Citrus Sinensis ID: 002341


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930----
MRIYELESHLSVLGFIIVAIVTHAATRSSGESSTCLTVYKEGGAPAVFQSPKCPRWKLSDYNSPPRTTSRCQSAMRQGRRKSQEDRTLCALDLHIPFPGRRGRQEVTVGIVAVFDGHNGAEASELASKLLLEYFALHTYFLLDATYSAVLKKSARRLPNKGERDIVFQVLNWDEKLGRHELKFERFKFSLPDIFDDSFHLEILREALLRAIHDIDTAFSKEASRKKLDSGSTATVVLIAEGQILVANIGDSKALLCSEKFQSPAEAKATLLRLYRKRRDNNAISTSQGYNYLKSTVSNGLAHFTVKELTRDHHPDREDERYRVEAAGGYVLQWGGVSRVNGQLAVSRAIGDLSYKSYGVISVPEVTDWQSLTANDSYLVAASDGVFEKLSLQDVCDVFWEVHTHGTAGPGFPSSCSYSLADCLVDTAFEKGSMDNMAAVVVPLGSIYVSENLHRERRMEEGDIDCPSKGLQKLVYKQSGSGMNMNLLQLKHAHPLTTKFDRLLVEGNHGSFGCFYLSENLNDNVDSTFGAQKDDPEDYVYDLSQTLPDTLNHQYGELLNLYNDQNMCLHFGTTMDGIKDQCFKPGGFASFVGLLESIPFLDVGSEYGSNEYVMPERYVLKKRFGRGSYGEVWLAFHWNCHEGDNSSRWSELTKNVSGESICEDMSIRNPCNSSSTDDFHGGYFHDSLFILKRIMLMALKSCHDRNITHRDIKPENMVICFEDQDTGRCLKGPPSEEKNVTTRMRIIDFGSAIDDFTVKHLYGSTGPSKAEQTSEYTPPEAFLNATWYQGPIGTTLKYDMWSVGVVILEMILGSPNVFQISDLTRALLDHHLEGWNDSLKELAFRLRSYMELCILIPGGSSKLKHTSNQGGLSPASWKCSEEFFSLKIKGRDPLKQGFPNVWALRLVRQLLLWDAEDRLSVDVALRHPYFQPSKR
ccEEEEcHHHHHHHHHHHHHHHHcccccccccccEEEEEccccccccccccccccccccccccccccccEEEEEEEcccccccccEEEEEcccccccccccccccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccccccccHHHHHHHHHHHHcHHHHHHHHccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHccccccccEEEEEEEEccEEEEEEccccEEEEEcccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccEEEEcccccccccEEEEEccccccccccccccccccEEEEEEcccccEEEEEEcccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccccccEEEEEEcccccccHHHHHHHHHccccccccccccHHHHHHccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccHHccccccccccccccccccccEEcccEEEEEEEcccccccEEEEEEEEccccccccccHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEccccccccccccccccccccccEEEEEcccccccccHHHHccccccccccccccccccHHHcccccccccccccccccEEEHHHHHHHHHHcccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHcccccccccccccHHHHHHHHHHccccccccccHHHHHcccccccccc
ccEEEHHcHHHHHHHHHHHEEEccccccccccccEEEEEccccccEEEccccccccccccccccccccHHHHHHHHcccccccccEEEEEccccccccccccccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHcccccccEEEEEEEEccEEEEEEcccccEEEEEccccccccccccHHHHHHHHHHHccccccccccccccccccccccEEEEEEccccccccHHHHHHHHHcccEEEEccccccEccHHHHHHcccccccccccEEEcccEEEEEcccccccEEEEEcccHHHcccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccccccEEEEEEEccccccccccccHHccccccccccccccccccccccccccccccEEccccccccccccEEEEEEcccccEEEEEEcccccccccEEEEcccccccccccccccccHHHHccccccHHHcccccEEEEccccccccccccccHHHHHHHHcccccccccccccccccccEEEcccEEEEEEccccccEEEEEEEEcccccHHHHHHHHHHHHHccccccHHHcccccccccccHHcccccccHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEcccEEcccccccccccccccccEEEEEccccccccccccccccccccHEEEEccccccHHHHHcccccccccccccccEEHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHccEEEEcccccHccccccccccEEcccccHHHHHHcccccccccHHHHcccHHHHHHHHHHHcccHHccccHHHHHcccccccccc
MRIYELESHLSVLGFIIVAIVTHaatrssgesstcltvykeggapavfqspkcprwklsdynspprttsrcQSAMrqgrrksqedrtlcaldlhipfpgrrgrqeVTVGIVAVFDGHNGAEASELASKLLLEYFALHTYFLLDATYSAVLKKSArrlpnkgerdIVFQVLNWDEKLGRHELKFerfkfslpdifddsFHLEILREALLRAIHDIDTAFSKEAsrkkldsgstATVVLIAEGQILVANigdskallcsekfqspAEAKATLLRLYRKrrdnnaistsqGYNYLKSTVSNGLAHFTVKeltrdhhpdredeRYRVEAAGGyvlqwggvsrvngqLAVSRaigdlsyksygvisvpevtdwqsltandsyLVAASDGVFEKLSLQDVCDVFWEvhthgtagpgfpsscsyslADCLVDTAFEKGSMDNMAAVVVPLGSiyvsenlhrerrmeegdidcpskglQKLVYKqsgsgmnmnllqlkhahplttkFDRLLVegnhgsfgcfylsenlndnvdstfgaqkddpedyvYDLSQTLPDTLNHQYGELLNLyndqnmclhfgttmdgikdqcfkpggfaSFVGLLesipfldvgseygsneyvmperyvlkkrfgrgsyGEVWLAFHWnchegdnssrwseltknvsgesicedmsirnpcnssstddfhggyfhdSLFILKRIMLMALKSchdrnithrdikpenmvicfedqdtgrclkgppseeknvttRMRIIDFgsaiddftvkhlygstgpskaeqtseytppeaflnatwyqgpigttlkydMWSVGVVILEMIlgspnvfqISDLTRALLDHHLEGWNDSLKELAFRLRSYMELCIlipggssklkhtsnqgglspaswkcSEEFFSlkikgrdplkqgfpnvWALRLVRQLLLWDAedrlsvdvalrhpyfqpskr
MRIYELESHLSVLGFIIVAIVTHAATRSSGESSTCLTVYKEGGapavfqspkcprwklsdynspprttsrcqsamrqgrrksqedrtLCALDlhipfpgrrgrqEVTVGIVAVFDGHNGAEASELASKLLLEYFALHTYFLLDATYSAVLKKSArrlpnkgerdiVFQVLNWDEKLGRHELKFERFKFSLPDIFDDSFHLEILREALLRAIHDIDTAFskeasrkkldsgsTATVVLIAEGQILVANIGDSKALLCSEKFQSPAEAKATLLRLYRKrrdnnaistsqgynyLKSTVSNGLAHFTVKeltrdhhpdredERYRVEAAGGYvlqwggvsrvNGQLAVSRAIGDLSYKSYGVISVPEVTDWQSLTANDSYLVAASDGVFEKLSLQDVCDVFWEVHTHGTAGPGFPSSCSYSLADCLVDTAFEKGSMDNMAAVVVPLGSIYVSENLHRERRmeegdidcpskgLQKLVYKQSGSGMNMNLLQLKHAHPLTTKFDRLLVEGNHGSFGCFYLSENLNDNVDSTFGAQKDDPEDYVYDLSQTLPDTLNHQYGELLNLYNDQNMCLHFGTTMDGIKDQCFKPGGFASFVGLLESIPFLDVGSEYGSNEYVMPERYVLKKRFGRGSYGEVWLAFHWNCHEGDNSSRWSELTKNVSGESICEDMSIRNPCNSSSTDDFHGGYFHDSLFILKRIMLMALKSCHDRnithrdikpenMVICFEdqdtgrclkgppseeknvttrMRIIDFGSAIDDFTVKHLYGStgpskaeqtseyTPPEAFLNATWYQGPIGTTLKYDMWSVGVVILEMILGSPNVFQISDLTRALLDHHLEGWNDSLKELAFRLRSYMELCILIPGGSSKLKHTSNQGGLSPASWKCSEEFFSLKikgrdplkqgfpNVWALRLVRQLLLWDAEDRLSVDValrhpyfqpskr
MRIYELESHLSVLGFIIVAIVTHAATRSSGESSTCLTVYKEGGAPAVFQSPKCPRWKLSDYNSPPRTTSRCQSAMRQGRRKSQEDRTLCALDLHIPFPGRRGRQEVTVGIVAVFDGHNGaeaselaskllleYFALHTYFLLDATYSAVLKKSARRLPNKGERDIVFQVLNWDEKLGRHELKFERFKFSLPDIFDDSFHLEILREALLRAIHDIDTAFSKEASRKKLDSGSTATVVLIAEGQILVANIGDSKALLCSEKFQSPAEAKATLLRLYRKRRDNNAISTSQGYNYLKSTVSNGLAHFTVKELTRDHHPDREDERYRVEAAGGYVLQWGGVSRVNGQLAVSRAIGDLSYKSYGVISVPEVTDWQSLTANDSYLVAASDGVFEKLSLQDVCDVFWEVHTHGTAGPGFPSSCSYSLADCLVDTAFEKGSMDNMAAVVVPLGSIYVSENLHRERRMEEGDIDCPSKGLQKLVYKQSGSGMNMNLLQLKHAHPLTTKFDRLLVEGNHGSFGCFYLSENLNDNVDSTFGAQKDDPEDYVYDLSQTLPDTLNHQYGELLNLYNDQNMCLHFGTTMDGIKDQCFKPGGFASFVGLLESIPFLDVGSEYGSNEYVMPERYVLKKRFGRGSYGEVWLAFHWNCHEGDNSSRWSELTKNVSGESICEDMSIRNPCNSSSTDDFHGGYFHDSLFILKRIMLMALKSCHDRNITHRDIKPENMVICFEDQDTGRCLKGPPSEEKNVTTRMRIIDFGSAIDDFTVKHLYGSTGPSKAEQTSEYTPPEAFLNATWYQGPIGTTLKYDMWSVGVVILEMILGSPNVFQISDLTRALLDHHLEGWNDSLKELAFRLRSYMELCILIPGGSSKLKHTSNQGGLSPASWKCSEEFFSLKIKGRDPLKQGFPNVWALRLVRQLLLWDAEDRLSVDVALRHPYFQPSKR
***YELESHLSVLGFIIVAIVTHAATR*****STCLTVYKEGGAPAVFQS**C**W******************************TLCALDLHIPFPGRRGRQEVTVGIVAVFDGHNGAEASELASKLLLEYFALHTYFLLDATYSAVLKKSARRLPNKGERDIVFQVLNWDEKLGRHELKFERFKFSLPDIFDDSFHLEILREALLRAIHDIDTAFS***********STATVVLIAEGQILVANIGDSKALLCSEKFQSPAEAKATLLRLYRKRRDNNAISTSQGYNYLKSTVSNGLAHFTVKELT**********RYRVEAAGGYVLQWGGVSRVNGQLAVSRAIGDLSYKSYGVISVPEVTDWQSLTANDSYLVAASDGVFEKLSLQDVCDVFWEVHTHGTAGPGFPSSCSYSLADCLVDTAFEKGSMDNMAAVVVPLGSIYVSENLH****************LQKLVYKQSGSGMNMNLLQLKHAHPLTTKFDRLLVEGNHGSFGCFYLSENLNDNVDSTFGA*****EDYVYDLSQTLPDTLNHQYGELLNLYNDQNMCLHFGTTMDGIKDQCFKPGGFASFVGLLESIPFLDVGSEYGSNEYVMPERYVLKKRFGRGSYGEVWLAFHWNCHEGD********************************DDFHGGYFHDSLFILKRIMLMALKSCHDRNITHRDIKPENMVICFEDQDTGRCL*********VTTRMRIIDFGSAIDDFTVKHLYG****************EAFLNATWYQGPIGTTLKYDMWSVGVVILEMILGSPNVFQISDLTRALLDHHLEGWNDSLKELAFRLRSYMELCILIPGG***************ASWKCSEEFFSLKIKGRDPLKQGFPNVWALRLVRQLLLWDAEDRLSVDVALRHPY******
******ESHLSVLGFIIVAIVTHAATRSSGESSTCLTVYKEGG**************************RCQSAMRQGRRKSQEDRTLCALDLHIPFPGRRGRQEVTVGIVAVFDGHNGAEASELASKLLLEYFALHTYFLLDATYSAVLKKSARRLPNKGERDIVFQVLNWDEKLGRHELKF**************FHLEILREALLRAIHDIDTAFSKEASRKKLDSGSTATVVLIAEGQILVANIGDSKALLCSEKFQS**********LYRKRRDNNAISTSQGYNYLKSTVSNGLAHFTVKELTRDHHPDREDERYRVEAAGGYVLQWGGVSRVNGQLAVSRAIGDLSYKSYGVISVPEVTDWQSLTANDSYLVAASDGVFEKLSLQDVCDVFWEVH*************SYSLADCLVDTAFEKGSMDNMAAVVVPLG*********************************************************LLVEGNHGSFGCFYLSENLNDN***********************************NLYNDQNMCLHFGTTM****DQCFKPGGFASFVGLLESIPFLDVGSEYGSNEYVMPERYVLKKRFGRGSYGEVWLAFHWNCHEGDNSSRWSELTKNVSGESICEDMSIRNPCNSSSTDDFHGGYFHDSLFILKRIMLMALKSCHDRNITHRDIKPENMVICFEDQDT**************TTRMRIIDFGSAIDDFTVKHLYGSTGPSKAEQTSEYTPPEAFLNATWYQGPIGTTLKYDMWSVGVVILEMILGSPNVFQISDLTRALLDHHLEGWNDSLKELAFRLRSYMELCIL*********************WKCSEEFFSL*********QGFPNVWALRLVRQLLLWDAEDRLSVDVALRHPYFQ****
MRIYELESHLSVLGFIIVAIVTHAA********TCLTVYKEGGAPAVFQSPKCPRWKLSDY************************RTLCALDLHIPFPGRRGRQEVTVGIVAVFDGHNGAEASELASKLLLEYFALHTYFLLDATYSAVLKKSARRLPNKGERDIVFQVLNWDEKLGRHELKFERFKFSLPDIFDDSFHLEILREALLRAIHDIDTAFSK**********STATVVLIAEGQILVANIGDSKALLCSEKFQSPAEAKATLLRLYRKRRDNNAISTSQGYNYLKSTVSNGLAHFTVKELTRDHHPDREDERYRVEAAGGYVLQWGGVSRVNGQLAVSRAIGDLSYKSYGVISVPEVTDWQSLTANDSYLVAASDGVFEKLSLQDVCDVFWEVHTHGTAGPGFPSSCSYSLADCLVDTAFEKGSMDNMAAVVVPLGSIYVSENLHRERRMEEGDIDCPSKGLQKLVYKQSGSGMNMNLLQLKHAHPLTTKFDRLLVEGNHGSFGCFYLSENLNDNVDSTFGAQKDDPEDYVYDLSQTLPDTLNHQYGELLNLYNDQNMCLHFGTTMDGIKDQCFKPGGFASFVGLLESIPFLDVGSEYGSNEYVMPERYVLKKRFGRGSYGEVWLAFHWNCHEGDNSSRWSELTKNVSGESICEDMSIRNPCNSSSTDDFHGGYFHDSLFILKRIMLMALKSCHDRNITHRDIKPENMVICFEDQDTGRCLKGPPSEEKNVTTRMRIIDFGSAIDDFTVKHLYGS************TPPEAFLNATWYQGPIGTTLKYDMWSVGVVILEMILGSPNVFQISDLTRALLDHHLEGWNDSLKELAFRLRSYMELCILIPGGSSK*************SWKCSEEFFSLKIKGRDPLKQGFPNVWALRLVRQLLLWDAEDRLSVDVALRHPYFQPSKR
MRIYELESHLSVLGFIIVAIVTHAATRSSGESSTCLTVYKEGGAPAVFQSPKCPRWKLSDYNS*PRTTSRCQSAMRQGRRKSQEDRTLCALDLHIPFPGRRGRQEVTVGIVAVFDGHNGAEASELASKLLLEYFALHTYFLLDATYSAVL********************************FERFKFSLPDIFDDSFHLEILREALLRAIHDIDTAFSKEASRKKLDSGSTATVVLIAEGQILVANIGDSKALLCSEKFQSPAEAKATLLRLYRKRRDNNAISTSQGYNYLKSTVSNGLAHFTVKELTRDHHPDREDERYRVEAAGGYVLQWGGVSRVNGQLAVSRAIGDLSYKSYGVISVPEVTDWQSLTANDSYLVAASDGVFEKLSLQDVCDVFWEVHTHGTAGPGFPSSCSYSLADCLVDTAFEKGSMDNMAAVVVPLGS**************************K*******SGMNMNLLQLKHAHPLTTKFDRLLVEGNHGSFGCFYLSENLNDNVDSTFGAQKDDPEDYVYDLSQTLPDTLNHQYGELLNLYNDQNMCLHFGTTMDGIKDQCFKPGGFASFVGLLESIPFLDVGSEYGSNEYVMPERYVLKKRFGRGSYGEVWLAFHWNCHEGDNSSRWSELTKNVSGESICEDMSIRNPCNSSSTDDFHGGYFHDSLFILKRIMLMALKSCHDRNITHRDIKPENMVICFEDQDTGRCLKGPPSEEKNVTTRMRIIDFGSAIDDFTVKHLYGSTGPSKAEQTSEYTPPEAFLNATWYQGPIGTTLKYDMWSVGVVILEMILGSPNVFQISDLTRALLDHHLEGWNDSLKELAFRLRSYMELCILIPGGSSKLKHTSNQGGLSPASWKCSEEFFSLKIKGRDPLKQGFPNVWALRLVRQLLLWDAEDRLSVDVALRHPYFQ****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRIYELESHLSVLGFIIVAIVTHAATRSSGESSTCLTVYKEGGAPAVFQSPKCPRWKLSDYNSPPRTTSRCQSAMRQGRRKSQEDRTLCALDLHIPFPGRRGRQEVTVGIVAVFDGHNGAEASELASKLLLEYFALHTYFLLDATYSAVLKKSARRLPNKGERDIVFQVLNWDEKLGRHELKFERFKFSLPDIFDDSFHLEILREALLRAIHDIDTAFSKEASRKKLDSGSTATVVLIAEGQILVANIGDSKALLCSEKFQSPAEAKATLLRLYRKRRDNNAISTSQGYNYLKSTVSNGLAHFTVKELTRDHHPDREDERYRVEAAGGYVLQWGGVSRVNGQLAVSRAIGDLSYKSYGVISVPEVTDWQSLTANDSYLVAASDGVFEKLSLQDVCDVFWEVHTHGTAGPGFPSSCSYSLADCLVDTAFEKGSMDNMAAVVVPLGSIYVSENLHRERRMEEGDIDCPSKGLQKLVYKQSGSGMNMNLLQLKHAHPLTTKFDRLLVEGNHGSFGCFYLSENLNDNVDSTFGAQKDDPEDYVYDLSQTLPDTLNHQYGELLNLYNDQNMCLHFGTTMDGIKDQCFKPGGFASFVGLLESIPFLDVGSEYGSNEYVMPERYVLKKRFGRGSYGEVWLAFHWNCHEGDNSSRWSELTKNVSGESICEDMSIRNPCNSSSTDDFHGGYFHDSLFILKRIMLMALKSCHDRNITHRDIKPENMVICFEDQDTGRCLKGPPSEEKNVTTRMRIIDFGSAIDDFTVKHLYGSTGPSKAEQTSEYTPPEAFLNATWYQGPIGTTLKYDMWSVGVVILEMILGSPNVFQISDLTRALLDHHLEGWNDSLKELAFRLRSYMELCILIPGGSSKLKHTSNQGGLSPASWKCSEEFFSLKIKGRDPLKQGFPNVWALRLVRQLLLWDAEDRLSVDVALRHPYFQPSKR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query934 2.2.26 [Sep-21-2011]
Q93YS2528 Probable protein phosphat no no 0.506 0.895 0.603 1e-162
A3CCP9499 Putative protein phosphat yes no 0.471 0.881 0.491 1e-119
Q9M1V8423 Putative protein phosphat no no 0.388 0.858 0.574 1e-117
Q8RXY0376 Probable inactive protein no no 0.316 0.787 0.568 1e-102
Q8BXN7372 Protein phosphatase 1K, m yes no 0.199 0.5 0.328 5e-23
Q8N3J5372 Protein phosphatase 1K, m yes no 0.207 0.521 0.321 2e-22
Q6ING9373 Protein phosphatase 1K, m N/A no 0.199 0.498 0.3 3e-22
Q2PC20372 Protein phosphatase 1K, m yes no 0.201 0.505 0.309 1e-21
Q0JLP9467 Probable protein phosphat no no 0.204 0.408 0.333 1e-21
Q67UX7348 Probable protein phosphat no no 0.253 0.681 0.260 2e-20
>sp|Q93YS2|P2C51_ARATH Probable protein phosphatase 2C 51 OS=Arabidopsis thaliana GN=At3g63340 PE=2 SV=2 Back     alignment and function desciption
 Score =  572 bits (1474), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 288/477 (60%), Positives = 357/477 (74%), Gaps = 4/477 (0%)

