Citrus Sinensis ID: 002337

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930----
MCVCISTPFFLIQATRVFEVCIIDSMVERRKPLVLSSTKLLINSVLSSSRRVTGENLVGDDVSPSLQLPAGILRFSKDKIDISDAKFASLDDSALLGLSTCVLKQLSVTSGSLVLVKNAETTKQRIAQVVVLDPPTTRKQVCDGDVHSKHSSPTMLTFPSIHLPQDDMELLDRQVAYLSPLLAFNLDLHISSLKFLVHQGKEVLESLFIAKVDDGTSGQDGKASLIKLGLQSVGQLPKYASHLRVSFVKIPECGTLESLKGSSAIEAEDRQEKIDLALHNYFEVDRYLARGDVFSVCINWNCSSMICIPCRQRLHRRSDNIIYFKVVAVEPSEETVLRVNCTKTALVLGGSIPSALPPDLLISGSNDFVPLQGDTVKILASILAPTLCPSVLSLKFRVAVLLHGLPGCGKRTVVRYVARRLGIHVVEYSCHNLMASSERKTSAALAQAFNTAQSYSPTILLLRDFDVFRNLVSNESLPNDQVGLSSEVASVIREFTEPSAEDEDEESHGYFPVKEIEKICRQQVLLVAAADSSEGLPPTIRRCFSHEISMGPLTEQQRVEMLSQLLQPVSELTSDTGSEEFVKDIIGQTSGFMPRDLHALVADAGANLIRKSNSEVDKNEPGESDLTAKVAHNDNSSIAATQVMGKEDLVKAMERSKKRNASALGAPKLPLLHKDLFSSGLRKRSGVLLYGPPGTGKTLLAKAVATECSLNFLSVKGPELINMYIGESEKNVRDIFQKARSARPCVIFFDELDSLAPARGASGDSGGVMDRVVSQMLAEIDGLNDSSQDLFIIGASNRPDLIDPALLRPGRFDKLLYVGVNSDVSYRERVLKALTRKFKLLEDVSLYSIAKKCPPNFTGADMYALCADAWFHAAKRKVLSSDSNSDSSRIDQADSVVVEYDDFVKVLRELSPSLSMAELKKYELLRDQFEGSSN
cccccccccEEEEEEcHHHHHHHHHHHHcccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccEEEEEccccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccEEEEcHHHHHHccccccccEEEEEccccEEEEEEEECcccccccccccccEEEEcccccccccccccEEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccEEEEEcccccccccccccccccccccccEEEEEEEEEcccccEEEEEEcccEEEEEcccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccEEEEEccccccHHHHHHHHHHHHccEEEEEEccccccccHHHHHHHHHHHHHHHHHcccCEEEEccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccHHHHHHccccEEEEEEccccccccHHHHcccccEECcccccHHHHHHHHHHHHcccccccccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHcccccccccHHHHHcccccccEEEEEccccccHHHHHHHHHHcccccEEEccccccccccccHHHHHHHHHHHHHHHccccEEEEcccccccccccccccccccHHHHHHHHHHHHcccccccccEEEEEEcccccccccccccccccccEEEEcccccHHHHHHHHHHHcccccccccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccc
*CVCISTPFFLIQATRVFEVCIIDSMVERRKPLVLSSTKLLINSVLSS*******NLVGDDVSPSLQLPAGILRFSKD********FASLDDSALLGLSTCVLKQLSVTSGSLVLVKNAETTKQRIAQVVVLDPP********************LTFPSIHLPQDDMELLDRQVAYLSPLLAFNLDLHISSLKFLVHQGKEVLESLFIAKVDDGTS**DGKASLIKLGLQSVGQLPKYASHLRVSFVKIPECGTLESLKG**AIEAEDRQEKIDLALHNYFEVDRYLARGDVFSVCINWNCSSMICIPCRQRLHRRSDNIIYFKVVAVEPSEETVLRVNCTKTALVLGGSIPSALPPDLLISGSNDFVPLQGDTVKILASILAPTLCPSVLSLKFRVAVLLHGLPGCGKRTVVRYVARRLGIHVVEYSCHNLMASSERKTSAALAQAFNTAQSYSPTILLLRDFDVFRNLV***************VASVIREFTEP***DEDEESHGYFPVKEIEKICRQQVLLVAAADSSEGLPPTIRRCFSHEISMGPLTEQQRVEMLSQLLQPVSELTSDTGSEEFVKDIIGQTSGFMPRDLHALVADAGANLI****************L***V********AATQVMGKEDLVKAMERSKKRNASALGAPKLPLLHKDLFSSGLRKRSGVLLYGPPGTGKTLLAKAVATECSLNFLSVKGPELINMYIGESEKNVRDIFQKARSARPCVIFFDELDSL**************DRVVSQMLAEIDGLNDSSQDLFIIGASNRPDLIDPALLRPGRFDKLLYVGVNSDVSYRERVLKALTRKFKLLEDVSLYSIAKKCPPNFTGADMYALCADAWFHAAKRKVL**************DSVVVEYDDFVKVLRELSPSLSMAELKKYEL***QF*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCVCISTPFFLIQATRVFEVCIIDSMVERRKPLVLSSTKLLINSVLSSSRRVTGENLVGDDVSPSLQLPAGILRFSKDKIDISDAKFASLDDSALLGLSTCVLKQLSVTSGSLVLVKNAETTKQRIAQVVVLDPPTTRKQVCDGDVHSKHSSPTMLTFPSIHLPQDDMELLDRQVAYLSPLLAFNLDLHISSLKFLVHQGKEVLESLFIAKVDDGTSGQDGKASLIKLGLQSVGQLPKYASHLRVSFVKIPECGTLESLKGSSAIEAEDRQEKIDLALHNYFEVDRYLARGDVFSVCINWNCSSMICIPCRQRLHRRSDNIIYFKVVAVEPSEETVLRVNCTKTALVLGGSIPSALPPDLLISGSNDFVPLQGDTVKILASILAPTLCPSVLSLKFRVAVLLHGLPGCGKRTVVRYVARRLGIHVVEYSCHNLMASSERKTSAALAQAFNTAQSYSPTILLLRDFDVFRNLVSNESLPNDQVGLSSEVASVIREFTEPSAEDEDEESHGYFPVKEIEKICRQQVLLVAAADSSEGLPPTIRRCFSHEISMGPLTEQQRVEMLSQLLQPVSELTSDTGSEEFVKDIIGQTSGFMPRDLHALVADAGANLIRKSNSEVDKNEPGESDLTAKVAHNDNSSIAATQVMGKEDLVKAMERSKKRNASALGAPKLPLLHKDLFSSGLRKRSGVLLYGPPGTGKTLLAKAVATECSLNFLSVKGPELINMYIGESEKNVRDIFQKARSARPCVIFFDELDSLAPARGASGDSGGVMDRVVSQMLAEIDGLNDSSQDLFIIGASNRPDLIDPALLRPGRFDKLLYVGVNSDVSYRERVLKALTRKFKLLEDVSLYSIAKKCPPNFTGADMYALCADAWFHAAKRKVLSSDSNSDSSRIDQADSVVVEYDDFVKVLRELSPSLSMAELKKYELLRDQFEGSSN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peroxisome biogenesis protein 6 Involved in peroxisomal-targeting signal one (PTS1) and peroxisomal-targeting signal two (PTS2) protein import. Required for jasmonate biosynthesis. Necessary for the developmental elimination of obsolete peroxisome matix proteins. May form heteromeric AAA ATPase complexes required for the import of proteins. May be involved in PEX5 recycling.probableQ8RY16

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HU3, chain A
Confidence level:very confident
Coverage over the Query: 73-135,170-192,227-262,273-299,319-497,517-622,634-659
View the alignment between query and template
View the model in PyMOL
Template: 3D8B, chain A
Confidence level:very confident
Coverage over the Query: 643-657,668-879,895-932
View the alignment between query and template
View the model in PyMOL
Template: 3CF2, chain A
Confidence level:very confident
Coverage over the Query: 77-135,170-192,227-262,273-299,319-495,515-622,634-755,769-843,861-873,889-907
View the alignment between query and template
View the model in PyMOL
Template: 1R7R, chain A
Confidence level:confident
Coverage over the Query: 399-468,501-873,892-902
View the alignment between query and template
View the model in PyMOL