Citrus Sinensis ID: 002235

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------95

MEKSCTLLIHFDKGTPAIANEIKEALEGNDVPAKVDAMKKAIMLLLNGETLPQLFITIVRYVLPSEDHTIQKLLLLYLEIIDKTDAKGRVLPEMILICQNLRNNLQHPNEYIRGVTLRFLCRLNETEIIEPLIPSVLQNLQHRHPYIRRNAILAVMAIYKLPQGEQLLVDAPEMIEKVLSTEQDPSAKRNAFLMLFTCDQDRAINYLLTHVDRVSEWGELLQMVVLELIRKVCRTNKGEKGKYIKIIISLLNAPSTAVIYECAGTLVSLSSAPTAIRAAANTYSQLLLSQSDNNVKLIVLDRLNELRSSHRDIMVDLIMDVLRALNSPNLDIRRKTLDIVLELITPRNINEVVLMLKKEVVKTQSGELEKNGEYRQMLIQAIHSCAIKFPEVASTVVHLLMDFLGDSNVASAIDVIIFVREIIEMNPKLRVSIITRLLDNFYQIRAARVCTCALWIIGEYCQSLSEVENGIATIKQCLGELPFFSVSEEGEDTDSSKKVQQQASSTTVSSRRPAVLADGTYATQSAASETAFSPPTIVQGTLTSGNLRSLLLTGDFFLGAVVACTLTKLVLRLEEVQPSRVEVNKASSQALLIMVSMLQLGQSPVLPHPIDNDSFDRIVVCIRLLCNTGDNIRKIWLQSCRQSFVKMLSEKQLRESEELKAKAQISHAQPDDLIDFYHLKSRKGMSQLELEDEVQDDLKRATGEFVKEGDDANKLNRILQLTGFSDPVYAEAYVTVHHYDIVLDVTVINRTKETLQNLCLELATMGDLKLVERPQNYTLAPESSKQIKANIKVSSTETGVIFGNIVYETSNVLERTVVVLNDIHIDIMDYISPAVCTDAAFRTMWAEFEWENKVAVNTVIQDEKEFLDHIIKSTNMKCLTAPSALDGDCGFLAANLYAKSVFGEDALVNVSIEKQTDGKLSGYIRIRSKTQGIALSLGDKITLKQKGGS

cccccEEEEECcccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccccccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHcccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHcccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcHHHHHHHHHHEEEEcccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcHHcHHHHHHHHHHHHHHcHHHHHHHHHEEEEEEcccccccHHHHHHHHHHHcccccccccccccccccccHHHHHHccccccccccccccccccHHHHHHcccccccccccccccccccccHHHHcccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHccccccccccHHHcccccccccccccEEEEEEEEEEEEEEEEEEEEEEccccccccEEEEEEEcccCEEEccccccccccccCEEEEEEEEEEEccccEEEEEEEEcccccccccEEEccccccccccccccccccHHHHHHHcccccccEEEEEccccccHHHHHHHHHHHcccccccccccccccccEEEEEHHccccccccEEEEEEEEEcccccEEEEEEEEEccccEEEEcccHHHHHHcccc

**KSCTLLIHFDKGTPAIANEIKEALEGNDVPAKVDAMKKAIMLLLNGETLPQLFITIVRYVLPSEDHTIQKLLLLYLEIIDKTDAKGRVLPEMILICQNLRNNLQHPNEYIRGVTLRFLCRLNETEIIEPLIPSVLQNLQHRHPYIRRNAILAVMAIYKLPQGEQLLVDAPEMIEKVLSTEQDPSAKRNAFLMLFTCDQDRAINYLLTHVDRVSEWGELLQMVVLELIRKVCRTNKGEKGKYIKIIISLLNAPSTAVIYECAGTLVSLSSAPTAIRAAANTYSQLLLSQSDNNVKLIVLDRLNELRSSHRDIMVDLIMDVLRALNSPNLDIRRKTLDIVLELITPRNINEVVLMLKKEVVKTQSGELEKNGEYRQMLIQAIHSCAIKFPEVASTVVHLLMDFLGDSNVASAIDVIIFVREIIEMNPKLRVSIITRLLDNFYQIRAARVCTCALWIIGEYCQSLSEVENGIATIKQCLGELPFFS******************************LADGTYATQSAASE*************TSGNLRSLLLTGDFFLGAVVACTLTKLVLRLEEVQPSRVEVNKASSQALLIMVSMLQLGQSPVLPHPIDNDSFDRIVVCIRLLCNTGDNIRKIWLQSCRQSFVKML**********************DDLIDFYHLKS**********DEVQDDLK************ANKLNRILQLTGFSDPVYAEAYVTVHHYDIVLDVTVINRTKETLQNLCLELATMGDLKLVERPQNYTLAPESSKQIKANIKVSSTETGVIFGNIVYETSNVLERTVVVLNDIHIDIMDYISPAVCTDAAFRTMWAEFEWENKVAVNTVIQDEKEFLDHIIKSTNMKCLTAPSALDGDCGFLAANLYAKSVFGEDALVNVSIEKQTDGKLSGYIRIRSKTQGIALSLGDKITLKQK***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Coatomer subunit beta-1	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins.	confident	Q9SV21
Coatomer subunit beta-2	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins.	confident	Q9SV20
Coatomer subunit beta-1	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins.	confident	Q53PC7

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VGL, chain B
Confidence level:very confident
Coverage over the Query: 14-474
View the alignment between query and template
View the model in PyMOL

Template: 1R4X, chain A
Confidence level:very confident
Coverage over the Query: 708-937
View the alignment between query and template
View the model in PyMOL

Template: 2Z6H, chain A
Confidence level:confident
Coverage over the Query: 16-481
View the alignment between query and template
View the model in PyMOL

Template: 3LVG, chain D
Confidence level:probable
Coverage over the Query: 630-711
View the alignment between query and template
View the model in PyMOL