Query: 30  GESSTCLTVYKEGGAPAVFQSPKCPRWKLSDYNSPPRT-TSRCQSAMRQGRRKSQEDRTL 88
           GESSTCL VYK+GGAPAVFQSPKCPRW L ++ SP  +   RC +A  QGRR  QEDR L
Sbjct: 30  GESSTCLAVYKQGGAPAVFQSPKCPRWILQNWGSPTHSGAGRCHTAAIQGRRNYQEDRLL 89

Query: 89  CALDLHIPFPGRRGR-QEVTVGIVAVFDGHNGAEASELASKLLLEYFALHTYFLLDATYS 147
           CALDL IPFPG+ G  ++V VGI AVFDGHNGAEAS++ASKLLL+YFALH  FLLDAT+S
Sbjct: 90  CALDLRIPFPGKTGTPKDVLVGIAAVFDGHNGAEASDMASKLLLDYFALHINFLLDATFS 149

Query: 148 AVLKKSARRLPNKGERDIVFQVLNWDEKLGRHELKFE-RFKFSLPDIFDDSFHLEILREA 206
           A+ +K   R P KG+  ++   ++ DE +  + L F+ +F+ SLP  FDDS  L+I++EA
Sbjct: 150 AMTRKLIGRFPTKGDHSVILHGVSRDEIMHLYNLDFQMQFRDSLPLHFDDSLPLDIMKEA 209

Query: 207 LLRAIHDIDTAFSKEASRKKLDSGSTATVVLIAEGQILVANIGDSKALLCSEKFQSPAEA 266
           LLRAIHDID  F+KEAS +KL+SGSTAT+ LIA+GQ++VA+IGDSKALLCSEKF++  EA
Sbjct: 210 LLRAIHDIDVTFTKEASNRKLNSGSTATIALIADGQLMVASIGDSKALLCSEKFETLEEA 269

Query: 267 KATLLRLYRKRRDNNAISTSQGYNYLKSTVSNGLAHFTVKELTRDHHPDREDERYRVEAA 326
           +ATL++LYR+RR N   S S+ ++  K    NGL  F  KELT+DHHP+REDE+ RVEAA
Sbjct: 270 RATLVKLYRERRRNRGSSPSR-FSDFKLEHGNGLLRFIAKELTKDHHPNREDEKIRVEAA 328

Query: 327 GGYVLQWGGVSRVNGQLAVSRAIGDLSYKSYGVISVPEVTDWQSLTANDSYLVAASDGVF 386
           GGYV +W GV RVNGQL VSRAIGDL+Y+SYGVIS PEV DWQ L ANDS+LV +SDG+F
Sbjct: 329 GGYVTEWAGVPRVNGQLTVSRAIGDLTYRSYGVISAPEVMDWQPLVANDSFLVVSSDGIF 388

Query: 387 EKLSLQDVCDVFWEVHTHGTAGPGFPSSCSYSLADCLVDTAFEKGSMDNMAAVVVPLGSI 446
           EKL +Q+VCD+ WEV+   ++G G PS CS SLADCLV+TAFEKGSMDNMAAVVVPL S 
Sbjct: 389 EKLEVQEVCDLLWEVNNQTSSGAGVPSYCSISLADCLVNTAFEKGSMDNMAAVVVPLKSN 448

Query: 447 YVSENLHRERRMEEGDIDCPSKGLQKLVYKQSGSGMNMNLLQLKHAHPLTTKFDRLL 503
            V++   +E+ M +      S            + +N+  LQLK A PL T F+RLL
Sbjct: 449 LVTQLQRKEQSMNDNKDKIASALPCSNCTLPLPNDINLGPLQLKQAQPLGTMFNRLL 505





Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 1EC: 6
>sp|A3CCP9|P2C76_ORYSJ Putative protein phosphatase 2C 76 OS=Oryza sativa subsp. japonica GN=Os11g0586001 PE=3 SV=2 Back     alignment and function description
>sp|Q9M1V8|P2C50_ARATH Putative protein phosphatase 2C 50 OS=Arabidopsis thaliana GN=At3g63320 PE=3 SV=1 Back     alignment and function description
>sp|Q8RXY0|Y3333_ARATH Probable inactive protein kinase At3g63330 OS=Arabidopsis thaliana GN=At3g63330 PE=2 SV=1 Back     alignment and function description
>sp|Q8BXN7|PPM1K_MOUSE Protein phosphatase 1K, mitochondrial OS=Mus musculus GN=Ppm1k PE=1 SV=1 Back     alignment and function description
>sp|Q8N3J5|PPM1K_HUMAN Protein phosphatase 1K, mitochondrial OS=Homo sapiens GN=PPM1K PE=1 SV=1 Back     alignment and function description
>sp|Q6ING9|PPM1K_XENLA Protein phosphatase 1K, mitochondrial OS=Xenopus laevis GN=ppm1k PE=2 SV=1 Back     alignment and function description
>sp|Q2PC20|PPM1K_BOVIN Protein phosphatase 1K, mitochondrial OS=Bos taurus GN=PPM1K PE=2 SV=1 Back     alignment and function description
>sp|Q0JLP9|P2C06_ORYSJ Probable protein phosphatase 2C 6 OS=Oryza sativa subsp. japonica GN=Os01g0583100 PE=2 SV=1 Back     alignment and function description
>sp|Q67UX7|P2C10_ORYSJ Probable protein phosphatase 2C 10 OS=Oryza sativa subsp. japonica GN=Os02g0149800 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query934
359495451 1211 PREDICTED: uncharacterized protein LOC10 0.713 0.549 0.691 0.0
296084483 1069 unnamed protein product [Vitis vinifera] 0.713 0.623 0.691 0.0
255559843 1058 protein phosphatase 2c, putative [Ricinu 0.721 0.637 0.650 0.0
356502797 1135 PREDICTED: uncharacterized protein LOC10 0.694 0.571 0.608 0.0
449455346 1062 PREDICTED: uncharacterized protein LOC10 0.711 0.626 0.580 0.0
357440603 1108 hypothetical protein MTR_1g071370 [Medic 0.744 0.627 0.565 0.0
334186224 1041 putative protein phosphatase 2C 51 [Arab 0.678 0.609 0.541 0.0
7523416816 putative protein [Arabidopsis thaliana] 0.678 0.776 0.537 0.0
334186226 1075 putative protein phosphatase 2C 51 [Arab 0.678 0.589 0.515 0.0
224085531505 predicted protein [Populus trichocarpa] 0.507 0.938 0.690 0.0
>gi|359495451|ref|XP_002274621.2| PREDICTED: uncharacterized protein LOC100263200 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  905 bits (2340), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/668 (69%), Positives = 524/668 (78%), Gaps = 2/668 (0%)

Query: 29  SGESSTCLTVYKEGGAPAVFQSPKCPRWKLSDYNSPPRTTSRCQSAMRQGRRKSQEDRTL 88
           +GESSTCL VYKEGGAPAVFQSPKCP W+LS+  S PRT + CQSAM QGRRKSQEDRT 
Sbjct: 179 NGESSTCLMVYKEGGAPAVFQSPKCPSWRLSNDASRPRTVT-CQSAMSQGRRKSQEDRTF 237

Query: 89  CALDLHIPFPGRRGRQEVTVGIVAVFDGHNGAEASELASKLLLEYFALHTYFLLDATYSA 148
           CALD+ IPFP   G  EV VGIVAVFDGHNGAEASE+ASKLL EYF LHTYFLLDATYS 
Sbjct: 238 CALDVRIPFPRSTGLAEVMVGIVAVFDGHNGAEASEMASKLLFEYFILHTYFLLDATYSV 297

Query: 149 VLKKSARRLPNKGERDIVFQVLNWDEKLGRHELKFERFKFSLPDIFDDSFHLEILREALL 208
           VLKKS  RLP+K ++DIVFQVL+WD++LGRH+   ERFKF++P  FD +FHLEIL+E+LL
Sbjct: 298 VLKKSTGRLPDKEKQDIVFQVLHWDDELGRHQSDLERFKFTIPAKFDGNFHLEILKESLL 357

Query: 209 RAIHDIDTAFSKEASRKKLDSGSTATVVLIAEGQILVANIGDSKALLCSEKFQSPAEAKA 268
           RAIHDID  FSKEASR  LDSGSTATV+LIA+GQILVAN+GDSKALLCSEKFQSPAEAK 
Sbjct: 358 RAIHDIDKTFSKEASRNNLDSGSTATVILIADGQILVANVGDSKALLCSEKFQSPAEAKV 417

Query: 269 TLLRLYRKRRDNNAISTSQGYNYLKSTVSNGLAHFTVKELTRDHHPDREDERYRVEAAGG 328
           TL RLYR+RR + AIS  + Y   K   SNGLAHF+VKELTRDHHPDR+DE+ RVE+AGG
Sbjct: 418 TLSRLYRQRRRSGAISPLKDYENSKFLSSNGLAHFSVKELTRDHHPDRDDEKSRVESAGG 477

Query: 329 YVLQWGGVSRVNGQLAVSRAIGDLSYKSYGVISVPEVTDWQSLTANDSYLVAASDGVFEK 388
           YV +WGGV+RVNGQLAVSRAIGDLS+KSYGVI  PEVTDWQ LT NDSYLVAASDG+FEK
Sbjct: 478 YVYEWGGVARVNGQLAVSRAIGDLSFKSYGVIPTPEVTDWQPLTTNDSYLVAASDGIFEK 537

Query: 389 LSLQDVCDVFWEVHTHGTAGPGFPSSCSYSLADCLVDTAFEKGSMDNMAAVVVPLGSIYV 448
           LS Q+VCD+ WEVH H     GF SSCSYSLA+C+V+TAFEKGSMDNMA VVVPL S   
Sbjct: 538 LSSQEVCDLLWEVHVHPKMRSGFSSSCSYSLAECIVNTAFEKGSMDNMATVVVPLRSTGF 597

Query: 449 SENLHRERRMEEGDIDCPSKGLQKLVYKQSGSGMNMNLLQLKHAHPLTTKFDRLLVEGNH 508
           S+ L  ER    GDIDC   G Q  +YKQS +     L+QL+HAHP+  +FDRLLVEG H
Sbjct: 598 SQALLEERCDGAGDIDCSDLGPQHFIYKQSANVFTSKLVQLEHAHPVMARFDRLLVEGKH 657

Query: 509 GSFGCFYLSENLNDNVDSTFGAQKDDPEDYVYDLSQTLPDTLNHQYGELLNLYNDQNMCL 568
           GSF CFYLSENLN+N D    AQKDD E  +++L Q LP+ L H  G  LNLYN QN+CL
Sbjct: 658 GSFWCFYLSENLNENRDYILRAQKDDEEGDMFNLPQALPEALGHHCGGPLNLYNGQNLCL 717

Query: 569 HFGTTMDGIKDQCFKPGGFASFVGLLESIPFLDVGSEYGSNEYVMPE-RYVLKKRFGRGS 627
           HFG T DG KDQC  P GFASF+GLLESIPF +  S YGS EY MP+ RYVLKKRFGRGS
Sbjct: 718 HFGMTTDGFKDQCINPEGFASFLGLLESIPFHNSDSNYGSFEYAMPDSRYVLKKRFGRGS 777

Query: 628 YGEVWLAFHWNCHEGDNSSRWSELTKNVSGESICEDMSIRNPCNSSSTDDFHGGYFHDSL 687
           YGEVWLAF WNC +G ++S  SE  K  S  ++  D    N   +SST + H G   D+L
Sbjct: 778 YGEVWLAFPWNCSQGADASNESEKKKVFSFNTMHLDSYNGNSQTNSSTHNCHAGPSDDNL 837

