Citrus Sinensis ID: 002320


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930------
MKRELDYELAGSLDETSTQSLPQAGIQASDCVKAACENVRCKRFKVTKVNGFIVYSRVKRSRFSNSDDLLEDDVIDKRINSKIHEGRINKVVKNVLNENGILESVVEEENQLVQMTVENVIEETVKGKKAPICKEEPISKVECFPRKEGGSEVSNGLNKKCLKRPSAMKPKVEPVEVLVTQSEGFGNESMSLIEVEAIAEGSALTSPKKNLELKMSKKISLNKKPMTVTELFETGLLDGVSVVYMGGIKFQASGLRGIIRDGGILCSCSLCNGCRVIPPSKFEIHACKQYRRASQYICFENGKSLLEVLRACRSVPLPMLKATLQSALSSLPEEKSFACVRCKGTFPITCVGKTGPGPLCNSCVKSKKPQGTMTYTTGIRIRASGPKLVSRSSENDSMCISYQNNKRERKKTRKLLEADLVSKSSSKSVSLRNLLKTRSPWELTRNSSRPGLIANSTPVTSVHKSSQSQRQRKITKKSKKTVLISKPFENASPPLSFPNKSRWNITPKDQRLHKLVFDESGLPDGTEVGYYACGQKLLEGYKNGLGIICHCCNSEVSPSQFEAHADGGNLLPCDGCPRAFHKECASLSSIPQGDWYCKYCQNMFERKRFLQHDANAVEAGRVSGVDSVEQITKRCIRIVKNLEAELSGCLLCRGCDFSKSGFGPRTILLCDQCEREFHVGCLKKHKMADLRELPKGKWFCCMDCSRINSVLQNLLVQEAEKLPEFHLNAIKKYAGNSLETVSDIDVRWRLLSGKAATPETRLLLSQAVAIFHDCFDPIVDSISGRDLIPSMVYGNLRGQEFGGMYCAILTVNSSVVSAGILRVFGQEVAELPLVATSKINHGKGYFQLLFACIEKLLSFLRVKSIVLPAAEEAESIWTDKFGFKKIDPELLSIYRKRCSQLVTFKGTSMLQKRVPACRIGSSSTDSTECVSGVEVG
cccccccccccccccccccccccccccccccccccccccccccEEEEEEcccEEEEECcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccHHHHHHcccccccccccccccccccccccccccccHHHHHHccccccEEEEEccccccccccccEEEEccccEEccccccccEEcccccccccccccccccccccccccccHHHHHHHHHccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccEEEccccccccccEEEEEEccEEEcccEEccccEEEccccccccccccccccccccCCcccccccccccccccccccccccccccccccccHHHHHHccccccHccccccccccccccccccccccccccccccccEEcccccccccccccccEEEcccccHHcccccccccccccccccccccEECccccccHHHHHHHHccccccccccccccHHHHccccccccccccccHHHHcccccccHHHHHHHHHHHHHHcccccccccccccccccHHHHHccccccccccEEEEEEEEccEEEEEEEEEEEccEEEECcccECccccccccHHHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHccccccccHHHHHHHHHccccEEEEcccEEEECcccccccccccccccccccccccc
******************************C*KAACENVRCKRFKVTKVNGFIVYSRVKR*RF*N***************************KN*LNENGILESVVEEENQLVQMTVENVIEETVK***************************************************************************************************MTVTELFETGLLDGVSVVYMGGIKFQASGLRGIIRDGGILCSCSLCNGCRVIPPSKFEIHACKQYRRASQYICFENGKSLLEVLRACRSVPLPMLKATLQSALSSLPEEKSFACVRCKGTFPITCVGKTGPGPLCNSCVK*******MTYTTGIRI*********************************************************************************************************************************RLHKLVFDESGLPDGTEVGYYACGQKLLEGYKNGLGIICHCCNSEVSPSQFEAHADGGNLLPCDGCPRAFHKECASLSSIPQGDWYCKYCQNMFERKRFLQHDANAVEAGRVSGVDSVEQITKRCIRIVKNLEAELSGCLLCRGCDFSKSGFGPRTILLCDQCEREFHVGCLKKHKMADLRELPKGKWFCCMDCSRINSVLQNLLVQEAEKLPEFHLNAIKKYAGNSLETVSDIDVRWRLLSGKAATPETRLLLSQAVAIFHDCFDPIVDSISGRDLIPSMVYGNLRGQEFGGMYCAILTVNSSVVSAGILRVFGQEVAELPLVATSKINHGKGYFQLLFACIEKLLSFLRVKSIVLPAAEEAESIWTDKFGFKKIDPELLSIYRKRCSQLVTFKGTSMLQKRVP*********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKRELDYELAGSLDETSTQSLPQAGIQASDCVKAACENVRCKRFKVTKVNGFIVYSRVKRSRFSNSDDLLEDDVIDKRINSKIHEGRINKVVKNVLNENGILESVVEEENQLVQMTVENVIEETVKGKKAPICKEEPISKVECFPRKEGGSEVSNGLNKKCLKRPSAMKPKVEPVEVLVTQSEGFGNESMSLIEVEAIAEGSALTSPKKNLELKMSKKISLNKKPMTVTELFETGLLDGVSVVYMGGIKFQASGLRGIIRDGGILCSCSLCNGCRVIPPSKFEIHACKQYRRASQYICFENGKSLLEVLRACRSVPLPMLKATLQSALSSLPEEKSFACVRCKGTFPITCVGKTGPGPLCNSCVKSKKPQGTMTYTTGIRIRASGPKLVSRSSENDSMCISYQNNKRERKKTRKLLEADLVSKSSSKSVSLRNLLKTRSPWELTRNSSRPGLIANSTPVTSVHKSSQSQRQRKITKKSKKTVLISKPFENASPPLSFPNKSRWNITPKDQRLHKLVFDESGLPDGTEVGYYACGQKLLEGYKNGLGIICHCCNSEVSPSQFEAHADGGNLLPCDGCPRAFHKECASLSSIPQGDWYCKYCQNMFERKRFLQHDANAVEAGRVSGVDSVEQITKRCIRIVKNLEAELSGCLLCRGCDFSKSGFGPRTILLCDQCEREFHVGCLKKHKMADLRELPKGKWFCCMDCSRINSVLQNLLVQEAEKLPEFHLNAIKKYAGNSLETVSDIDVRWRLLSGKAATPETRLLLSQAVAIFHDCFDPIVDSISGRDLIPSMVYGNLRGQEFGGMYCAILTVNSSVVSAGILRVFGQEVAELPLVATSKINHGKGYFQLLFACIEKLLSFLRVKSIVLPAAEEAESIWTDKFGFKKIDPELLSIYRKRCSQLVTFKGTSMLQKRVPACRIGSSSTDSTECVSGVEVG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2KWJ, chain A
Confidence level:very confident
Coverage over the Query: 547-602,649-708
View the alignment between query and template
View the model in PyMOL
Template: 1YGH, chain A
Confidence level:confident
Coverage over the Query: 758-916
View the alignment between query and template
View the model in PyMOL
Template: 3RSN, chain A
Confidence level:probable
Coverage over the Query: 664-775
View the alignment between query and template
View the model in PyMOL
Template: 4AP4, chain A
Confidence level:probable
Coverage over the Query: 544-610,637-684
View the alignment between query and template
View the model in PyMOL
Template: 3U5M, chain A
Confidence level:probable
Coverage over the Query: 566-642
View the alignment between query and template
View the model in PyMOL