0047325 inositol tetrakisphosphate 1-kinase activity, 0052725 inositol-1,3,4-trisphosphate 6-kinase activity, 0052726 inositol-1,3,4-trisphosphate 5-kinase activity, 0032957 inositol trisphosphate metabolic process, 0005622 intracellular; PDB: 1Z2P_X 1Z2O_X 1Z2N_X 2Q7D_A 2QB5_B 2ODT_X.
Probab=21.78  E-value=2e+02  Score=32.54  Aligned_cols=51  Identities=20%  Similarity=0.163  Sum_probs=33.0

Q ss_pred             chHHHHHHHHHhccCcccccEEEeceecCCCCCcEEEEEEeecCCcccchHH
Q 002185          748 PLVSELAGEIAAGVFMKQSQVRIIGANAAEQPDKTVVLTDLVPLGEKFDNTT  799 (955)
Q Consensus       748 Py~SELEsELASgL~L~vSQV~I~Nf~wesgPrkL~VtLdLFPsGdsFNnTE  799 (955)
                      ..+.++...|-..|||+...+.|.--.... .++..|+|+.||..+.+.+-+
T Consensus       248 ~~v~~la~~LR~~lgL~LFgfDvI~~~~t~-~~~~VIDINyFPgY~~vp~f~  298 (307)
T PF05770_consen  248 ELVEKLAKELRRALGLTLFGFDVIRENGTG-GRYYVIDINYFPGYKKVPDFE  298 (307)
T ss_dssp             HHHHHHHHHHHHHHT-SEEEEEEEEGCCT--SSEEEEEEEES--TTTSCTHH
T ss_pred             HHHHHHHHHHHHHhCcceeeeEEEEEcCCC-CcEEEEEeccCCCccCCCChH
Confidence            345677778888889988887776433332 367999999999665554433


No 125
>PF04277 OAD_gamma:  Oxaloacetate decarboxylase, gamma chain ;  InterPro: IPR005899  This family comprises distantly related, low complexity, hydrophobic small subunits of several related sodium ion-pumping decarboxylases. These include oxaloacetate decarboxylase gamma subunit and methylmalonyl-CoA decarboxylase delta subunit [].; GO: 0008948 oxaloacetate decarboxylase activity, 0015081 sodium ion transmembrane transporter activity, 0071436 sodium ion export, 0016020 membrane
Probab=21.76  E-value=83  Score=27.72  Aligned_cols=21  Identities=14%  Similarity=0.188  Sum_probs=10.2

Q ss_pred             hhhHHHHHHHHHHHHHHHHHH
Q 002185          882 IVVLSAFVAVVLCSAAAWVLL  902 (955)
Q Consensus       882 GIVLGSVVlVVLLsAaa~LLL  902 (955)
                      .+.+|.|+++++++.+++.++
T Consensus         9 i~Gm~iVF~~L~lL~~~i~l~   29 (79)
T PF04277_consen    9 IIGMGIVFLVLILLILVISLM   29 (79)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            333555555555555444443


No 126
>COG3889 Predicted solute binding protein [General function prediction only]
Probab=21.71  E-value=72  Score=40.09  Aligned_cols=24  Identities=25%  Similarity=0.191  Sum_probs=11.9

Q ss_pred             hhhHHHHHHHHHHHHHHHHHHHhhc
Q 002185          882 IVVLSAFVAVVLCSAAAWVLLFKYK  906 (955)
Q Consensus       882 GIVLGSVVlVVLLsAaa~LLLLRRR  906 (955)
                      |-++|.++++++|+++. |+++|||
T Consensus       848 ~~i~g~i~iiv~LaAla-~lLrRRr  871 (872)
T COG3889         848 GGICGPIVIIVGLAALA-LLLRRRR  871 (872)
T ss_pred             cccchHHHHHHHHHHHH-HHHHhhc
Confidence            33445555555565554 4434443


No 127
>PF13706 PepSY_TM_3:  PepSY-associated TM helix
Probab=21.35  E-value=86  Score=24.97  Aligned_cols=23  Identities=17%  Similarity=0.238  Sum_probs=16.8