Query: 688 FILKRIML 695
           FILKRIM+
Sbjct: 838 FILKRIMV 845




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|296084483|emb|CBI25042.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255559843|ref|XP_002520940.1| protein phosphatase 2c, putative [Ricinus communis] gi|223539777|gb|EEF41357.1| protein phosphatase 2c, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356502797|ref|XP_003520202.1| PREDICTED: uncharacterized protein LOC100781476 [Glycine max] Back     alignment and taxonomy information
>gi|449455346|ref|XP_004145414.1| PREDICTED: uncharacterized protein LOC101210198 [Cucumis sativus] Back     alignment and taxonomy information
>gi|357440603|ref|XP_003590579.1| hypothetical protein MTR_1g071370 [Medicago truncatula] gi|355479627|gb|AES60830.1| hypothetical protein MTR_1g071370 [Medicago truncatula] Back     alignment and taxonomy information
>gi|334186224|ref|NP_567145.2| putative protein phosphatase 2C 51 [Arabidopsis thaliana] gi|332646947|gb|AEE80468.1| putative protein phosphatase 2C 51 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|7523416|emb|CAB86435.1| putative protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|334186226|ref|NP_001190168.1| putative protein phosphatase 2C 51 [Arabidopsis thaliana] gi|332646948|gb|AEE80469.1| putative protein phosphatase 2C 51 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224085531|ref|XP_002307609.1| predicted protein [Populus trichocarpa] gi|222857058|gb|EEE94605.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query934
TAIR|locus:2077319423 AT3G63320 [Arabidopsis thalian 0.306 0.676 0.626 4.6e-103
RGD|1308501372 Ppm1k "protein phosphatase, Mg 0.134 0.338 0.375 4.1e-23
MGI|MGI:2442111372 Ppm1k "protein phosphatase 1K 0.134 0.338 0.382 5.9e-23
ZFIN|ZDB-GENE-110411-37358 si:ch211-149b19.3 "si:ch211-14 0.135 0.354 0.380 1.3e-22
TAIR|locus:2124784311 WIN2 "HOPW1-1-interacting 2" [ 0.127 0.382 0.365 7.6e-22
UNIPROTKB|E2RJI1372 PPM1K "Uncharacterized protein 0.134 0.338 0.361 1e-21
UNIPROTKB|Q8N3J5372 PPM1K "Protein phosphatase 1K, 0.134 0.338 0.368 1.3e-21
UNIPROTKB|Q2PC20372 PPM1K "Protein phosphatase 1K, 0.134 0.338 0.361 1.8e-21
UNIPROTKB|F1P138372 PPM1K "Uncharacterized protein 0.134 0.338 0.361 1.3e-20
UNIPROTKB|E1BF95419 PPM1F "Uncharacterized protein 0.133 0.298 0.407 1e-19
TAIR|locus:2077319 AT3G63320 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 900 (321.9 bits), Expect = 4.6e-103, Sum P(2) = 4.6e-103
 Identities = 186/297 (62%), Positives = 225/297 (75%)

Query:   179 HELKFERFKFSLPDIFDDSFHLEILREALLRAIHDIDTAFSKEASRKKLDSGSTATVVLI 238
             ++L  +RF+ SLP     +FHL+IL+EALLRAI+DID  F+KEAS +KLDSGSTAT+ LI
Sbjct:   121 YDLDSQRFQDSLPL----NFHLDILKEALLRAIYDIDATFTKEASTRKLDSGSTATIALI 176

Query:   239 AEGQILVANIGDSKALLCSEKFQSPAEAKATLLRLYRKRRDNNAISTSQGYNYLKSTVSN 298
             A+GQ+LVA+IGDSKALLCSE++++P EAKATL++LYR+R+ N   S S+ ++ LK     
Sbjct:   177 ADGQLLVASIGDSKALLCSERYETPEEAKATLIKLYRERKRNQDSSPSR-FSDLKLEHRT 235

Query:   299 GLAHFTVKELTRDHHPDREDERYRVEAAGGYVLQWGGVSRVNGQLAVSRAIGDLSYKSYG 358
             GL  F  KELT+DHHPDREDE  RV+AAGGYV +W GV RVNGQLAVSR+IGDL+Y+SYG
Sbjct:   236 GLMRFIAKELTKDHHPDREDEMLRVKAAGGYVTKWAGVPRVNGQLAVSRSIGDLTYRSYG 295

Query:   359 VISVPEVTDWQSLTANDSYLVAASDGVFEKLSLQDVCDVFWEVHTHGTAGPGFPSSCSYS 418
             VIS PEV DWQ L ANDSYLV +SDG+FEKL +QD CD  WEV    + G G PS CS S
Sbjct:   296 VISAPEVMDWQPLVANDSYLVVSSDGIFEKLEVQDACDRLWEVKNQTSFGAGVPSYCSIS 355

Query:   419 LADCLVDTAFEKGSMDNMAAVVVPLGSIYVSENLHRERRMEEGDIDCPSKGLQKLVY 475
             LADCLV+TAFEKGSMDNMAAVVVPL S     NL  E + +E  +  PS    K  Y
Sbjct:   356 LADCLVNTAFEKGSMDNMAAVVVPLKS-----NLDWESQPKEQSVG-PSGFKMKNTY 406


GO:0003824 "catalytic activity" evidence=IEA
GO:0004722 "protein serine/threonine phosphatase activity" evidence=ISS
RGD|1308501 Ppm1k "protein phosphatase, Mg2+/Mn2+ dependent, 1K" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2442111 Ppm1k "protein phosphatase 1K (PP2C domain containing)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110411-37 si:ch211-149b19.3 "si:ch211-149b19.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2124784 WIN2 "HOPW1-1-interacting 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E2RJI1 PPM1K "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N3J5 PPM1K "Protein phosphatase 1K, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q2PC20 PPM1K "Protein phosphatase 1K, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1P138 PPM1K "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BF95 PPM1F "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3.16LOW CONFIDENCE prediction!
3rd Layer3.1.3LOW CONFIDENCE prediction!
4th Layer2.7.11.10.737
3rd Layer2.7.110.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00023800001
SubName- Full=Chromosome chr7 scaffold_31, whole genome shotgun sequence; (597 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query934
cd00143254 cd00143, PP2Cc, Serine/threonine phosphatases, fam 4e-52
smart00332252 smart00332, PP2Cc, Serine/threonine phosphatases, 7e-44
pfam00481252 pfam00481, PP2C, Protein phosphatase 2C 1e-40
COG0631262 COG0631, PTC1, Serine/threonine protein phosphatas 2e-21
PTZ00224381 PTZ00224, PTZ00224, protein phosphatase 2C; Provis 9e-20
PLN03145365 PLN03145, PLN03145, Protein phosphatase 2c; Provis 1e-18
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 2e-18
cd05118283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 5e-18
pfam00069260 pfam00069, Pkinase, Protein kinase domain 3e-17
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 4e-16
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 3e-15
cd07852337 cd07852, STKc_MAPK15, Catalytic domain of the Seri 3e-15
cd07834330 cd07834, STKc_MAPK, Catalytic domain of the Serine 3e-14
cd07832286 cd07832, STKc_CCRK, Catalytic domain of the Serine 4e-14
cd07829282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 1e-13
cd07871288 cd07871, STKc_PCTAIRE3, Catalytic domain of the Se 2e-13
cd07844291 cd07844, STKc_PCTAIRE_like, Catalytic domain of PC 2e-12
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 4e-12
cd07849336 cd07849, STKc_ERK1_2_like, Catalytic domain of Ext 5e-12
cd07858337 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of 8e-12
cd07841298 cd07841, STKc_CDK7, Catalytic domain of the Serine 8e-12
cd07854342 cd07854, STKc_MAPK4_6, Catalytic domain of the Ser 1e-11
cd07833288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 2e-11
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 5e-11
cd07866311 cd07866, STKc_BUR1, Catalytic domain of the Serine 6e-11
cd07857332 cd07857, STKc_MPK1, Catalytic domain of the Serine 6e-11
cd07855334 cd07855, STKc_ERK5, Catalytic domain of the Serine 8e-11
cd07876359 cd07876, STKc_JNK2, Catalytic domain of the Serine 8e-11
cd07831282 cd07831, STKc_MOK, Catalytic domain of the Serine/ 9e-11
cd07850353 cd07850, STKc_JNK, Catalytic domain of the Serine/ 2e-10
cd07859338 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of 5e-10
cd07851343 cd07851, STKc_p38, Catalytic domain of the Serine/ 7e-10
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 1e-09
cd07875364 cd07875, STKc_JNK1, Catalytic domain of the Serine 2e-09
cd07880343 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of 3e-09
cd07845309 cd07845, STKc_CDK10, Catalytic domain of the Serin 4e-09
cd07839284 cd07839, STKc_CDK5, Catalytic domain of the Serine 5e-09
cd07837295 cd07837, STKc_CdkB_plant, Catalytic domain of the 5e-09
cd07847286 cd07847, STKc_CDKL1_4, Catalytic domain of the Ser 5e-09
cd07836284 cd07836, STKc_Pho85, Catalytic domain of the Serin 7e-09
cd07856328 cd07856, STKc_Sty1_Hog1, Catalytic domain of the S 9e-09
cd07879342 cd07879, STKc_p38delta_MAPK13, Catalytic domain of 9e-09
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 1e-08
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 2e-08
cd07846286 cd07846, STKc_CDKL2_3, Catalytic domain of the Ser 2e-08
cd07873301 cd07873, STKc_PCTAIRE1, Catalytic domain of the Se 3e-08
cd07869303 cd07869, STKc_PFTAIRE1, Catalytic domain of the Se 4e-08
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 5e-08
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 8e-08
PTZ00036440 PTZ00036, PTZ00036, glycogen synthase kinase; Prov 8e-08
cd05572262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 9e-08
cd07843293 cd07843, STKc_CDC2L1, Catalytic domain of the Seri 1e-07
cd05580290 cd05580, STKc_PKA, Catalytic domain of the Protein 1e-07
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 2e-07
cd07861285 cd07861, STKc_CDK1_euk, Catalytic domain of the Se 3e-07
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 4e-07
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 4e-07
PLN00034353 PLN00034, PLN00034, mitogen-activated protein kina 5e-07
cd07835283 cd07835, STKc_CDK1_like, Catalytic domain of Cycli 6e-07
cd07878343 cd07878, STKc_p38beta_MAPK11, Catalytic domain of 6e-07
cd07870291 cd07870, STKc_PFTAIRE2, Catalytic domain of the Se 7e-07
cd07872309 cd07872, STKc_PCTAIRE2, Catalytic domain of the Se 8e-07
cd07830283 cd07830, STKc_MAK_like, Catalytic domain of Male g 1e-06
cd07842316 cd07842, STKc_CDK8_like, Catalytic domain of Cycli 1e-06
cd07874355 cd07874, STKc_JNK3, Catalytic domain of the Serine 1e-06
PTZ00024335 PTZ00024, PTZ00024, cyclin-dependent protein kinas 1e-06
PLN03225566 PLN03225, PLN03225, Serine/threonine-protein kinas 1e-06
cd07848287 cd07848, STKc_CDKL5, Catalytic domain of the Serin 2e-06
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 2e-06
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 2e-06
cd07853372 cd07853, STKc_NLK, Catalytic domain of the Serine/ 3e-06
cd05599364 cd05599, STKc_NDR_like, Catalytic domain of Nuclea 3e-06
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 6e-06
cd07877345 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of 6e-06
cd07865310 cd07865, STKc_CDK9, Catalytic domain of the Serine 1e-05
PLN00009294 PLN00009, PLN00009, cyclin-dependent kinase A; Pro 1e-05
cd05601330 cd05601, STKc_CRIK, Catalytic domain of the Protei 1e-05
cd06917277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 1e-05
PHA03209357 PHA03209, PHA03209, serine/threonine kinase US3; P 2e-05
cd05624331 cd05624, STKc_MRCK_beta, Catalytic domain of the P 2e-05
cd05586330 cd05586, STKc_Sck1_like, Catalytic domain of Suppr 3e-05
cd05573350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 3e-05
PLN03224507 PLN03224, PLN03224, probable serine/threonine prot 3e-05
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 4e-05
cd06621287 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of 5e-05
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 5e-05
cd06624268 cd06624, STKc_ASK, Catalytic domain of the Protein 7e-05
cd05596370 cd05596, STKc_ROCK, Catalytic domain of the Protei 8e-05
cd05600333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 1e-04
cd07860284 cd07860, STKc_CDK2_3, Catalytic domain of the Seri 1e-04
cd05597331 cd05597, STKc_DMPK_like, Catalytic domain of Myoto 1e-04
cd07838287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 1e-04
cd05623332 cd05623, STKc_MRCK_alpha, Catalytic domain of the 1e-04
cd06622286 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of 2e-04
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 2e-04
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 3e-04
cd05577277 cd05577, STKc_GRK, Catalytic domain of the Protein 4e-04
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 4e-04
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 5e-04
PHA03212391 PHA03212, PHA03212, serine/threonine kinase US3; P 5e-04
cd05609305 cd05609, STKc_MAST, Catalytic domain of the Protei 6e-04
cd07830283 cd07830, STKc_MAK_like, Catalytic domain of Male g 8e-04
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 8e-04
PHA03207392 PHA03207, PHA03207, serine/threonine kinase US3; P 9e-04
cd05612291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 0.001
cd05585312 cd05585, STKc_YPK1_like, Catalytic domain of Yeast 0.001
cd05605285 cd05605, STKc_GRK4_like, Catalytic domain of G pro 0.001
cd08220256 cd08220, STKc_Nek8, Catalytic domain of the Protei 0.001
cd06647293 cd06647, STKc_PAK_I, Catalytic domain of the Prote 0.001
cd05630285 cd05630, STKc_GRK6, Catalytic domain of the Protei 0.001
cd07864302 cd07864, STKc_CDK12, Catalytic domain of the Serin 0.002
PTZ00426340 PTZ00426, PTZ00426, cAMP-dependent protein kinase 0.002
cd05621370 cd05621, STKc_ROCK2, Catalytic domain of the Prote 0.002
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 0.002
cd05628363 cd05628, STKc_NDR1, Catalytic domain of the Protei 0.003
TIGR03903 1266 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclas 0.003
cd05632285 cd05632, STKc_GRK5, Catalytic domain of the Protei 0.003
cd05584323 cd05584, STKc_p70S6K, Catalytic domain of the Prot 0.004
cd05622371 cd05622, STKc_ROCK1, Catalytic domain of the Prote 0.004
cd05571323 cd05571, STKc_PKB, Catalytic domain of the Protein 0.004
>gnl|CDD|238083 cd00143, PP2Cc, Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity Back     alignment and domain information
 Score =  182 bits (465), Expect = 4e-52
 Identities = 107/370 (28%), Positives = 146/370 (39%), Gaps = 125/370 (33%)

Query: 76  RQGRRKSQEDRTLCALDLHIPFPGRRGRQEVTVGIVAVFDGHNGAEASELASKLLLEYFA 135
           + G RK+ ED  +   +L+              G+  VFDGH G  A E ASKLL+E   
Sbjct: 8   KGGDRKTNEDAVVIKPNLNNE----------DGGLFGVFDGHGGHAAGEFASKLLVEE-- 55

Query: 136 LHTYFLLDATYSAVLKKSARRLPNKGERDIVFQVLNWDEKLGRHELKFERFKFSLPDIFD 195
                         L +         E DI                              
Sbjct: 56  --------------LLEELEETLTLSEEDI------------------------------ 71

Query: 196 DSFHLEILREALLRAIHDIDTAFSKEASRKKLD--SGSTATVVLIAEGQILVANIGDSKA 253
                    EAL +A    D    +EA  +  D  SG+TA V LI   ++ VAN+GDS+A
Sbjct: 72  --------EEALRKAFLRADEEILEEAQDEPDDARSGTTAVVALIRGNKLYVANVGDSRA 123

Query: 254 LLCSEKFQSPAEAKATLLRLYRKRRDNNAISTSQGYNYLKSTVSNGLAHFTVKELTRDHH 313
           +LC                     R+  A+                       +LT+DH 
Sbjct: 124 VLC---------------------RNGEAV-----------------------QLTKDHK 139

Query: 314 PDREDERYRVEAAGGYVLQWGGVSRVNGQLAVSRAIGDLSYKSYGVISVPEVTDWQSLTA 373
           P  E+ER R+E AGG V       RV G LAV+RA+GD   K  GV + P+VT  + LT 
Sbjct: 140 PVNEEERERIEKAGGRVSNG----RVPGVLAVTRALGDFDLK-PGVSAEPDVTVVK-LTE 193

Query: 374 NDSYLVAASDGVFEKLSLQDVCDVFWEVHTHGTAGPGFPSSCSYSLADCLVDTAFEKGSM 433
           +D +L+ ASDG+++ LS Q+  D+   V +                A  LVD A  +GS 
Sbjct: 194 DDDFLILASDGLWDVLSNQEAVDI---VRSELA------KEDLQEAAQELVDLALRRGSH 244

