Citrus Sinensis ID: 002271


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940----
MQEVTFRVDYAVPNIGREFGTVILGDKNVAMLVVSEGWAKVKEQGSQKGEASPFLAELLRLEEQAKLQGLGRWSKVPGAAEASIRNLPPSAIGDSSNFNAMALLDANKGRPMQGIVEQARDGSTLRVYLLPEFQFVQVFVAGIQAPAVARRPAAIVDTDTEETNGDVSAAEAVAPLNSAQRLAASTASAGQQSTDEPFALDAKYFTEMRVLNREVRIVLEGVDKFKNLIGSVFYPDGETAKDLAMELVENGLAKYIEWSANMMEEDAKRRLKAADLQAKKTRLRMWTNYVPPQSNSKAIHDQNFTGKVVEVVSGDCIIVADDSIPYGNALAERRVNLSSIRCPKIGNPRKDEKPAAYAREAREFLRTRLIGRQVNVQMEYSRKVVVEAAPVAAGAKGPAGTKGPAGTKGQAAAKGPAGEESVGATETRIIDFGSIFLLSPIKGEGDDASAVAQSNAAGQPAGVNVAELVVSRGLGNVINHRDFEERSNYYDALLAAEARAKAGKKGCYSSKEPPVMHIQDLTMAPVKKARDFLPFLQRSRRIPAVVEYVLSGHRFKVLIPKETCSIAFSFSGVRCPGRNERYSNEALLLMRQKILQRDVEIEVETVDRTGTFLGSLWESRTNVAVILLEAGLAKLQTSFGSDRIPDSHLLEQAEKSAKSQKLKIWENYVEGEEVSNGAAVEGKQKEVLKVVVTEILGGGKFYVQQVGDQKVASVQQQLASLNLQEAPVIGAFNPKKGEIVLAQFSADNSWNRAMIVNAPREKVESVNDKFEVFYIDYGNQELVPYNKLRPIDPSLSSTPPLAQLCSLAYIKIPALEDEYGPEAAEFLNEHTYNSSNEFRALVEERDSSGGKLKGQGTGTLLHVTLVAVDAEISINTLMVQEGLARVERRKRWGSRDRQAALENLEKFQEEAKTARIGMWQYGDIQSDDEDPLPSAVRKVAGGRR
ccEEEEEEEEECcccccEEEEEEEccccHHHHHHHcccEEEEccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHccccCCcEEEEEEccccEEEEEEccccEEEEEEEEcccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccHHHHHHHHHHHHccccEEEEEEEEEcccccEEEEEECccccccccHHHHHHHcccEEEEEcccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccEEEEEEEEEEccEEEEEccccccccccccEEEEEECccccccccccccccccHHHHHHHHHHHHHccccEEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccEEEcccccEEccccccccccccccHcccccccccccccHHHHHHHcccCEEEEccccccccHHHHHHHHHHHHHHHccccccccccccccEEECcccccHHHHHHHHHHHHHcccccEEEEEEccccEEEEEcccccccccccccccccccccccccHHHHHHHHHHHccccEEEEEEEEcccccEEEEEEcccccHHHHHHHccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEEEEEEEEccEEEEEEcccccHHHHHHHHHHHHHcccccccccccccccEEEEEEcccccEEEEEEEECccccccccccEEEEEEEEccccCECcccccccccccccccccccEEEEcccEEcccccccccHHHHHHHHHHHccccccEEEEEEECcccccEECccccccEEEEEEEcccccccHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccc
MQEVTFRVDYAVPNIGREFGTVILGDKNVAMLVVSEGWAKVK************LAELLRL*****LQGLGRWSKVPGAAEASIRNLPPSAIGDSSNFNAMALLDANKGRPMQGIVEQARDGSTLRVYLLPEFQFVQVFVAGIQAPAVA*******************AAEAVAPLNSA***************DEPFALDAKYFTEMRVLNREVRIVLEGVDKFKNLIGSVFYPDGETAKDLAMELVENGLAKYIEWSANMMEEDAKR*LKAADLQAKKTRLRMWTNYVP******AIHDQNFTGKVVEVVSGDCIIVADDSIPYGNALAERRVNLSSIRCP**************AREAREFLRTRLIGRQVNVQMEYSRKVVVEAA*******GPAGTKGPAGTKGQAAAKGPAGEESVGATETRIIDFGSIFLLSPIK****************QPAGVNVAELVVSRGLGNVINHRDFEERSNYYDALLAAEA****************VMHIQDLTMAPVKKARDFLPFLQRSRRIPAVVEYVLSGHRFKVLIPKETCSIAFSFSGVRCPGRNERYSNEALLLMRQKILQRDVEIEVETVDRTGTFLGSLWESRTNVAVILLEAGLAKLQTSF**********************LKIWENYVEGEEVSNGAAVEGKQKEVLKVVVTEILGGGKFYVQQVGDQKVASVQQQLASLNLQEAPVIGAFNPKKGEIVLAQFSADNSWNRAMIVNAPREKVESVNDKFEVFYIDYGNQELVPYNKLRPIDPSLSSTPPLAQLCSLAYIKIPALEDEYGPEAAEFLNEHTYNSSNEFRALVEERDSSGGKLKGQGTGTLLHVTLVAVDAEISINTLMVQEGLARVER*************************ARIGMWQYGDIQSDDE***************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQEVTFRVDYAVPNIGREFGTVILGDKNVAMLVVSEGWAKVKEQGSQKGEASPFLAELLRLEEQAKLQGLGRWSKVPGAAEASIRNLPPSAIGDSSNFNAMALLDANKGRPMQGIVEQARDGSTLRVYLLPEFQFVQVFVAGIQAPAVARRPAAIVDTDTEETNGDVSAAEAVAPLNSAQRLAASTASAGQQSTDEPFALDAKYFTEMRVLNREVRIVLEGVDKFKNLIGSVFYPDGETAKDLAMELVENGLAKYIEWSANMMEEDAKRRLKAADLQAKKTRLRMWTNYVPPQSNSKAIHDQNFTGKVVEVVSGDCIIVADDSIPYGNALAERRVNLSSIRCPKIGNPRKDEKPAAYAREAREFLRTRLIGRQVNVQMEYSRKVVVEAAPVAAGAKGPAGTKGPAGTKGQAAAKGPAGEESVGATETRIIDFGSIFLLSPIKGEGDDASAVAQSNAAGQPAGVNVAELVVSRGLGNVINHRDFEERSNYYDALLAAEARAKAGKKGCYSSKEPPVMHIQDLTMAPVKKARDFLPFLQRSRRIPAVVEYVLSGHRFKVLIPKETCSIAFSFSGVRCPGRNERYSNEALLLMRQKILQRDVEIEVETVDRTGTFLGSLWESRTNVAVILLEAGLAKLQTSFGSDRIPDSHLLEQAEKSAKSQKLKIWENYVEGEEVSNGAAVEGKQKEVLKVVVTEILGGGKFYVQQVGDQKVASVQQQLASLNLQEAPVIGAFNPKKGEIVLAQFSADNSWNRAMIVNAPREKVESVNDKFEVFYIDYGNQELVPYNKLRPIDPSLSSTPPLAQLCSLAYIKIPALEDEYGPEAAEFLNEHTYNSSNEFRALVEERDSSGGKLKGQGTGTLLHVTLVAVDAEISINTLMVQEGLARVERRKRWGSRDRQAALENLEKFQEEAKTARIGMWQYGDIQSDDEDPLPSAVRKVAGGRR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Staphylococcal nuclease domain-containing protein 1 Functions as a bridging factor between STAT6 and the basal transcription factor. Plays a role in PIM1 regulation of MYB activity. Plays a role in cell viability (By similarity). Functions as a transcriptional coactivator for STAT5.probableQ78PY7
Staphylococcal nuclease domain-containing protein 1 Functions as a bridging factor between STAT6 and the basal transcription factor. Plays a role in PIM1 regulation of MYB activity. Functions as a transcriptional coactivator for the Epstein-Barr virus nuclear antigen 2 (EBNA2).probableQ7KZF4
Staphylococcal nuclease domain-containing protein 1 Functions as a bridging factor between STAT6 and the basal transcription factor. Plays a role in PIM1 regulation of MYB activity. Plays a role in cell viability. Functions as a transcriptional coactivator for STAT5. Plays a role in cell viability.probableQ66X93

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BDL, chain A
Confidence level:very confident
Coverage over the Query: 301-387,402,423-437,461-666,677-847,859-911
View the alignment between query and template
View the model in PyMOL
Template: 3BDL, chain A
Confidence level:very confident
Coverage over the Query: 108-165,183-381,402-404,429-437,461-657
View the alignment between query and template
View the model in PyMOL
Template: 2HQX, chain A
Confidence level:very confident
Coverage over the Query: 709-803
View the alignment between query and template
View the model in PyMOL