Q ss_pred             ceehhhHHHHHHHHHHHHHHHHH
Q 002185          879 MIAIVVLSAFVAVVLCSAAAWVL  901 (955)
Q Consensus       879 aIAGIVLGSVVlVVLLsAaa~LL  901 (955)
                      .++||++|.+++++.+.+++.++
T Consensus         9 ~W~Gl~~g~~l~~~~~tG~~~~f   31 (37)
T PF13706_consen    9 RWLGLILGLLLFVIFLTGAVMVF   31 (37)
T ss_pred             HHHHHHHHHHHHHHHHHhHHHHH
Confidence            36788998888877777765443


No 128
>PF12669 P12:  Virus attachment protein p12 family
Probab=20.95  E-value=67  Score=28.08  Aligned_cols=8  Identities=13%  Similarity=0.015  Sum_probs=3.2

Q ss_pred             Hhhccccc
Q 002185          903 FKYKSHAC  910 (955)
Q Consensus       903 LRRRRR~s  910 (955)
                      ++..|+.+
T Consensus        18 r~~~k~~K   25 (58)
T PF12669_consen   18 RKFIKDKK   25 (58)
T ss_pred             HHHHHHhh
Confidence            44443433


No 129
>PF06305 DUF1049:  Protein of unknown function (DUF1049);  InterPro: IPR010445 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=20.83  E-value=68  Score=27.28  Aligned_cols=10  Identities=20%  Similarity=0.580  Sum_probs=4.1

Q ss_pred             CCCcceehhh
Q 002185          875 LSGGMIAIVV  884 (955)
Q Consensus       875 LSkGaIAGIV  884 (955)
                      ++.++++.|+
T Consensus        18 ~pl~l~il~~   27 (68)
T PF06305_consen   18 LPLGLLILIA   27 (68)
T ss_pred             chHHHHHHHH
Confidence            3444444333


No 130
>PF13268 DUF4059:  Protein of unknown function (DUF4059)
Probab=20.81  E-value=93  Score=28.91  Aligned_cols=24  Identities=25%  Similarity=0.393  Sum_probs=13.7

Q ss_pred             HHHHHHHHHHHHhhcccccccccC
Q 002185          892 VLCSAAAWVLLFKYKSHACQAEEV  915 (955)
Q Consensus       892 VLLsAaa~LLLLRRRRR~sqa~e~  915 (955)
                      +++++.+|++++..||+.+..+|+
T Consensus        20 V~~~~~~wi~~Ra~~~~DKT~~eR   43 (72)
T PF13268_consen   20 VLLVSGIWILWRALRKKDKTAKER   43 (72)
T ss_pred             HHHHHHHHHHHHHHHcCCCcHHHH
Confidence            344455677766555555555554


No 131
>PF09472 MtrF:  Tetrahydromethanopterin S-methyltransferase, F subunit (MtrF);  InterPro: IPR013347  Many archaea have evolved energy-yielding pathways marked by one-carbon biochemistry featuring novel cofactors and enzymes. This domain is mostly found in MtrF, where it covers the entire length of the protein. This polypeptide is one of eight subunits of the N5-methyltetrahydromethanopterin: coenzyme M methyltransferase complex found in methanogenic archaea. This is a membrane-associated enzyme complex that uses methyl-transfer reactions to drive a sodium-ion pump []. MtrF itself is involved in the transfer of the methyl group from N5-methyltetrahydromethanopterin to coenzyme M. Subsequently, methane is produced by two-electron reduction of the methyl moiety in methyl-coenzyme M by another enzyme, methyl-coenzyme M reductase. In some organisms this domain is found at the C-terminal region of what appears to be a fusion of the MtrA and MtrF proteins [, ]. The function of these proteins is unknown, though it is likely that they are involved in C1 metabolism.; GO: 0030269 tetrahydromethanopterin S-methyltransferase activity, 0015948 methanogenesis, 0016020 membrane
Probab=20.79  E-value=60  Score=29.37  Aligned_cols=26  Identities=19%  Similarity=0.181  Sum_probs=17.2

Q ss_pred             CCCCCcceehhhHHHHHHHHHHHHHH
Q 002185          873 YGLSGGMIAIVVLSAFVAVVLCSAAA  898 (955)
Q Consensus       873 kgLSkGaIAGIVLGSVVlVVLLsAaa  898 (955)
                      +|+...-+.|.++|.++++++++.-+
T Consensus        35 SGv~~~~~~GfaiG~~~AlvLv~ip~   60 (64)
T PF09472_consen   35 SGVMATGIKGFAIGFLFALVLVGIPI   60 (64)
T ss_pred             HHHhhhhhHHHHHHHHHHHHHHHHHH
Confidence            45666667888888777666554443