Query: 434 DNMAAVVVPL 443
           DN+  VVV L
Sbjct: 245 DNITVVVVRL 254


Length = 254

>gnl|CDD|214625 smart00332, PP2Cc, Serine/threonine phosphatases, family 2C, catalytic domain Back     alignment and domain information
>gnl|CDD|215938 pfam00481, PP2C, Protein phosphatase 2C Back     alignment and domain information
>gnl|CDD|223704 COG0631, PTC1, Serine/threonine protein phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|240318 PTZ00224, PTZ00224, protein phosphatase 2C; Provisional Back     alignment and domain information
>gnl|CDD|215603 PLN03145, PLN03145, Protein phosphatase 2c; Provisional Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>gnl|CDD|143381 cd07876, STKc_JNK2, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>gnl|CDD|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>gnl|CDD|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|143374 cd07869, STKc_PFTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173333 PTZ00036, PTZ00036, glycogen synthase kinase; Provisional Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143383 cd07878, STKc_p38beta_MAPK11, Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|143375 cd07870, STKc_PFTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143379 cd07874, STKc_JNK3, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215638 PLN03225, PLN03225, Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|173748 cd07853, STKc_NLK, Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|143382 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional Back     alignment and domain information
>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|177557 PHA03209, PHA03209, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|178763 PLN03224, PLN03224, probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|165478 PHA03212, PHA03212, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|165473 PHA03207, PHA03207, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>gnl|CDD|234389 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclase fusion protein Back     alignment and domain information
>gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 934
KOG0697379 consensus Protein phosphatase 1B (formerly 2C) [Si 100.0
KOG0698330 consensus Serine/threonine protein phosphatase [Si 100.0
PLN03145365 Protein phosphatase 2c; Provisional 100.0
KOG0700390 consensus Protein phosphatase 2C/pyruvate dehydrog 100.0
PF00481254 PP2C: Protein phosphatase 2C; InterPro: IPR001932 100.0
PTZ00224381 protein phosphatase 2C; Provisional 100.0
KOG0699542 consensus Serine/threonine protein phosphatase [Si 100.0
KOG0593 396 consensus Predicted protein kinase KKIAMRE [Genera 100.0
KOG0615475 consensus Serine/threonine protein kinase Chk2 and 100.0
KOG0661 538 consensus MAPK related serine/threonine protein ki 100.0
KOG0659318 consensus Cdk activating kinase (CAK)/RNA polymera 100.0
COG0631262 PTC1 Serine/threonine protein phosphatase [Signal 100.0
KOG0660359 consensus Mitogen-activated protein kinase [Signal 100.0
KOG0575 592 consensus Polo-like serine/threonine protein kinas 100.0
KOG0663419 consensus Protein kinase PITSLRE and related kinas 100.0
KOG0598357 consensus Ribosomal protein S6 kinase and related 100.0
KOG0581364 consensus Mitogen-activated protein kinase kinase 100.0
KOG0592 604 consensus 3-phosphoinositide-dependent protein kin 100.0
KOG0600 560 consensus Cdc2-related protein kinase [Cell cycle 100.0
KOG1323493 consensus Serine/threonine phosphatase [Signal tra 100.0
KOG0667586 consensus Dual-specificity tyrosine-phosphorylatio 100.0
KOG0594323 consensus Protein kinase PCTAIRE and related kinas 100.0
KOG0658364 consensus Glycogen synthase kinase-3 [Carbohydrate 100.0
KOG0582 516 consensus Ste20-like serine/threonine protein kina 100.0
KOG0605550 consensus NDR and related serine/threonine kinases 100.0
KOG0585 576 consensus Ca2+/calmodulin-dependent protein kinase 100.0
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 100.0
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 100.0
KOG0033355 consensus Ca2+/calmodulin-dependent protein kinase 100.0
KOG0198313 consensus MEKK and related serine/threonine protei 100.0
KOG0583370 consensus Serine/threonine protein kinase [Signal 100.0
KOG0616355 consensus cAMP-dependent protein kinase catalytic 100.0
KOG0671415 consensus LAMMER dual specificity kinases [Signal 100.0
KOG0595 429 consensus Serine/threonine-protein kinase involved 100.0
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 100.0
KOG0591375 consensus NIMA (never in mitosis)-related G2-speci 100.0
KOG0578550 consensus p21-activated serine/threonine protein k 100.0
KOG0201 467 consensus Serine/threonine protein kinase [Signal 100.0
cd00143254 PP2Cc Serine/threonine phosphatases, family 2C, ca 100.0
KOG1290590 consensus Serine/threonine protein kinase [Signal 100.0
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 100.0
KOG0694694 consensus Serine/threonine protein kinase [Signal 100.0
smart00332255 PP2Cc Serine/threonine phosphatases, family 2C, ca 100.0
PTZ00284467 protein kinase; Provisional 100.0
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 100.0
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 100.0
PHA03212391 serine/threonine kinase US3; Provisional 100.0
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 100.0
KOG0666438 consensus Cyclin C-dependent kinase CDK8 [Transcri 100.0
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 100.0
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 100.0
KOG0599 411 consensus Phosphorylase kinase gamma subunit [Carb 100.0
PTZ00036440 glycogen synthase kinase; Provisional 100.0
KOG4717 864 consensus Serine/threonine protein kinase [Signal 100.0
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 100.0
KOG0662292 consensus Cyclin-dependent kinase CDK5 [Intracellu 100.0
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 100.0
PTZ00263329 protein kinase A catalytic subunit; Provisional 100.0
PRK14559645 putative protein serine/threonine phosphatase; Pro 100.0
KOG0032382 consensus Ca2+/calmodulin-dependent protein kinase 100.0
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 100.0
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 100.0
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 100.0
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 100.0
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 100.0
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 100.0
KOG0580281 consensus Serine/threonine protein kinase [Cell cy 100.0
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 100.0
PHA03207392 serine/threonine kinase US3; Provisional 99.98
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 99.98
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 99.98
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 99.98
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.98
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.98
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.98
PHA03211461 serine/threonine kinase US3; Provisional 99.98
PLN00034353 mitogen-activated protein kinase kinase; Provision 99.98
PHA03209357 serine/threonine kinase US3; Provisional 99.98
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.98
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.98
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.97
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.97
KOG0611 668 consensus Predicted serine/threonine protein kinas 99.97
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.97
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.97
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.97
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 99.97
KOG0596677 consensus Dual specificity; serine/threonine and t 99.97
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.97
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.97
KOG0577 948 consensus Serine/threonine protein kinase [Signal 99.97
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.97
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.97
KOG0604400 consensus MAP kinase-activated protein kinase 2 [S 99.97
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.97
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 99.97
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.97
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.97
KOG0669376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 99.97
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 99.97
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.97
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.97
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.97
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 99.97
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.97
PHA03210501 serine/threonine kinase US3; Provisional 99.97
PTZ00283 496 serine/threonine protein kinase; Provisional 99.97
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.97
KOG0610459 consensus Putative serine/threonine protein kinase 99.97
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.97
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.97
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.97
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.97
KOG4236888 consensus Serine/threonine protein kinase PKC mu/P 99.97
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.97
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.97
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 99.97
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.97
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.97
KOG0668338 consensus Casein kinase II, alpha subunit [Signal 99.97
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.97
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.97
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.97
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.97
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.97
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.97
KOG0574 502 consensus STE20-like serine/threonine kinase MST [ 99.97
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.97
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 99.97
KOG2345302 consensus Serine/threonine protein kinase/TGF-beta 99.97
KOG0670752 consensus U4/U6-associated splicing factor PRP4 [R 99.97
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.97
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.97
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.97
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.97
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.97
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.97
KOG0986 591 consensus G protein-coupled receptor kinase [Signa 99.97
KOG0983391 consensus Mitogen-activated protein kinase (MAPK) 99.97
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.97
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.97
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.97
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.97
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.97
KOG0690516 consensus Serine/threonine protein kinase [Signal 99.97
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.97
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 99.97
KOG0192362 consensus Tyrosine kinase specific for activated ( 99.97
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.97
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.97
KOG0664449 consensus Nemo-like MAPK-related serine/threonine 99.97
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.97
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.97
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.97
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.97
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.97
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.97
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.97
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.97
KOG0589 426 consensus Serine/threonine protein kinase [General 99.97
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.97
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.96
PTZ00267 478 NIMA-related protein kinase; Provisional 99.96
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.96
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.96
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.96
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.96
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.96
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.96
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.96
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.96
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.96
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.96
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.96
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.96
KOG0696683 consensus Serine/threonine protein kinase [Signal 99.96
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.96
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.96
KOG0193678 consensus Serine/threonine protein kinase RAF [Sig 99.96
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.96
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.96
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 99.96
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.96
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.96
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.96
KOG0665369 consensus Jun-N-terminal kinase (JNK) [Signal tran 99.96
KOG0607463 consensus MAP kinase-interacting kinase and relate 99.96
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.96
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.96
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.96
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.96
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.96
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.96
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.96
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.96
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.96
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.96
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.96
PHA02882294 putative serine/threonine kinase; Provisional 99.96
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.96
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.96
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.96
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 99.96
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.96
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.96
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.96
KOG0197468 consensus Tyrosine kinases [Signal transduction me 99.96
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.96
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.96
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.96
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.96
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.96
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.96
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.96
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.96
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.96
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.96
KOG46451509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 99.96
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.96
KOG0584 632 consensus Serine/threonine protein kinase [General 99.96
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.96
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 99.96
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.96
PLN00009294 cyclin-dependent kinase A; Provisional 99.96
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.96
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.96
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.96
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.96
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.96
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.96
PTZ00024335 cyclin-dependent protein kinase; Provisional 99.96
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.96
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 99.96
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.96
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.96
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.96
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.96
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.96
KOG0614732 consensus cGMP-dependent protein kinase [Signal tr 99.96
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.96
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.96
KOG1989 738 consensus ARK protein kinase family [Signal transd 99.96
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 99.96
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 99.96
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.96
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.96
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.96
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 99.96
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.96
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.95
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 99.95
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.95
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.95
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.95
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.95
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.95
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.95
KOG4721 904 consensus Serine/threonine protein kinase, contain 99.95
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.95
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.95
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.95
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.95
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.95
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.95
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.95
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.95
KOG0586 596 consensus Serine/threonine protein kinase [General 99.95
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.95
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.95
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.95
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.95
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.95
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.95
KOG1167418 consensus Serine/threonine protein kinase of the C 99.95
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.95
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.95
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.95
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.95
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.95
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.95
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.95
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.95
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.95
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.95
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.95
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.95
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.95
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.95
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.95
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.95
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.95
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.95
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.95
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 99.95
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.95
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.95
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.95
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.95
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.95
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.95
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.95
KOG0603612 consensus Ribosomal protein S6 kinase [Signal tran 99.95
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.95
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.95
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.95
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.95
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.95
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.95
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.95
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.95
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.95
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.95
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.95
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.95
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.95
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.94
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.94
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.94
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.94
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.94
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.94
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.94
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.94
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.94
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.94
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.94
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.94
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.94
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.94
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.94
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.94
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.94
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.94
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.94
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.94
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.94
KOG1151775 consensus Tousled-like protein kinase [Signal tran 99.94
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.94
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.94
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 99.94
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.94
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.94
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.94
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.94
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.94
PHA02988283 hypothetical protein; Provisional 99.94
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.94
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.94
KOG1026774 consensus Nerve growth factor receptor TRKA and re 99.94
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.94
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.94
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.94
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.94
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.94
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.94
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.94
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.94
KOG0695593 consensus Serine/threonine protein kinase [Signal 99.94
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.94
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.94
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.94
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.94
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.94
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.94
KOG1006361 consensus Mitogen-activated protein kinase (MAPK) 99.94
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 99.94
KOG10951025 consensus Protein tyrosine kinase [Signal transduc 99.94
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.94
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.94
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.94
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.94
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.94
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.94
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.93
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.93
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.93
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.93
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.93
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.93
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.93
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.93
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 99.93
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.93
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.93
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.93
KOG06081034 consensus Warts/lats-like serine threonine kinases 99.93
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.93
KOG1187361 consensus Serine/threonine protein kinase [Signal 99.93
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.93
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.93
PLN03224507 probable serine/threonine protein kinase; Provisio 99.93
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.93
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 99.93
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.93
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.93
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 99.92
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.92
KOG0194474 consensus Protein tyrosine kinase [Signal transduc 99.92
KOG2052513 consensus Activin A type IB receptor, serine/threo 99.92
KOG1027 903 consensus Serine/threonine protein kinase and endo 99.92
KOG1094807 consensus Discoidin domain receptor DDR1 [Signal t 99.91
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 99.91
KOG0984282 consensus Mitogen-activated protein kinase (MAPK) 99.91
KOG0196 996 consensus Tyrosine kinase, EPH (ephrin) receptor f 99.91
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.91
KOG3653534 consensus Transforming growth factor beta/activin 99.9
KOG0576 829 consensus Mitogen-activated protein kinase kinase 99.89
KOG1025 1177 consensus Epidermal growth factor receptor EGFR an 99.89
PLN00181 793 protein SPA1-RELATED; Provisional 99.88
KOG0200609 consensus Fibroblast/platelet-derived growth facto 99.88
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.87
KOG1152772 consensus Signal transduction serine/threonine kin 99.87
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.86
KOG1345378 consensus Serine/threonine kinase [Signal transduc 99.86
KOG1024563 consensus Receptor-like protein tyrosine kinase RY 99.86
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.81
KOG0590601 consensus Checkpoint kinase and related serine/thr 99.81
KOG1163341 consensus Casein kinase (serine/threonine/tyrosine 99.79
KOG06181081 consensus Serine/threonine phosphatase 2C containi 99.79
KOG1165449 consensus Casein kinase (serine/threonine/tyrosine 99.79
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.77
KOG1164322 consensus Casein kinase (serine/threonine/tyrosine 99.75
KOG0606 1205 consensus Microtubule-associated serine/threonine 99.73
PRK09188365 serine/threonine protein kinase; Provisional 99.68
COG0515384 SPS1 Serine/threonine protein kinase [General func 99.67
KOG1379330 consensus Serine/threonine protein phosphatase [Si 99.66
KOG4158598 consensus BRPK/PTEN-induced protein kinase [Signal 99.65
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 99.65
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 99.64
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 99.64
PF13672212 PP2C_2: Protein phosphatase 2C; PDB: 2JFT_A 2JFS_A 99.56
KOG1166974 consensus Mitotic checkpoint serine/threonine prot 99.56
KOG1033516 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati 99.5
smart00331193 PP2C_SIG Sigma factor PP2C-like phosphatases. 99.48
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.48
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.43
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.41
PRK12274218 serine/threonine protein kinase; Provisional 99.38
KOG0590 601 consensus Checkpoint kinase and related serine/thr 99.3
smart00090237 RIO RIO-like kinase. 99.27
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.25
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 99.13
PRK10345210 hypothetical protein; Provisional 99.13
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 99.13
KOG1023 484 consensus Natriuretic peptide receptor, guanylate 99.12
TIGR02865764 spore_II_E stage II sporulation protein E. Stage I 99.04
KOG0601 524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 99.01
PRK14879211 serine/threonine protein kinase; Provisional 98.97
PRK09605535 bifunctional UGMP family protein/serine/threonine 98.97
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 98.97
KOG0606 1205 consensus Microtubule-associated serine/threonine 98.79
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 98.71
PF07228193 SpoIIE: Stage II sporulation protein E (SpoIIE); I 98.67
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 98.62
KOG2137 700 consensus Protein kinase [Signal transduction mech 98.33
KOG1266458 consensus Protein kinase [Signal transduction mech 98.31
KOG0601524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 98.21
TIGR01982437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 98.19
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 98.15
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 98.14
PRK04750537 ubiB putative ubiquinone biosynthesis protein UbiB 98.13
KOG1243 690 consensus Protein kinase [General function predict 97.73
COG4248 637 Uncharacterized protein with protein kinase and he 97.71
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 97.5
KOG3087229 consensus Serine/threonine protein kinase [General 97.21
cd05154223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 97.11
KOG3741655 consensus Poly(A) ribonuclease subunit [RNA proces 97.0
PRK15123268 lipopolysaccharide core heptose(I) kinase RfaP; Pr 96.9
PF06293206 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; 96.77
KOG0576 829 consensus Mitogen-activated protein kinase kinase 96.67
COG0478304 RIO-like serine/threonine protein kinase fused to 96.29
PF01163188 RIO1: RIO1 family; InterPro: IPR018934 Protein pho 96.25
PRK09902216 hypothetical protein; Provisional 96.11
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 95.74
COG1718268 RIO1 Serine/threonine protein kinase involved in c 95.27
COG0661517 AarF Predicted unusual protein kinase [General fun 94.93
PF06176229 WaaY: Lipopolysaccharide core biosynthesis protein 94.75
COG2208367 RsbU Serine phosphatase RsbU, regulator of sigma s 94.05
KOG1235538 consensus Predicted unusual protein kinase [Genera 93.37
PF13095207 FTA2: Kinetochore Sim4 complex subunit FTA2 92.11
COG2112201 Predicted Ser/Thr protein kinase [Signal transduct 91.72
KOG1093 725 consensus Predicted protein kinase (contains TBC a 89.47
KOG1826 2724 consensus Ras GTPase activating protein RasGAP/neu 83.96
KOG2268465 consensus Serine/threonine protein kinase [Signal 83.85
TIGR00938307 thrB_alt homoserine kinase, Neisseria type. Homose 82.76
PF12260188 PIP49_C: Protein-kinase domain of FAM69; InterPro: 81.3
cd05155235 APH_ChoK_like_1 Uncharacterized bacterial proteins 80.95
TIGR02906313 spore_CotS spore coat protein, CotS family. Member 80.51
PRK05231319 homoserine kinase; Provisional 80.5
>KOG0697 consensus Protein phosphatase 1B (formerly 2C) [Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=1.2e-53  Score=424.80  Aligned_cols=263  Identities=31%  Similarity=0.449  Sum_probs=223.7

