BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 002304
         (939 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2JWN|A Chain A, Solution Nmr Structure Of The Protease-Resistent Domain Of
           Xenopus Laevis Epabp2
 pdb|2JWN|B Chain B, Solution Nmr Structure Of The Protease-Resistent Domain Of
           Xenopus Laevis Epabp2
          Length = 124

 Score = 31.6 bits (70), Expect = 2.2,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 30/67 (44%), Gaps = 1/67 (1%)

Query: 273 TLSKKVLGATKEKKFHSLGAAECFEISA-SAAAGTFVHGFEDEFYEVRKSACSSLGSLVI 331
           T SK   GA  E     L A E  EI   S   G   +G   +  E   S+C S+  + I
Sbjct: 9   THSKMTAGAYTEGPPQPLSAEEKKEIDKRSVYVGNVDYGSTAQDLEAHFSSCGSINRITI 68

Query: 332 LSEKFAG 338
           L +KF+G
Sbjct: 69  LCDKFSG 75


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.137    0.407 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 23,412,783
Number of Sequences: 62578
Number of extensions: 859996
Number of successful extensions: 2086
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 2086
Number of HSP's gapped (non-prelim): 2
length of query: 939
length of database: 14,973,337
effective HSP length: 108
effective length of query: 831
effective length of database: 8,214,913
effective search space: 6826592703
effective search space used: 6826592703
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 56 (26.2 bits)