Citrus Sinensis ID: 002331

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-----
MRNIFKKLHIGSNHESNRTNETLASTTSCATDHNRTSSSSSNAAPPSPSASAATAASSPAPVVSSGSRTDYMTSEEEFQVQLAMAISASSSNPEDFSEKDQIRAATLLSLNNRRSDLGRDKADVAAEVLSRQYWEYNVLDYEERVVDGFYDIYGLSTDPSTQGKLPSLAHLESNLGNSGFEVVIVNRTIDHALEELVQVAQCIALDLPATDVGILVQQLADLVNGHMGGPVKDANIMLARWMERSTELRRSLQTSVLPIGSINIGLSRHRALLFKVLADSIRLPCRLVKGSHYTGVEDDAVNIIKLEEEREFLVDLMAAPGTLIPADILSAKDTAFKPYNPLISKIPILRTSNDSGAVYSKPKPLHAEGSSQNSTVDGSLPLNGGSTSEKAESLPSFPSPSYEPGAASSGISSRVTPNQSDYLSSSTIGTSLYKGGRGPNAVGDGARMNVNVVPYGQTGQEDSKSLFADLNPFQIKGAGKTSLHKNPTESKVEEFQSHRINPVSGRPPIPMMRKNQHPYNEVPRKKEYSYMEGILPKINREPNNNLSTSASTSSTSENFNPHSFKPSNDANISSKDSESRSALSGSGPSLASSTSQLNGPPLVEDLSSNSKDENPKNVEDHEIGYHDRRKCTHDRFMGTNLKLRDLESPSSSVDSSTSKVDQIFDDDVCECEIPWEDLVLGERIGLGSYGEVYHADWNGTEVAVKKFLDQDFSGAALLEFKREVKIMRRLRHPNVVLFMGAVTRPPNLSIITEFLPRGSLFRILHRPHCQVDEKRRIKMALDVARGMNCLHTSTPTIVHRDLKSPNLLVDKNWNVKVSDFGLSRLKHNTFLSSKSTAGTPEWMAPEVLRNEPSNEKCDVYSFGVILWELATLKLPWIGMNPMQVVGAVGFQNRRLEIPKELDPLVARIIWECWQTGWSSLHIRTSQAQLSHKRFQ
ccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHccccccccccccccEEEEccccccccccccccHHHHHcccccccCEEEEEEccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccCEEEccccccccccHHHHHHHHHHHcccccccccccccccccccccEEEEEEcccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEECccccccEEEEEEcccEEEEEEEccccccHHHHHHHHHHHHHHHHcccccEEEEEEEEEccccEEEEEEccccccHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccccEECcccccccEEEcccccEEEcccccccccccccccccccccccccccHHHHccccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHccccccccccccHHHHHHHHHHHccccccccccccHHHHHHHHHc
*RNIFKK*********************************************************************EFQVQLAMAISA**********************************DVAAEVLSRQYWEYNVLDYEERVVDGFYDIYGLSTDPSTQGKLPSLAHLESNLGNSGFEVVIVNRTIDHALEELVQVAQCIALDLPATDVGILVQQLADLVNGHMGGPVKDANIMLARWMERSTELRRSLQTSVLPIGSINIGLSRHRALLFKVLADSIRLPCRLVKGSHYTGVEDDAVNIIKLEEEREFLVDLMAAPGTLIPADILSAKDTAFKPY**********************************************************************************************************************************************************************************************************************************************************************************************************************************QIFDDDVCECEIPWEDLVLGERIGLGSYGEVYHADWNGTEVAVKKFLDQDFSGAALLEFKREVKIMRRLRHPNVVLFMGAVTRPPNLSIITEFLPRGSLFRILHRPHCQVDEKRRIKMALDVARGMNCLHTSTPTIVHRDLKSPNLLVDKNWNVKVSDFGLSRLKHNTFL**KSTAGTPEWMAPEVLRNEPSNEKCDVYSFGVILWELATLKLPWIGMNPMQVVGAVGFQNRRLEIPKELDPLVARIIWECWQTGWSSLHIRTSQAQLSHKRF*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRNIFKKLHIGSNHESNRTNETLASTTSCATDHNRTSSSSSNAAPPSPSASAATAASSPAPVVSSGSRTDYMTSEEEFQVQLAMAISASSSNPEDFSEKDQIRAATLLSLNNRRSDLGRDKADVAAEVLSRQYWEYNVLDYEERVVDGFYDIYGLSTDPSTQGKLPSLAHLESNLGNSGFEVVIVNRTIDHALEELVQVAQCIALDLPATDVGILVQQLADLVNGHMGGPVKDANIMLARWMERSTELRRSLQTSVLPIGSINIGLSRHRALLFKVLADSIRLPCRLVKGSHYTGVEDDAVNIIKLEEEREFLVDLMAAPGTLIPADILSAKDTAFKPYNPLISKIPILRTSNDSGAVYSKPKPLHAEGSSQNSTVDGSLPLNGGSTSEKAESLPSFPSPSYEPGAASSGISSRVTPNQSDYLSSSTIGTSLYKGGRGPNAVGDGARMNVNVVPYGQTGQEDSKSLFADLNPFQIKGAGKTSLHKNPTESKVEEFQSHRINPVSGRPPIPMMRKNQHPYNEVPRKKEYSYMEGILPKINREPNNNLSTSASTSSTSENFNPHSFKPSNDANISSKDSESRSALSGSGPSLASSTSQLNGPPLVEDLSSNSKDENPKNVEDHEIGYHDRRKCTHDRFMGTNLKLRDLESPSSSVDSSTSKVDQIFDDDVCECEIPWEDLVLGERIGLGSYGEVYHADWNGTEVAVKKFLDQDFSGAALLEFKREVKIMRRLRHPNVVLFMGAVTRPPNLSIITEFLPRGSLFRILHRPHCQVDEKRRIKMALDVARGMNCLHTSTPTIVHRDLKSPNLLVDKNWNVKVSDFGLSRLKHNTFLSSKSTAGTPEWMAPEVLRNEPSNEKCDVYSFGVILWELATLKLPWIGMNPMQVVGAVGFQNRRLEIPKELDPLVARIIWECWQTGWSSLHIRTSQAQLSHKRFQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein kinase EDR1 MAPKKK serine/threonine-protein kinase involved in the regulation of a MAP kinase cascade (probably including MPK3 and MPK6) that negatively regulates salicylic acid- (SA-) dependent defense responses, abscisic acid (ABA) signaling, and ethylene-induced senescence. Modulates also stress response (e.g. drought) signaling and cell death, in an ORE9-dependent manner. Functions at a point of cross talk between ethylene, ABA and SA signaling that impinges on senescence and cell death. In another hand, confers sensitivity to various pathogens such as the fungus Erysiphe cichoracearum, the oomycete Hyaloperonospora parasitica and the bacteria Pseudomonas syringae pv. tomato DC3000. Required for the resistance to some hemibiotrophic/necrotrophic fungal pathogens (e.g. Colletotrichum gloeosporioides, Colletotrichum higginsianum and Alternaria brassicicola) through the induction of defensins expression, probably by repressing MYC2, an inhibitor of defensin genes (PDFs). Together with KEG, may regulate endocytic trafficking and/or the formation of signaling complexes on trans-Golgi network (TGN)/ early endosome (EE) vesicles during stress responses.probableQ9FPR3

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3P86, chain A
Confidence level:very confident
Coverage over the Query: 671-820,838-931
View the alignment between query and template
View the model in PyMOL
Template: 3KD4, chain A
Confidence level:probable
Coverage over the Query: 196-251,264-316
View the alignment between query and template
View the model in PyMOL