Q ss_pred             cceeeeeeeeccCCccccceeeeeccCCCCCCCCCCccceEEEEEEecCCCchHHHHHHHHHHHHHHHHHhhhhhhhHHH
Q 002341           68 TSRCQSAMRQGRRKSQEDRTLCALDLHIPFPGRRGRQEVTVGIVAVFDGHNGAEASELASKLLLEYFALHTYFLLDATYS  147 (934)
Q Consensus        68 ~~~~~~~~~~G~R~~~ED~~~~~~~~~~~~~~~~~~~~~~~~lfgVfDGHgG~~~a~~~s~~L~~~i~~~~~~~~~~~~~  147 (934)
                      ..+||.+++||||-.|||+|.+...+.-|+        .+|+||||||||.|+..|.+|+++|+++|...-.+      .
T Consensus        21 glryg~SSMQGWR~eMEDah~A~~~l~~~l--------~dWSfFAVfDGHAGs~va~~c~~hLlehi~sse~F------~   86 (379)
T KOG0697|consen   21 GLRYGVSSMQGWRVEMEDAHTAVAGLPSPL--------EDWSFFAVFDGHAGSQVANHCAEHLLEHIISSEEF------R   86 (379)
T ss_pred             ceeeeeccccchhhhhhhhhhhhhcCCCCc--------cCceEEEEEcCccchHHHHHHHHHHHHHhhhhHHH------h
Confidence            467999999999999999999887765444        37999999999999999999999999988643211      0


Q ss_pred             HHHHhhhccCCCCCCccchhhcccchhhhccchhhhhhcccCCCcccccchhHHHHHHHHHHHHHHHHHHHHHHhc--cC
Q 002341          148 AVLKKSARRLPNKGERDIVFQVLNWDEKLGRHELKFERFKFSLPDIFDDSFHLEILREALLRAIHDIDTAFSKEAS--RK  225 (934)
Q Consensus       148 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~al~~af~~~d~~i~~~~~--~~  225 (934)
                      .+.                                             ..-..+.++.-|+.+|+++|+.+.....  ..
T Consensus        87 ~~~---------------------------------------------k~gsv~~~~~GIrtGFL~iDE~mr~~~~~~~~  121 (379)
T KOG0697|consen   87 GMT---------------------------------------------KNGSVENVEKGIRTGFLSIDEIMRTLSDISKG  121 (379)
T ss_pred             hhc---------------------------------------------cCCcHHHHHhhHhhcceeHHHHHhhhhhhhcc
Confidence            000                                             0112466788999999999988765432  23


Q ss_pred             CCCCCceeEeeeeeCCeEEEEEcccceeEEeccCCCChhHHHHHHHHHHhhccCCcccccccccccccccccCCccccee
Q 002341          226 KLDSGSTATVVLIAEGQILVANIGDSKALLCSEKFQSPAEAKATLLRLYRKRRDNNAISTSQGYNYLKSTVSNGLAHFTV  305 (934)
Q Consensus       226 ~~~sGsTa~v~~i~~~~l~vAnvGDSRavl~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~G~~~~~~  305 (934)
                      ...+||||+.+++...++|++|+||||||||+++                                            .+
T Consensus       122 ~drsGsTAVcv~vsp~h~y~~NcGDSRavl~rng--------------------------------------------~~  157 (379)
T KOG0697|consen  122 SDRSGSTAVCVFVSPTHIYIINCGDSRAVLCRNG--------------------------------------------EV  157 (379)
T ss_pred             cccCCceEEEEEecCceEEEEecCcchhheecCC--------------------------------------------ce
Confidence            3569999999999999999999999999999765                                            67


Q ss_pred             eecCCCCCCCChhHHHHHHHcCCEEEeccCcccccCccceecccCCCCCccCC--------cccCCceeEEeecCCCCeE
Q 002341          306 KELTRDHHPDREDERYRVEAAGGYVLQWGGVSRVNGQLAVSRAIGDLSYKSYG--------VISVPEVTDWQSLTANDSY  377 (934)
Q Consensus       306 ~~Lt~DH~~~~~~E~~RI~~~gg~v~~~~~~~Rv~g~L~~sRa~GD~~~K~~g--------v~a~Pev~~~~~l~~~d~f  377 (934)
                      .--|.||+|.+|.|++||+++||.|.-    .||||.||+||||||+.||..+        |+++|||.... ....|+|
T Consensus       158 ~f~TqDHKP~~p~EkeRIqnAGGSVMI----qRvNGsLAVSRAlGDydyK~v~~kgp~eQlVSPEPev~~~~-R~eedeF  232 (379)
T KOG0697|consen  158 VFSTQDHKPYLPKEKERIQNAGGSVMI----QRVNGSLAVSRALGDYDYKNVPGKGPTEQLVSPEPEVYIIE-RSEEDEF  232 (379)
T ss_pred             EEeccCCCCCChHHHHHHhcCCCeEEE----EEecceeeeehhccCcccccCCCCCchhcccCCCCceEEee-ccccCcE
Confidence            788999999999999999999999986    8999999999999999999742        89999999876 5677779


Q ss_pred             EEEEcCCCccccCHHHHHHHHHHHhhcCCCCCCCCCcchHHHHHHHHHHHHhcCCCCCcEEEEEEcCCC
Q 002341          378 LVAASDGVFEKLSLQDVCDVFWEVHTHGTAGPGFPSSCSYSLADCLVDTAFEKGSMDNMAAVVVPLGSI  446 (934)
Q Consensus       378 LVLaSDGLwd~ls~~evv~~v~~~~~~~~~~~~~~~~~~~~~a~~lv~~A~~~gs~DNiT~ivv~l~~~  446 (934)
                      |||||||+||+|+|+|++++|...+.-..        .+..+|..+++..+-+||+||||+++|.|.+.
T Consensus       233 ivlACDGIwDVMtneelcefv~sRl~Vt~--------dL~~vcn~VvDtCLhKGSRDNMsivlvcfp~A  293 (379)
T KOG0697|consen  233 IVLACDGIWDVMTNEELCEFVKSRLEVTS--------DLEEVCNDVVDTCLHKGSRDNMSIVLVCFPGA  293 (379)
T ss_pred             EEEEccchhhhcccHHHHHHHHhhheecc--------cHHHHHHHHHHHHHhccCccCceEEEEecCCC
Confidence            99999999999999999999988776222        27899999999999999999999999998764