No 132
>PHA03049 IMV membrane protein; Provisional
Probab=20.41  E-value=1.5e+02  Score=27.35  Aligned_cols=14  Identities=14%  Similarity=0.413  Sum_probs=6.5

Q ss_pred             HHHHHHHHHHHHHH
Q 002185          886 SAFVAVVLCSAAAW  899 (955)
Q Consensus       886 GSVVlVVLLsAaa~  899 (955)
                      |-++++++|++++.
T Consensus         3 ~d~~l~iICVaIi~   16 (68)
T PHA03049          3 GDIILVIICVVIIG   16 (68)
T ss_pred             HHHHHHHHHHHHHH
Confidence            34444555554443


No 133
>PF05399 EVI2A:  Ectropic viral integration site 2A protein (EVI2A);  InterPro: IPR008608 This family contains several mammalian ectropic viral integration site 2A (EVI2A) proteins. The function of this protein is unknown although it is thought to be a membrane protein and may function as an oncogene in retrovirus induced myeloid tumours [, ].; GO: 0016021 integral to membrane
Probab=20.40  E-value=88  Score=34.12  Aligned_cols=21  Identities=5%  Similarity=0.129  Sum_probs=9.0

Q ss_pred             Ccceeh-hhHHHHHHHHHHHHH
Q 002185          877 GGMIAI-VVLSAFVAVVLCSAA  897 (955)
Q Consensus       877 kGaIAG-IVLGSVVlVVLLsAa  897 (955)
                      ..++|+ |+||++|++-.|+.+
T Consensus       128 ~amLIClIIIAVLfLICT~LfL  149 (227)
T PF05399_consen  128 MAMLICLIIIAVLFLICTLLFL  149 (227)
T ss_pred             hhHHHHHHHHHHHHHHHHHHHH
Confidence            344444 335554444333333


No 134
>PF08114 PMP1_2:  ATPase proteolipid family;  InterPro: IPR012589 This family consists of small proteolipids associated with the plasma membrane H+ ATPase. Two proteolipids (PMP1 and PMP2) are associated with the ATPase and both genes are similarly expressed in the wild-type strain of yeast. No modification of the level of transcription of one PMP gene is detected in a strain deleted of the other. Though both proteolipids show similarity with other small proteolipids associated with other cation -transporting ATPases, their functions remain unclear [].
Probab=20.27  E-value=1.4e+02  Score=25.43  Aligned_cols=10  Identities=40%  Similarity=0.840  Sum_probs=5.1

Q ss_pred             CCCcceehhh
Q 002185          875 LSGGMIAIVV  884 (955)
Q Consensus       875 LSkGaIAGIV  884 (955)
                      +-.|+|...+
T Consensus         6 lp~GVIlVF~   15 (43)
T PF08114_consen    6 LPGGVILVFC   15 (43)
T ss_pred             CCCCeeeehH
Confidence            3455665544


No 135
>PF05795 Plasmodium_Vir:  Plasmodium vivax Vir protein;  InterPro: IPR008780 This family consists of several Vir proteins specific to the genus Plasmodium and Plasmodium vivax in particular. The vir genes are present at about 600-1,000 copies per haploid genome and encode proteins that are immunovariant in natural infections, indicating that they may have a functional role in establishing chronic infection through antigenic variation [].
Probab=20.16  E-value=1.2e+02  Score=32.34  Aligned_cols=22  Identities=14%  Similarity=0.030  Sum_probs=9.6

Q ss_pred             CCcceehhhHHHHHHHHHHHHHH
Q 002185          876 SGGMIAIVVLSAFVAVVLCSAAA  898 (955)
Q Consensus       876 SkGaIAGIVLGSVVlVVLLsAaa  898 (955)
                      ....|.+++ +++++++.+.+++
T Consensus       277 ~s~~~~~~v-~~~~~~~G~~~~~  298 (354)
T PF05795_consen  277 ISNPFSTSV-SPVLSVLGIPLIF  298 (354)
T ss_pred             cCcccccch-hhhhhhHHHHHHH
Confidence            334455544 3444444444443


Done!