>KOG0698 consensus Serine/threonine protein phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03145 Protein phosphatase 2c; Provisional Back     alignment and domain information
>KOG0700 consensus Protein phosphatase 2C/pyruvate dehydrogenase (lipoamide) phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PF00481 PP2C: Protein phosphatase 2C; InterPro: IPR001932 This domain is found in protein phosphatase 2C, as well as other proteins eg Back     alignment and domain information
>PTZ00224 protein phosphatase 2C; Provisional Back     alignment and domain information
>KOG0699 consensus Serine/threonine protein phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG0631 PTC1 Serine/threonine protein phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1323 consensus Serine/threonine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd00143 PP2Cc Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity Back     alignment and domain information
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>smart00332 PP2Cc Serine/threonine phosphatases, family 2C, catalytic domain Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>PRK14559 putative protein serine/threonine phosphatase; Provisional Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1379 consensus Serine/threonine protein phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>PF13672 PP2C_2: Protein phosphatase 2C; PDB: 2JFT_A 2JFS_A 2V06_A 2JFR_A 2J86_A 2J82_A 2Y09_A 2XZV_A 2CM1_A 1TXO_B Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00331 PP2C_SIG Sigma factor PP2C-like phosphatases Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02865 spore_II_E stage II sporulation protein E Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>PF07228 SpoIIE: Stage II sporulation protein E (SpoIIE); InterPro: IPR001932 This domain is found in protein phosphatase 2C, as well as other proteins eg Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1266 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains [General function prediction only] Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3087 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>KOG3741 consensus Poly(A) ribonuclease subunit [RNA processing and modification] Back     alignment and domain information
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional Back     alignment and domain information
>PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] Back     alignment and domain information
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK09902 hypothetical protein; Provisional Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1718 RIO1 Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms / Cell division and chromosome partitioning] Back     alignment and domain information
>COG0661 AarF Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>PF06176 WaaY: Lipopolysaccharide core biosynthesis protein (WaaY); InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY) Back     alignment and domain information
>COG2208 RsbU Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>KOG1235 consensus Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>PF13095 FTA2: Kinetochore Sim4 complex subunit FTA2 Back     alignment and domain information
>COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1093 consensus Predicted protein kinase (contains TBC and RHOD domains) [General function prediction only] Back     alignment and domain information
>KOG1826 consensus Ras GTPase activating protein RasGAP/neurofibromin [Defense mechanisms] Back     alignment and domain information
>KOG2268 consensus Serine/threonine protein kinase [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>TIGR00938 thrB_alt homoserine kinase, Neisseria type Back     alignment and domain information
>PF12260 PIP49_C: Protein-kinase domain of FAM69; InterPro: IPR022049 Family with sequence similarity 69 has three members (A, B and C) Back     alignment and domain information
>cd05155 APH_ChoK_like_1 Uncharacterized bacterial proteins with similarity to Aminoglycoside 3'-phosphotransferase (APH) and Choline kinase (ChoK) family members Back     alignment and domain information
>TIGR02906 spore_CotS spore coat protein, CotS family Back     alignment and domain information
>PRK05231 homoserine kinase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query934
4da1_A389 Crystal Structure Of Branched-Chain Alpha-Ketoacid 1e-23
2iq1_A274 Crystal Structure Of Human Ppm1k Length = 274 3e-23
4ds8_B343 Complex Structure Of Abscisic Acid Receptor Pyl3-(+ 6e-21
3rt0_A340 Crystal Structure Of Pyl10-Hab1 Complex In The Abse 6e-21
3nmt_B341 Crystal Structure Of Pyrabactin Bound Abscisic Acid 7e-21
3ujg_B350 Crystal Structure Of Snrk2.6 In Complex With Hab1 L 7e-21
3qn1_B337 Crystal Structure Of The Pyr1 Abscisic Acid Recepto 8e-21
3kdj_B316 Complex Structure Of (+)-Aba-Bound Pyl1 And Abi1 Le 9e-21
3kb3_B321 Crystal Structure Of Abscisic Acid-Bound Pyl2 In Co 9e-21
3nmv_B324 Crystal Structure Of Pyrabactin-Bound Abscisic Acid 1e-20
3nmn_B319 Crystal Structure Of Pyrabactin-Bound Abscisic Acid 3e-20
3jrq_A326 Crystal Structure Of (+)-aba-bound Pyl1 In Complex 4e-20
3fxj_A390 Crystal Structure Of Human Protein Phosphatase 1a ( 2e-15
1a6q_A382 Crystal Structure Of The Protein SerineTHREONINE PH 2e-15
2p8e_A307 Crystal Structure Of The SerineTHREONINE PHOSPHATAS 1e-13
2i0o_A304 Crystal Structure Of Anopheles Gambiae SerTHR PHOSP 1e-10
3nr9_A368 Structure Of Human Cdc2-Like Kinase 2 (Clk2) Length 2e-10
3e7o_A360 Crystal Structure Of Jnk2 Length = 360 3e-10
3npc_A364 Crystal Structure Of Jnk2 Complexed With Birb796 Le 3e-10
2b9h_A353 Crystal Structure Of Fus3 With A Docking Motif From 3e-10
2b9f_A353 Crystal Structure Of Non-Phosphorylated Fus3 Length 7e-10
3vul_A370 Crystal Structure Of A Cysteine-deficient Mutant M1 7e-10
3vum_A370 Crystal Structure Of A Cysteine-deficient Mutant M7 8e-10
3v3v_A379 Structural And Functional Analysis Of Quercetagetin 1e-09
2xs0_A386 Linear Binding Motifs For Jnk And For Calcineurin A 2e-09
2xrw_A371 Linear Binding Motifs For Jnk And For Calcineurin A 2e-09
1ukh_A369 Structural Basis For The Selective Inhibition Of Jn 2e-09
2f9g_A353 Crystal Structure Of Fus3 Phosphorylated On Tyr182 2e-09
3vuk_A370 Crystal Structure Of A Cysteine-deficient Mutant M5 3e-09
3vud_A370 Crystal Structure Of A Cysteine-deficient Mutant M1 4e-09
2wu6_A381 Crystal Structure Of The Human Clk3 In Complex With 4e-09
2exe_A357 Crystal Structure Of The Phosphorylated Clk3 Length 4e-09
3vug_A370 Crystal Structure Of A Cysteine-deficient Mutant M2 4e-09
3vuh_A370 Crystal Structure Of A Cysteine-deficient Mutant M3 4e-09
3vui_A370 Crystal Structure Of A Cysteine-deficient Mutant M2 5e-09
2eu9_A355 Crystal Structure Of Clk3 Length = 355 5e-09
2ojg_A380 Crystal Structure Of Erk2 In Complex With N,n-dimet 5e-09
1wzy_A368 Crystal Structure Of Human Erk2 Complexed With A Py 6e-09
1tvo_A368 The Structure Of Erk2 In Complex With A Small Molec 6e-09
2gph_A364 Docking Motif Interactions In The Map Kinase Erk2 L 6e-09
1pme_A380 Structure Of Penta Mutant Human Erk2 Map Kinase Com 6e-09
3qyw_A364 Crystal Structure Of Erk2 In Complex With An Inhibi 6e-09
3o71_A358 Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length 6e-09
3zu7_A365 Crystal Structure Of A Designed Selected Ankyrin Re 6e-09
2y9q_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 6e-09
2z7l_A366 Unphosphorylated Mitogen Activated Protein Kinase E 6e-09
3c9w_A357 Crystal Structure Of Erk-2 With Hypothemycin Covale 6e-09
2fys_B364 Crystal Structure Of Erk2 Complex With Kim Peptide 6e-09
4gsb_A364 Monoclinic Crystal Form Of The Apo-Erk2 Length = 36 7e-09
1gol_A364 Coordinates Of Rat Map Kinase Erk2 With An Arginine 7e-09
4fux_A360 Crystal Structure Of The Erk2 Complexed With E75 Le 7e-09
3r63_A358 Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 7e-09
4h3q_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 7e-09
4fv6_A360 Crystal Structure Of The Erk2 Complexed With E57 Le 7e-09
3i6w_A443 Structure And Activation Mechanism Of The Chk2 Dna- 8e-09
1z57_A339 Crystal Structure Of Human Clk1 In Complex With 10z 8e-09
3zuv_A364 Crystal Structure Of A Designed Selected Ankyrin Re 8e-09
2erk_A365 Phosphorylated Map Kinase Erk2 Length = 365 8e-09
3tei_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 1e-08
3i6u_A419 Structure And Activation Mechanism Of The Chk2 Dna- 1e-08
3sa0_A360 Complex Of Erk2 With Norathyriol Length = 360 1e-08
4fv7_A360 Crystal Structure Of The Erk2 Complexed With E94 Le 1e-08
2cn5_A329 Crystal Structure Of Human Chk2 In Complex With Adp 3e-08
1cm8_A367 Phosphorylated Map Kinase P38-Gamma Length = 367 4e-08
2vag_A339 Crystal Structure Of Di-Phosphorylated Human Clk1 I 4e-08
2w0j_A323 Crystal Structure Of Chk2 In Complex With Nsc 10955 4e-08
2xk9_A322 Structural Analysis Of Checkpoint Kinase 2 (Chk2) I 4e-08
2ycr_A323 Crystal Structure Of Checkpoint Kinase 2 In Complex 4e-08
2ycf_A322 Crystal Structure Of Checkpoint Kinase 2 In Complex 4e-08
3o17_A370 Crystal Structure Of Jnk1-Alpha1 Isoform Length = 3 7e-08
2g01_A370 Pyrazoloquinolones As Novel, Selective Jnk1 Inhibit 8e-08
3pze_A358 Jnk1 In Complex With Inhibitor Length = 358 1e-07
3elj_A369 Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine 1e-07
4e5a_X360 The W197a Mutant Of P38a Map Kinase Length = 360 1e-07
3ofm_A350 Structure Of A Human Ck2alpha Prime, The Paralog Is 2e-07
3e3b_X339 Crystal Structure Of Catalytic Subunit Of Human Pro 2e-07
1na7_A329 Crystal Structure Of The Catalytic Subunit Of Human 2e-07
3eb0_A383 Crystal Structure Of Cgd4_240 From Cryptosporidium 2e-07
2zoq_A382 Structural Dissection Of Human Mitogen-Activated Ki 2e-07
3h4j_B336 Crystal Structure Of Pombe Ampk Kdaid Fragment Leng 3e-07
4agu_A311 Crystal Structure Of The Human Cdkl1 Kinase Domain 4e-07
2fso_X367 Mitogen Activated Protein Kinase P38alpha (D176a) A 4e-07
2fst_X367 Mitogen Activated Protein Kinase P38alpha (d176a+f3 4e-07
2fsl_X367 Mitogen Activated Protein Kinase P38alpha (D176a+f3 4e-07
3nie_A429 Crystal Structure Of Pf11_0147 Length = 429 5e-07
2y8o_A362 Crystal Structure Of Human P38alpha Complexed With 7e-07
3py3_A380 Crystal Structure Of Phosphorylated P38alpha Map Ki 8e-07
2baq_A365 P38alpha Bound To Ro3201195 Length = 365 8e-07
1ove_A366 The Structure Of P38 Alpha In Complex With A Dihydr 8e-07
3ttj_A464 Crystal Structure Of Jnk3 Complexed With Cc-359, A 8e-07
4ewq_A383 Human P38 Alpha Mapk In Complex With A Pyridazine B 9e-07
3u87_A349 Structure Of A Chimeric Construct Of Human Ck2alpha 9e-07
2bal_A365 P38alpha Map Kinase Bound To Pyrazoloamine Length = 1e-06
3nnx_A354 Crystal Structure Of Phosphorylated P38 Alpha In Co 1e-06
3e92_A371 Crystal Structure Of P38 Kinase In Complex With A B 1e-06
1jnk_A423 The C-Jun N-Terminal Kinase (Jnk3s) Complexed With 1e-06
3k3j_A362 P38alpha Bound To Novel Dfg-Out Compound Pf-0041612 1e-06
3d83_A360 Crystal Structure Of P38 Kinase In Complex With A B 1e-06
3mpt_A371 Crystal Structure Of P38 Kinase In Complex With A P 1e-06
2puu_A348 Crystal Structure Of P38 Complex With 1-(5-Tert-But 1e-06
2npq_A367 A Novel Lipid Binding Site In The P38 Alpha Map Kin 1e-06
3hvc_A362 Crystal Structure Of Human P38alpha Map Kinase Leng 1e-06
3d7z_A360 Crystal Structure Of P38 Kinase In Complex With A B 1e-06
1oz1_A372 P38 Mitogen-Activated Kinase In Complex With 4-Azai 1e-06
3od6_X360 Crystal Structure Of P38alpha Y323t Active Mutant L 1e-06
2gfs_A372 P38 Kinase Crystal Structure In Complex With Ro3201 1e-06
3fi4_A372 P38 Kinase Crystal Structure In Complex With Ro4499 1e-06
3zsg_A362 X-Ray Structure Of P38alpha Bound To Tak-715 Length 1e-06
3ody_X360 Crystal Structure Of P38alpha Y323q Active Mutant L 1e-06
3p4k_A370 The Third Conformation Of P38a Map Kinase Observed 1e-06
1bmk_A379 The Complex Structure Of The Map Kinase P38SB218655 1e-06
2baj_A365 P38alpha Bound To Pyrazolourea Length = 365 1e-06
2lgc_A359 Joint Nmr And X-Ray Refinement Reveals The Structur 1e-06
3hrb_A359 P38 Kinase Crystal Structure In Complex With Small 1e-06
3oef_X360 Crystal Structure Of Y323f Inactive Mutant Of P38al 1e-06
1bl6_A379 The Complex Structure Of The Map Kinase P38SB216995 1e-06
1lew_A360 Crystal Structure Of Map Kinase P38 Complexed To Th 1e-06
1ian_A366 Human P38 Map Kinase Inhibitor Complex Length = 366 1e-06
1m7q_A366 Crystal Structure Of P38 Map Kinase In Complex With 1e-06
3odz_X360 Crystal Structure Of P38alpha Y323r Active Mutant L 1e-06
3kq7_A380 Structure Of Human P38alpha With N-[4-Methyl-3-(6-{ 1e-06
1di9_A360 The Structure Of P38 Mitogen-Activated Protein Kina 1e-06
3gcu_A360 Human P38 Map Kinase In Complex With Rl48 Length = 1e-06
3tg1_A380 Crystal Structure Of P38alpha In Complex With A Map 1e-06
3hec_A348 P38 In Complex With Imatinib Length = 348 1e-06
2oza_B366 Structure Of P38alpha Complex Length = 366 1e-06
3nnu_A354 Crystal Structure Of P38 Alpha In Complex With Dp13 1e-06
3dt1_A383 P38 Complexed With A Quinazoline Inhibitor Length = 1e-06
2gtm_A348 Mutated Mouse P38 Map Kinase Domain In Complex With 1e-06
3s3i_A349 P38 Kinase Crystal Structure In Complex With Small 1e-06
3k3i_A350 P38alpha Bound To Novel Dgf-Out Compound Pf-0021595 1e-06
2exc_X356 Inhibitor Complex Of Jnk3 Length = 356 1e-06
1zzl_A351 Crystal Structure Of P38 With Triazolopyridine Leng 1e-06
2b1p_A355 Inhibitor Complex Of Jnk3 Length = 355 2e-06
3oxi_A362 Design And Synthesis Of Disubstituted Thiophene And 2e-06
2ghl_A348 Mutant Mus Musculus P38 Kinase Domain In Complex Wi 2e-06
4h36_A356 Crystal Structure Of Jnk3 In Complex With Atf2 Pept 2e-06
1yw2_A360 Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 2e-06
1ywr_A360 Crystal Structure Analysis Of Inactive P38 Kinase D 2e-06
1pmn_A364 Crystal Structure Of Jnk3 In Complex With An Imidaz 2e-06
2ok1_A365 Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3 2e-06
3ptg_A363 Design And Synthesis Of A Novel, Orally Efficacious 2e-06
3k2l_A429 Crystal Structure Of Dual-Specificity Tyrosine Phos 2e-06
2o0u_A364 Crystal Structure Of Human Jnk3 Complexed With N-{3 2e-06
3kvw_A429 Crystal Structure Of Dual-Specificity Tyrosine Phos 2e-06
4azf_A417 Human Dyrk2 In Complex With Leucettine L41 Length = 2e-06
3fi3_A364 Crystal Structure Of Jnk3 With Indazole Inhibitor, 2e-06
3fi2_A353 Crystal Structure Of Jnk3 With Amino-Pyrazole Inhib 2e-06
3gcp_A360 Human P38 Map Kinase In Complex With Sb203580 Lengt 2e-06
3kvx_A364 Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Le 3e-06
3fv8_A355 Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Le 3e-06
3mh2_A360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 3e-06
2r9s_A356 C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Qu 3e-06
1h4l_A292 Structure And Regulation Of The Cdk5-P25(Nck5a) Com 3e-06
4exu_A371 Mapk13, Inactive Form Length = 371 4e-06
3coi_A353 Crystal Structure Of P38delta Kinase Length = 353 4e-06
3q5i_A 504 Crystal Structure Of Pbanka_031420 Length = 504 4e-06
2a27_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 4e-06
3juh_A335 Crystal Structure Of A Mutant Of Human Protein Kina 4e-06
3oht_A389 Crystal Structure Of Salmo Salar P38alpha Length = 4e-06
2r7i_A335 Crystal Structure Of Catalytic Subunit Of Protein K 4e-06
3q9w_A336 Crystal Structure Of Human Ck2 Alpha In Complex Wit 5e-06
3h30_A334 Crystal Structure Of The Catalytic Subunit Of Human 5e-06
3nsz_A330 Human Ck2 Catalytic Domain In Complex With Amppn Le 5e-06
3mb6_A331 Human Ck2 Catalytic Domain In Complex With A Difura 5e-06
3q04_A328 Crystal Structure Of The Apo-Form Of Human Ck2 Alph 5e-06
3bqc_A335 High Ph-Value Crystal Structure Of Emodin In Comple 5e-06
1z9x_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 5e-06
1pjk_A334 Crystal Structure Of A C-terminal Deletion Mutant O 5e-06
1jwh_A337 Crystal Structure Of Human Protein Kinase Ck2 Holoe 5e-06
2zjw_A340 Crystal Structure Of Human Ck2 Alpha Complexed With 5e-06
3nga_A333 Human Ck2 Catalytic Domain In Complex With Cx-4945 5e-06
1v0o_A288 Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulpho 5e-06
1wmk_A321 Human Death-Associated Kinase Drp-1, Mutant S308d D 5e-06
1zws_A288 Crystal Structure Of The Catalytic Domain Of Human 6e-06
1ob3_A288 Structure Of P. Falciparum Pfpk5 Length = 288 6e-06
1v0b_A288 Crystal Structure Of The T198a Mutant Of Pfpk5 Leng 6e-06
2ya9_A361 Crystal Structure Of The Autoinhibited Form Of Mous 6e-06
2pop_A353 The Crystal Structure Of Tab1 And Bir1 Complex Leng 7e-06
3gc9_A370 The Structure Of P38beta C119s, C162s In Complex Wi 7e-06
3gc8_A370 The Structure Of P38beta C162s In Complex With A Di 7e-06
3i7c_A 484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 7e-06
2a2a_A321 High-resolution Crystallographic Analysis Of The Au 7e-06
3gp0_A348 Crystal Structure Of Human Mitogen Activated Protei 1e-05
3o8p_A360 Conformational Plasticity Of P38 Map Kinase Dfg Mot 1e-05
3mtl_A324 Crystal Structure Of The Pctaire1 Kinase In Complex 1e-05
3mh0_A360 Mutagenesis Of P38 Map Kinase Eshtablishes Key Role 1e-05
4dgl_C335 Crystal Structure Of The Ck2 Tetrameric Holoenzyme 1e-05
3hx4_A 508 Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg 1e-05
3ku2_A 507 Crystal Structure Of Inactivated Form Of Cdpk1 From 1e-05
3gi3_A360 Crystal Structure Of A N-Phenyl-N'-Naphthylurea Ana 1e-05
3i79_A 484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 1e-05
2clq_A295 Structure Of Mitogen-Activated Protein Kinase Kinas 1e-05
2pvh_A352 Structure-Based Design Of Pyrazolo[1,5-A][1,3,5]tri 1e-05
3vw6_A269 Crystal Structure Of Human Apoptosis Signal-Regulat 2e-05
3mh3_A360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 2e-05
1ung_A292 Structural Mechanism For The Inhibition Of Cdk5-P25 2e-05
3mh1_A360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 2e-05
2vrx_A285 Structure Of Aurora B Kinase In Complex With Zm4474 2e-05
2bfx_B284 Mechanism Of Aurora-B Activation By Incenp And Inhi 2e-05
3n9x_A432 Crystal Structure Of Map Kinase From Plasmodium Ber 2e-05
1daw_A327 Crystal Structure Of A Binary Complex Of Protein Ki 2e-05
3pvg_A331 Crystal Structure Of Z. Mays Ck2 Alpha Subunit In C 2e-05
4anm_A335 Complex Of Ck2 With A Cdc7 Inhibitor Length = 335 2e-05
2qc6_A332 Protein Kinase Ck2 In Complex With Dbc Length = 332 2e-05
1m2p_A325 Crystal Structure Of 1,8-Di-Hydroxy-4-Nitro- Anthra 2e-05
3kxg_A327 Crystal Structure Of Z. Mays Ck2 Kinase Alpha Subun 2e-05
3ma6_A298 Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr 2e-05
1ds5_A332 Dimeric Crystal Structure Of The Alpha Subunit In C 2e-05
2bfy_A284 Complex Of Aurora-B With Incenp And Hesperidin. Len 2e-05
4dgn_A326 Crystal Structure Of Maize Ck2 In Complex With The 2e-05
4dgm_A326 Crystal Structure Of Maize Ck2 In Complex With The 2e-05
4eoo_A299 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 2e-05
4eop_A300 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 2e-05
3tku_A433 Mrck Beta In Complex With Fasudil Length = 433 2e-05
2pom_A372 Tab1 With Manganese Ion Length = 372 2e-05
4eoi_A299 Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc 2e-05
4eon_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 3e-05
4eom_A301 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 3e-05
3qfv_A415 Mrck Beta In Complex With Tpca-1 Length = 415 3e-05
2j4o_A401 Structure Of Tab1 Length = 401 3e-05
1o9u_A350 Glycogen Synthase Kinase 3 Beta Complexed With Axin 3e-05
2pml_X348 Crystal Structure Of Pfpk7 In Complex With An Atp A 3e-05
2i6l_A320 Crystal Structure Of Human Mitogen Activated Protei 4e-05
2wtv_A285 Aurora-A Inhibitor Structure Length = 285 4e-05
1gii_A298 Human Cyclin Dependent Kinase 2 Complexed With The 4e-05
3pxf_A306 Cdk2 In Complex With Two Molecules Of 8-Anilino-1-N 4e-05
2w4k_A302 X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 4e-05
3ezr_A300 Cdk-2 With Indazole Inhibitor 17 Bound At Its Activ 4e-05
2xru_A280 Aurora-A T288e Complexed With Pha-828300 Length = 2 4e-05
1h8f_A352 Glycogen Synthase Kinase 3 Beta. Length = 352 5e-05
1pf8_A298 Crystal Structure Of Human Cyclin-dependent Kinase 5e-05
2iw8_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82 5e-05
2iw6_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A Com 5e-05
4eos_A300 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 5e-05
1ogu_A302 Structure Of Human Thr160-phospho Cdk2/cyclin A Com 5e-05
2y0a_A326 Structure Of Dapk1 Construct Residues 1-304 Length 5e-05
3pj8_A299 Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D] 5e-05
1oit_A299 Imidazopyridines: A Potent And Selective Class Of C 5e-05
1oir_A299 Imidazopyridines: A Potent And Selective Class Of C 5e-05
1h01_A298 Cdk2 In Complex With A Disubstituted 2, 4-Bis Anili 5e-05
4erw_A306 Cdk2 In Complex With Staurosporine Length = 306 5e-05
1h1p_A303 Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMP 5e-05
1vyw_A309 Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 5e-05
3bht_A300 Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN 5e-05
2jgz_A289 Crystal Structure Of Phospho-Cdk2 In Complex With C 5e-05
3qhr_A298 Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic 5e-05
3lij_A 494 Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) 5e-05
2yak_A285 Structure Of Death-Associated Protein Kinase 1 (Dap 5e-05
4eoq_A301 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 5e-05
4bcq_A301 Structure Of Cdk2 In Complex With Cyclin A And A 2- 5e-05
1w98_A298 The Structural Basis Of Cdk2 Activation By Cyclin E 5e-05
1e9h_A297 Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex 5e-05
4e7w_A394 Structure Of Gsk3 From Ustilago Maydis Length = 394 5e-05
4i3z_A296 Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES 5e-05
2w17_A299 Cdk2 In Complex With The Imidazole Pyrimidine Amide 5e-05
1fin_A298 Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 5e-05
2wqe_A262 Structure Of S155r Aurora-A Somatic Mutant Length = 5e-05
4eok_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 6e-05
3nrm_A283 Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito 6e-05
1qmz_A299 Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com 6e-05
2w1d_A275 Structure Determination Of Aurora Kinase In Complex 6e-05
2x6d_A285 Aurora-A Bound To An Inhibitor Length = 285 6e-05
1jst_A298 Phosphorylated Cyclin-Dependent Kinase-2 Bound To C 6e-05
2w4j_A277 X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 6e-05
1wvw_A278 Crystal Structures Of Kinase Domain Of Dap Kinase I 6e-05
1gz8_A299 Human Cyclin Dependent Kinase 2 Complexed With The 6e-05
3fdn_A279 Structure-Based Drug Design Of Novel Aurora Kinase 6e-05
3h0y_A268 Aurora A In Complex With A Bisanilinopyrimidine Len 6e-05
3coh_A268 Crystal Structure Of Aurora-A In Complex With A Pen 6e-05
3lau_A287 Crystal Structure Of Aurora2 Kinase In Complex With 6e-05
3e5a_A268 Crystal Structure Of Aurora A In Complex With Vx-68 6e-05
1ol5_A282 Structure Of Aurora-A 122-403, Phosphorylated On Th 6e-05
2x0g_A334 X-ray Structure Of A Dap-kinase Calmodulin Complex 6e-05
3f88_A349 Glycogen Synthase Kinase 3beta Inhibitor Complex Le 6e-05
2j50_A280 Structure Of Aurora-2 In Complex With Pha-739358 Le 6e-05
3gb2_A353 Gsk3beta Inhibitor Complex Length = 353 6e-05
2wtw_A285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 6e-05
3f5u_A295 Crystal Structure Of The Death Associated Protein K 6e-05
1ig1_A294 1.8a X-Ray Structure Of Ternary Complex Of A Cataly 6e-05
3unz_A279 Aurora A In Complex With Rpm1679 Length = 279 6e-05
3f7z_A350 X-ray Co-crystal Structure Of Glycogen Synthase Kin 6e-05
2xzs_A312 Death Associated Protein Kinase 1 Residues 1-312 Le 6e-05
2xng_A283 Structure Of Aurora-A Bound To A Selective Imidazop 6e-05
2c6d_A275 Aurora A Kinase Activated Mutant (T287d) In Complex 6e-05
3dfc_B295 Crystal Structure Of A Glycine-Rich Loop Mutant Of 6e-05
2ow3_A352 Glycogen Synthase Kinase-3 Beta In Complex With Bis 6e-05
3zdi_A350 Glycogen Synthase Kinase 3 Beta Complexed With Axin 7e-05
4afj_A367 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selec 7e-05
3o50_A267 Crystal Structure Of Benzamide 9 Bound To Auroraa L 7e-05
3gu8_A295 Crystal Structure Of Dapkl93g With N6-Cyclopentylad 7e-05
3gu4_A295 Crystal Structure Of Dapkq23v-Amppnp Length = 295 7e-05
2w1c_A275 Structure Determination Of Aurora Kinase In Complex 7e-05
4eoj_A302 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 7e-05
2c6e_A283 Aurora A Kinase Activated Mutant (T287d) In Complex 7e-05
4dit_A382 Crystal Structure Of Gsk3beta In Complex With A Imi 7e-05
3zrk_A371 Identification Of 2-(4-Pyridyl)thienopyridinones As 7e-05
3r1n_A317 Mk3 Kinase Bound To Compound 5b Length = 317 7e-05
1p4f_A293 Death Associated Protein Kinase Catalytic Domain Wi 7e-05
1mq4_A272 Crystal Structure Of Aurora-A Protein Kinase Length 7e-05
3say_A430 Crystal Structure Of Human Glycogen Synthase Kinase 7e-05
3fhr_A336 High Resolution Crystal Structure Of Mitogen-Activa 7e-05
1gng_A378 Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With 7e-05
3is5_A285 Crystal Structure Of Cdpk Kinase Domain From Toxopl 7e-05
3ha6_A268 Crystal Structure Of Aurora A In Complex With Tpx2 7e-05
3a62_A327 Crystal Structure Of Phosphorylated P70s6k1 Length 8e-05
1muo_A297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 8e-05
3qbn_A281 Structure Of Human Aurora A In Complex With A Diami 8e-05
3a60_A327 Crystal Structure Of Unphosphorylated P70s6k1 (Form 8e-05
2dwb_A285 Aurora-A Kinase Complexed With Amppnp Length = 285 9e-05
1r0e_A391 Glycogen Synthase Kinase-3 Beta In Complex With 3-I 9e-05
1uv5_A350 Glycogen Synthase Kinase 3 Beta Complexed With 6-Br 9e-05
3sd0_A350 Identification Of A Glycogen Synthase Kinase-3b Inh 9e-05
1q5k_A414 Crystal Structure Of Glycogen Synthase Kinase 3 In 9e-05
3llt_A360 Crystal Structure Of Pf14_0431, Kinase Domain Lengt 9e-05
3oz6_A388 Crystal Structure Of Mapk From Cryptosporidium Parv 9e-05
2isn_A364 Crystal Structure Of A Phosphatase From A Pathogeni 1e-04
3r21_A271 Design, Synthesis, And Biological Evaluation Of Pyr 1e-04
2o5k_A372 Crystal Structure Of Gsk3beta In Complex With A Ben 1e-04
1i09_A420 Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Len 1e-04
1q3d_A424 Gsk-3 Beta Complexed With Staurosporine Length = 42 1e-04
1pyx_A422 Gsk-3 Beta Complexed With Amp-Pnp Length = 422 1e-04
3mfr_A351 Cask-4m Cam Kinase Domain, Native Length = 351 1e-04
3f3z_A277 Crystal Structure Of Cryptosporidium Parvum Calcium 1e-04
4aw2_A437 Crystal Structure Of Cdc42 Binding Protein Kinase A 1e-04
4acc_A465 Gsk3b In Complex With Inhibitor Length = 465 1e-04
2bmc_A306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 1e-04
2j4z_A306 Structure Of Aurora-2 In Complex With Pha-680626 Le 1e-04
2qg5_A294 Cryptosporidium Parvum Calcium Dependent Protein Ki 1e-04
2i3o_A516 Crystal Structure Of Gamma-Glutamyl Transferase Rel 1e-04
4eqm_A294 Structural Analysis Of Staphylococcus Aureus Serine 1e-04
3igo_A 486 Crystal Structure Of Cryptosporidium Parvum Cdpk1, 2e-04
3dfa_A286 Crystal Structure Of Kinase Domain Of Calcium-depen 2e-04
3d14_A272 Crystal Structure Of Mouse Aurora A (Asn186->gly, L 2e-04
2wei_A287 Crystal Structure Of The Kinase Domain Of Cryptospo 2e-04
3hko_A345 Crystal Structure Of A Cdpk Kinase Domain From Cryp 2e-04
2vz6_A313 Structure Of Human Calcium Calmodulin Dependent Pro 2e-04
3niz_A311 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 2e-04
1ol6_A282 Structure Of Unphosphorylated D274n Mutant Of Auror 2e-04
2xne_A272 Structure Of Aurora-A Bound To An Imidazopyrazine I 2e-04
3daj_A272 Crystal Structure Of Aurora A Complexed With An Inh 2e-04
2qnj_A328 Kinase And Ubiquitin-Associated Domains Of Mark3PAR 2e-04
2qkr_A313 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 2e-04
3kl8_A269 Camkiintide Inhibitor Complex Length = 269 2e-04
3kk8_A284 Camkii Substrate Complex A Length = 284 3e-04
3fe3_A328 Crystal Structure Of The Kinase Mark3PAR-1: T211a-S 3e-04
3kk9_A282 Camkii Substrate Complex B Length = 282 3e-04
2bdw_A362 Crystal Structure Of The Auto-Inhibited Kinase Doma 3e-04
2hak_A328 Catalytic And Ubiqutin-Associated Domains Of Mark1P 3e-04
2xuu_A334 Crystal Structure Of A Dap-Kinase 1 Mutant Length = 3e-04
1how_A373 The X-Ray Crystal Structure Of Sky1p, An Sr Protein 3e-04
1q8y_A373 The Structure Of The Yeast Sr Protein Kinase, Sky1p 4e-04
4aaa_A331 Crystal Structure Of The Human Cdkl2 Kinase Domain 4e-04
3bhh_A295 Crystal Structure Of Human Calcium/calmodulin-depen 4e-04
2wel_A327 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 4e-04
2pk9_A317 Structure Of The Pho85-pho80 Cdk-cyclin Complex Of 4e-04
3uc3_A361 The Crystal Structure Of Snf1-Related Kinase 2.3 Le 5e-04
3gbz_A329 Structure Of The Cmgc Cdk Kinase From Giardia Lambl 5e-04
4ec8_A373 Structure Of Full Length Cdk9 In Complex With Cycli 5e-04
2vn9_A301 Crystal Structure Of Human Calcium Calmodulin Depen 5e-04
1yhs_A273 Crystal Structure Of Pim-1 Bound To Staurosporine L 5e-04
1zyc_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 6e-04
2y7j_A365 Structure Of Human Phosphorylase Kinase, Gamma 2 Le 7e-04
1zmv_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 7e-04
2r0i_A327 Crystal Structure Of A Kinase Mark2PAR-1 Mutant Len 7e-04
1zmu_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 7e-04
4fg8_A315 Crystal Structure Of Human Calcium/calmodulin-depen 7e-04
4bcf_A331 Structure Of Cdk9 In Complex With Cyclin T And A 2- 8e-04
4a07_A311 Human Pdk1 Kinase Domain In Complex With Allosteric 8e-04
4fg9_A320 Crystal Structure Of Human Calcium/calmodulin-depen 8e-04
1y8g_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 8e-04
3blh_A331 Crystal Structure Of Human Cdk9CYCLINT1 Length = 33 8e-04
1a06_A332 Calmodulin-Dependent Protein Kinase From Rat Length 8e-04
1ql6_A298 The Catalytic Mechanism Of Phosphorylase Kinase Pro 8e-04
4alv_A328 Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 9e-04
4alu_A328 Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 9e-04
3iec_A319 Helicobacter Pylori Caga Inhibits Par1MARK FAMILY K 9e-04
1zy4_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 9e-04
1xws_A313 Crystal Structure Of The Human Pim1 Kinase Domain L 9e-04
3nax_A311 Pdk1 In Complex With Inhibitor Mp7 Length = 311 9e-04
3mi9_A351 Crystal Structure Of Hiv-1 Tat Complexed With Human 9e-04
3cxw_A314 Crystal Structure Of Human Proto-Oncogene Serine Th 9e-04
3c4e_A273 Pim-1 Kinase Domain In Complex With 3-Aminophenyl-7 9e-04
>pdb|4DA1|A Chain A, Crystal Structure Of Branched-Chain Alpha-Ketoacid Dehydrogenase Phosphatase With Mg (Ii) Ions At The Active Site Length = 389 Back     alignment and structure

Iteration: 1

Score = 108 bits (271), Expect = 1e-23, Method: Compositional matrix adjust. Identities = 84/261 (32%), Positives = 126/261 (48%), Gaps = 67/261 (25%) Query: 192 DIFDDSFHLEILREALLRAIHDIDTAFSKEASRKK----LDSGSTATVVLIAEG-QILVA 246 D+ +LE L L A +ID AFS A L SG+TATV L+ +G +++VA Sbjct: 177 DLLPKEKNLETL---LTLAFLEIDKAFSSHARLSADATLLTSGTTATVALLRDGIELVVA 233 Query: 247 NIGDSKALLCSEKFQSPAEAKATLLRLYRKRRDNNAISTSQGYNYLKSTVSNGLAHFTVK 306 ++GDS+A+LC RK + Sbjct: 234 SVGDSRAILC------------------RKGKP--------------------------M 249 Query: 307 ELTRDHHPDREDERYRVEAAGGYVLQWG--GVSRVNGQLAVSRAIGDLSYKSYGVISVPE 364 +LT DH P+R+DE+ R++ GG+V W G VNG+LA++R+IGDL K+ GVI+ PE Sbjct: 250 KLTIDHTPERKDEKERIKKCGGFV-AWNSLGQPHVNGRLAMTRSIGDLDLKTSGVIAEPE 308 Query: 365 VTDWQSLTANDSYLVAASDGVFEKLSLQDVCDVFWEVHTHGTAGPGFPSSCSYSLADCLV 424 + A+DS+LV +DG+ ++ Q++CD + H A A + Sbjct: 309 TKRIKLHHADDSFLVLTTDGINFMVNSQEICDFVNQCHDPNEA------------AHAVT 356 Query: 425 DTAFEKGSMDNMAAVVVPLGS 445 + A + G+ DN AVVVP G+ Sbjct: 357 EQAIQYGTEDNSTAVVVPFGA 377
>pdb|2IQ1|A Chain A, Crystal Structure Of Human Ppm1k Length = 274 Back     alignment and structure
>pdb|4DS8|B Chain B, Complex Structure Of Abscisic Acid Receptor Pyl3-(+)-Aba-Hab1 In The Presence Of Mn2+ Length = 343 Back     alignment and structure
>pdb|3RT0|A Chain A, Crystal Structure Of Pyl10-Hab1 Complex In The Absence Of Abscisic Acid (Aba) Length = 340 Back     alignment and structure
>pdb|3NMT|B Chain B, Crystal Structure Of Pyrabactin Bound Abscisic Acid Receptor Pyl2 Mutant A93f In Complex With Type 2c Protein Phosphatase Hab1 Length = 341 Back     alignment and structure
>pdb|3UJG|B Chain B, Crystal Structure Of Snrk2.6 In Complex With Hab1 Length = 350 Back     alignment and structure
>pdb|3QN1|B Chain B, Crystal Structure Of The Pyr1 Abscisic Acid Receptor In Complex With The Hab1 Type 2c Phosphatase Catalytic Domain Length = 337 Back     alignment and structure
>pdb|3KDJ|B Chain B, Complex Structure Of (+)-Aba-Bound Pyl1 And Abi1 Length = 316 Back     alignment and structure
>pdb|3KB3|B Chain B, Crystal Structure Of Abscisic Acid-Bound Pyl2 In Complex With Hab1 Length = 321 Back     alignment and structure
>pdb|3NMV|B Chain B, Crystal Structure Of Pyrabactin-Bound Abscisic Acid Receptor Pyl2 Mutant A93f In Complex With Type 2c Protein Phosphatase Abi2 Length = 324 Back     alignment and structure
>pdb|3NMN|B Chain B, Crystal Structure Of Pyrabactin-Bound Abscisic Acid Receptor Pyl1 In Complex With Type 2c Protein Phosphatase Abi1 Length = 319 Back     alignment and structure
>pdb|3JRQ|A Chain A, Crystal Structure Of (+)-aba-bound Pyl1 In Complex With Abi1 Length = 326 Back     alignment and structure
>pdb|3FXJ|A Chain A, Crystal Structure Of Human Protein Phosphatase 1a (Ppm1a) Bound With Phosphate At 3 Mm Of Mn2+ Length = 390 Back     alignment and structure
>pdb|1A6Q|A Chain A, Crystal Structure Of The Protein SerineTHREONINE PHOSPHATASE 2C AT 2 A Resolution Length = 382 Back     alignment and structure
>pdb|2P8E|A Chain A, Crystal Structure Of The SerineTHREONINE PHOSPHATASE Domain Of Human Ppm1b Length = 307 Back     alignment and structure
>pdb|2I0O|A Chain A, Crystal Structure Of Anopheles Gambiae SerTHR PHOSPHATASE COMPLEXED With Zn2+ Length = 304 Back     alignment and structure
>pdb|3NR9|A Chain A, Structure Of Human Cdc2-Like Kinase 2 (Clk2) Length = 368 Back     alignment and structure
>pdb|3E7O|A Chain A, Crystal Structure Of Jnk2 Length = 360 Back     alignment and structure
>pdb|3NPC|A Chain A, Crystal Structure Of Jnk2 Complexed With Birb796 Length = 364 Back     alignment and structure
>pdb|2B9H|A Chain A, Crystal Structure Of Fus3 With A Docking Motif From Ste7 Length = 353 Back     alignment and structure
>pdb|2B9F|A Chain A, Crystal Structure Of Non-Phosphorylated Fus3 Length = 353 Back     alignment and structure
>pdb|3VUL|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VUM|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M7 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3V3V|A Chain A, Structural And Functional Analysis Of Quercetagetin, A Natural Jnk1 Inhibitor Length = 379 Back     alignment and structure
>pdb|2XS0|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 386 Back     alignment and structure
>pdb|2XRW|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 371 Back     alignment and structure
>pdb|1UKH|A Chain A, Structural Basis For The Selective Inhibition Of Jnk1 By The Scaffolding Protein Jip1 And Sp600125 Length = 369 Back     alignment and structure
>pdb|2F9G|A Chain A, Crystal Structure Of Fus3 Phosphorylated On Tyr182 Length = 353 Back     alignment and structure
>pdb|3VUK|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M5 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VUD|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|2WU6|A Chain A, Crystal Structure Of The Human Clk3 In Complex With Dki Length = 381 Back     alignment and structure
>pdb|2EXE|A Chain A, Crystal Structure Of The Phosphorylated Clk3 Length = 357 Back     alignment and structure
>pdb|3VUG|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VUH|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M3 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VUI|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|2EU9|A Chain A, Crystal Structure Of Clk3 Length = 355 Back     alignment and structure
>pdb|2OJG|A Chain A, Crystal Structure Of Erk2 In Complex With N,n-dimethyl-4-(4- Phenyl-1h-pyrazol-3-yl)-1h-pyrrole-2-carboxamide Length = 380 Back     alignment and structure
>pdb|1WZY|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Pyrazolopyridazine Derivative Length = 368 Back     alignment and structure
>pdb|1TVO|A Chain A, The Structure Of Erk2 In Complex With A Small Molecule Inhibitor Length = 368 Back     alignment and structure
>pdb|2GPH|A Chain A, Docking Motif Interactions In The Map Kinase Erk2 Length = 364 Back     alignment and structure
>pdb|1PME|A Chain A, Structure Of Penta Mutant Human Erk2 Map Kinase Complexed With A Specific Inhibitor Of Human P38 Map Kinase Length = 380 Back     alignment and structure
>pdb|3QYW|A Chain A, Crystal Structure Of Erk2 In Complex With An Inhibitor Length = 364 Back     alignment and structure
>pdb|3O71|A Chain A, Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length = 358 Back     alignment and structure
>pdb|3ZU7|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 365 Back     alignment and structure
>pdb|2Y9Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|2Z7L|A Chain A, Unphosphorylated Mitogen Activated Protein Kinase Erk2 In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin 2-Yl]amino}phenyl)acetic Acid Length = 366 Back     alignment and structure
>pdb|3C9W|A Chain A, Crystal Structure Of Erk-2 With Hypothemycin Covalently Bound Length = 357 Back     alignment and structure
>pdb|2FYS|B Chain B, Crystal Structure Of Erk2 Complex With Kim Peptide Derived From Mkp3 Length = 364 Back     alignment and structure
>pdb|4GSB|A Chain A, Monoclinic Crystal Form Of The Apo-Erk2 Length = 364 Back     alignment and structure
>pdb|1GOL|A Chain A, Coordinates Of Rat Map Kinase Erk2 With An Arginine Mutation At Position 52 Length = 364 Back     alignment and structure
>pdb|4FUX|A Chain A, Crystal Structure Of The Erk2 Complexed With E75 Length = 360 Back     alignment and structure
>pdb|3R63|A Chain A, Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 Back     alignment and structure
>pdb|4H3Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|4FV6|A Chain A, Crystal Structure Of The Erk2 Complexed With E57 Length = 360 Back     alignment and structure
>pdb|3I6W|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 443 Back     alignment and structure
>pdb|1Z57|A Chain A, Crystal Structure Of Human Clk1 In Complex With 10z-Hymenialdisine Length = 339 Back     alignment and structure
>pdb|3ZUV|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 364 Back     alignment and structure
>pdb|2ERK|A Chain A, Phosphorylated Map Kinase Erk2 Length = 365 Back     alignment and structure
>pdb|3TEI|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|3I6U|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 419 Back     alignment and structure
>pdb|3SA0|A Chain A, Complex Of Erk2 With Norathyriol Length = 360 Back     alignment and structure
>pdb|4FV7|A Chain A, Crystal Structure Of The Erk2 Complexed With E94 Length = 360 Back     alignment and structure
>pdb|2CN5|A Chain A, Crystal Structure Of Human Chk2 In Complex With Adp Length = 329 Back     alignment and structure
>pdb|1CM8|A Chain A, Phosphorylated Map Kinase P38-Gamma Length = 367 Back     alignment and structure
>pdb|2VAG|A Chain A, Crystal Structure Of Di-Phosphorylated Human Clk1 In Complex With A Novel Substituted Indole Inhibitor Length = 339 Back     alignment and structure
>pdb|2W0J|A Chain A, Crystal Structure Of Chk2 In Complex With Nsc 109555, A Specific Inhibitor Length = 323 Back     alignment and structure
>pdb|2XK9|A Chain A, Structural Analysis Of Checkpoint Kinase 2 (Chk2) In Complex With Inhibitor Pv1533 Length = 322 Back     alignment and structure
>pdb|2YCR|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv976 Length = 323 Back     alignment and structure
>pdb|2YCF|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv1531 Length = 322 Back     alignment and structure
>pdb|3O17|A Chain A, Crystal Structure Of Jnk1-Alpha1 Isoform Length = 370 Back     alignment and structure
>pdb|2G01|A Chain A, Pyrazoloquinolones As Novel, Selective Jnk1 Inhibitors Length = 370 Back     alignment and structure
>pdb|3PZE|A Chain A, Jnk1 In Complex With Inhibitor Length = 358 Back     alignment and structure
>pdb|3ELJ|A Chain A, Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine Inhibitor Length = 369 Back     alignment and structure
>pdb|4E5A|X Chain X, The W197a Mutant Of P38a Map Kinase Length = 360 Back     alignment and structure
>pdb|3OFM|A Chain A, Structure Of A Human Ck2alpha Prime, The Paralog Isoform Of The Catalytic Subunit Of Protein Kinase Ck2 From Homo Sapiens Length = 350 Back     alignment and structure
>pdb|3E3B|X Chain X, Crystal Structure Of Catalytic Subunit Of Human Protein Kinase Ck2alpha Prime With A Potent Indazole-Derivative Inhibitor Length = 339 Back     alignment and structure
>pdb|1NA7|A Chain A, Crystal Structure Of The Catalytic Subunit Of Human Protein Kinase Ck2 Length = 329 Back     alignment and structure
>pdb|3EB0|A Chain A, Crystal Structure Of Cgd4_240 From Cryptosporidium Parvum In Complex With Indirubin E804 Length = 383 Back     alignment and structure
>pdb|2ZOQ|A Chain A, Structural Dissection Of Human Mitogen-Activated Kinase Erk1 Length = 382 Back     alignment and structure
>pdb|3H4J|B Chain B, Crystal Structure Of Pombe Ampk Kdaid Fragment Length = 336 Back     alignment and structure
>pdb|4AGU|A Chain A, Crystal Structure Of The Human Cdkl1 Kinase Domain Length = 311 Back     alignment and structure
>pdb|2FSO|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a) Activating Mutant Length = 367 Back     alignment and structure
>pdb|2FST|X Chain X, Mitogen Activated Protein Kinase P38alpha (d176a+f327l) Activating Mutant Length = 367 Back     alignment and structure
>pdb|2FSL|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a+f327s) Activating Mutant Form-A Length = 367 Back     alignment and structure
>pdb|3NIE|A Chain A, Crystal Structure Of Pf11_0147 Length = 429 Back     alignment and structure
>pdb|2Y8O|A Chain A, Crystal Structure Of Human P38alpha Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|3PY3|A Chain A, Crystal Structure Of Phosphorylated P38alpha Map Kinase Length = 380 Back     alignment and structure
>pdb|2BAQ|A Chain A, P38alpha Bound To Ro3201195 Length = 365 Back     alignment and structure
>pdb|1OVE|A Chain A, The Structure Of P38 Alpha In Complex With A Dihydroquinolinone Length = 366 Back     alignment and structure
>pdb|3TTJ|A Chain A, Crystal Structure Of Jnk3 Complexed With Cc-359, A Jnk Inhibitor For The Prevention Of Ischemia-Reperfusion Injury Length = 464 Back     alignment and structure
>pdb|4EWQ|A Chain A, Human P38 Alpha Mapk In Complex With A Pyridazine Based Inhibitor Length = 383 Back     alignment and structure
>pdb|3U87|A Chain A, Structure Of A Chimeric Construct Of Human Ck2alpha And Human Ck2alpha' In Complex With A Non-hydrolysable Atp-analogue Length = 349 Back     alignment and structure
>pdb|2BAL|A Chain A, P38alpha Map Kinase Bound To Pyrazoloamine Length = 365 Back     alignment and structure
>pdb|3NNX|A Chain A, Crystal Structure Of Phosphorylated P38 Alpha In Complex With Dp802 Length = 354 Back     alignment and structure
>pdb|3E92|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biaryl Amide Inhibitor Length = 371 Back     alignment and structure
>pdb|1JNK|A Chain A, The C-Jun N-Terminal Kinase (Jnk3s) Complexed With Mgamp-Pnp Length = 423 Back     alignment and structure
>pdb|3K3J|A Chain A, P38alpha Bound To Novel Dfg-Out Compound Pf-00416121 Length = 362 Back     alignment and structure
>pdb|3D83|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|3MPT|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Pyrrole-2- Carboxamide Inhibitor Length = 371 Back     alignment and structure
>pdb|2PUU|A Chain A, Crystal Structure Of P38 Complex With 1-(5-Tert-Butyl-2-P- Tolyl-2h-Pyrazol-3-Yl)-3-[4-(6-Morpholin-4-Ylmethyl- Pyridin-3-Yl)naphthalen-1-Yl]urea Length = 348 Back     alignment and structure
>pdb|2NPQ|A Chain A, A Novel Lipid Binding Site In The P38 Alpha Map Kinase Length = 367 Back     alignment and structure
>pdb|3HVC|A Chain A, Crystal Structure Of Human P38alpha Map Kinase Length = 362 Back     alignment and structure
>pdb|3D7Z|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|1OZ1|A Chain A, P38 Mitogen-Activated Kinase In Complex With 4-Azaindole Inhibitor Length = 372 Back     alignment and structure
>pdb|3OD6|X Chain X, Crystal Structure Of P38alpha Y323t Active Mutant Length = 360 Back     alignment and structure
>pdb|2GFS|A Chain A, P38 Kinase Crystal Structure In Complex With Ro3201195 Length = 372 Back     alignment and structure
>pdb|3FI4|A Chain A, P38 Kinase Crystal Structure In Complex With Ro4499 Length = 372 Back     alignment and structure
>pdb|3ZSG|A Chain A, X-Ray Structure Of P38alpha Bound To Tak-715 Length = 362 Back     alignment and structure
>pdb|3ODY|X Chain X, Crystal Structure Of P38alpha Y323q Active Mutant Length = 360 Back     alignment and structure
>pdb|3P4K|A Chain A, The Third Conformation Of P38a Map Kinase Observed In Phosphorylated P38a And In Solution Length = 370 Back     alignment and structure
>pdb|1BMK|A Chain A, The Complex Structure Of The Map Kinase P38SB218655 Length = 379 Back     alignment and structure
>pdb|2BAJ|A Chain A, P38alpha Bound To Pyrazolourea Length = 365 Back     alignment and structure
>pdb|2LGC|A Chain A, Joint Nmr And X-Ray Refinement Reveals The Structure Of A Novel Dibenzo[a,D]cycloheptenone InhibitorP38 MAP KINASE COMPLEX IN Solution Length = 359 Back     alignment and structure
>pdb|3HRB|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 359 Back     alignment and structure
>pdb|3OEF|X Chain X, Crystal Structure Of Y323f Inactive Mutant Of P38alpha Map Kinase Length = 360 Back     alignment and structure
>pdb|1BL6|A Chain A, The Complex Structure Of The Map Kinase P38SB216995 Length = 379 Back     alignment and structure
>pdb|1LEW|A Chain A, Crystal Structure Of Map Kinase P38 Complexed To The Docking Site On Its Nuclear Substrate Mef2a Length = 360 Back     alignment and structure
>pdb|1IAN|A Chain A, Human P38 Map Kinase Inhibitor Complex Length = 366 Back     alignment and structure
>pdb|1M7Q|A Chain A, Crystal Structure Of P38 Map Kinase In Complex With A Dihydroquinazolinone Inhibitor Length = 366 Back     alignment and structure
>pdb|3ODZ|X Chain X, Crystal Structure Of P38alpha Y323r Active Mutant Length = 360 Back     alignment and structure
>pdb|3KQ7|A Chain A, Structure Of Human P38alpha With N-[4-Methyl-3-(6-{[2-(1- Methylpyrrolidin-2-Yl)ethyl]amino}pyridine-3- Amido)phenyl]- 2-(Morpholin-4-Yl)pyridine-4-Carboxamide Length = 380 Back     alignment and structure
>pdb|1DI9|A Chain A, The Structure Of P38 Mitogen-Activated Protein Kinase In Complex With 4-[3-Methylsulfanylanilino]-6,7- Dimethoxyquinazoline Length = 360 Back     alignment and structure
>pdb|3GCU|A Chain A, Human P38 Map Kinase In Complex With Rl48 Length = 360 Back     alignment and structure
>pdb|3TG1|A Chain A, Crystal Structure Of P38alpha In Complex With A Mapk Docking Partner Length = 380 Back     alignment and structure
>pdb|3HEC|A Chain A, P38 In Complex With Imatinib Length = 348 Back     alignment and structure
>pdb|2OZA|B Chain B, Structure Of P38alpha Complex Length = 366 Back     alignment and structure
>pdb|3NNU|A Chain A, Crystal Structure Of P38 Alpha In Complex With Dp1376 Length = 354 Back     alignment and structure
>pdb|3DT1|A Chain A, P38 Complexed With A Quinazoline Inhibitor Length = 383 Back     alignment and structure
>pdb|2GTM|A Chain A, Mutated Mouse P38 Map Kinase Domain In Complex With Inhibitor Pg-892579 Length = 348 Back     alignment and structure
>pdb|3S3I|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 349 Back     alignment and structure
>pdb|3K3I|A Chain A, P38alpha Bound To Novel Dgf-Out Compound Pf-00215955 Length = 350 Back     alignment and structure
>pdb|2EXC|X Chain X, Inhibitor Complex Of Jnk3 Length = 356 Back     alignment and structure
>pdb|1ZZL|A Chain A, Crystal Structure Of P38 With Triazolopyridine Length = 351 Back     alignment and structure
>pdb|2B1P|A Chain A, Inhibitor Complex Of Jnk3 Length = 355 Back     alignment and structure
>pdb|3OXI|A Chain A, Design And Synthesis Of Disubstituted Thiophene And Thiazole Based Inhibitors Of Jnk For The Treatment Of Neurodegenerative Diseases Length = 362 Back     alignment and structure
>pdb|2GHL|A Chain A, Mutant Mus Musculus P38 Kinase Domain In Complex With Inhibitor Pg-874743 Length = 348 Back     alignment and structure
>pdb|4H36|A Chain A, Crystal Structure Of Jnk3 In Complex With Atf2 Peptide Length = 356 Back     alignment and structure
>pdb|1YW2|A Chain A, Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 Back     alignment and structure
>pdb|1YWR|A Chain A, Crystal Structure Analysis Of Inactive P38 Kinase Domain In Complex With A Monocyclic Pyrazolone Inhibitor Length = 360 Back     alignment and structure
>pdb|1PMN|A Chain A, Crystal Structure Of Jnk3 In Complex With An Imidazole- Pyrimidine Inhibitor Length = 364 Back     alignment and structure
>pdb|2OK1|A Chain A, Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3- Chlorophenyl)-1h-Pyrazol-3-Yl)-1h-Pyrrole-2-Carboxamide Length = 365 Back     alignment and structure
>pdb|3PTG|A Chain A, Design And Synthesis Of A Novel, Orally Efficacious Tri-Substituted Thiophene Based Jnk Inhibitor Length = 363 Back     alignment and structure
>pdb|3K2L|A Chain A, Crystal Structure Of Dual-Specificity Tyrosine Phosphorylation Regulated Kinase 2 (Dyrk2) Length = 429 Back     alignment and structure
>pdb|2O0U|A Chain A, Crystal Structure Of Human Jnk3 Complexed With N-{3-Cyano-6-[3-(1- Piperidinyl)propanoyl]-4,5,6,7-Tetrahydrothieno[2, 3-C]pyridin-2-Yl}- 1-Naphthalenecarboxamide Length = 364 Back     alignment and structure
>pdb|3KVW|A Chain A, Crystal Structure Of Dual-Specificity Tyrosine Phosphorylation Regulated Kinase 2 (Dyrk2) In Complex With An Indirubin Ligand Length = 429 Back     alignment and structure
>pdb|4AZF|A Chain A, Human Dyrk2 In Complex With Leucettine L41 Length = 417 Back     alignment and structure
>pdb|3FI3|A Chain A, Crystal Structure Of Jnk3 With Indazole Inhibitor, Sr-3737 Length = 364 Back     alignment and structure
>pdb|3FI2|A Chain A, Crystal Structure Of Jnk3 With Amino-Pyrazole Inhibitor, Sr- 3451 Length = 353 Back     alignment and structure
>pdb|3GCP|A Chain A, Human P38 Map Kinase In Complex With Sb203580 Length = 360 Back     alignment and structure
>pdb|3KVX|A Chain A, Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Length = 364 Back     alignment and structure
>pdb|3FV8|A Chain A, Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Length = 355 Back     alignment and structure
>pdb|3MH2|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|2R9S|A Chain A, C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Quinoline Inhibitor Length = 356 Back     alignment and structure
>pdb|1H4L|A Chain A, Structure And Regulation Of The Cdk5-P25(Nck5a) Complex Length = 292 Back     alignment and structure
>pdb|4EXU|A Chain A, Mapk13, Inactive Form Length = 371 Back     alignment and structure
>pdb|3COI|A Chain A, Crystal Structure Of P38delta Kinase Length = 353 Back     alignment and structure
>pdb|3Q5I|A Chain A, Crystal Structure Of Pbanka_031420 Length = 504 Back     alignment and structure
>pdb|2A27|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 8 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|3JUH|A Chain A, Crystal Structure Of A Mutant Of Human Protein Kinase Ck2alpha With Altered Cosubstrate Specificity Length = 335 Back     alignment and structure
>pdb|3OHT|A Chain A, Crystal Structure Of Salmo Salar P38alpha Length = 389 Back     alignment and structure
>pdb|2R7I|A Chain A, Crystal Structure Of Catalytic Subunit Of Protein Kinase Ck2 Length = 335 Back     alignment and structure
>pdb|3Q9W|A Chain A, Crystal Structure Of Human Ck2 Alpha In Complex With Emodin At Ph 8.5 Length = 336 Back     alignment and structure
>pdb|3H30|A Chain A, Crystal Structure Of The Catalytic Subunit Of Human Protein Kinase Ck2 With 5,6-Dichloro-1-Beta-D- Ribofuranosylbenzimidazole Length = 334 Back     alignment and structure
>pdb|3NSZ|A Chain A, Human Ck2 Catalytic Domain In Complex With Amppn Length = 330 Back     alignment and structure
>pdb|3MB6|A Chain A, Human Ck2 Catalytic Domain In Complex With A Difurane Derivative Inhibitor (Cpa) Length = 331 Back     alignment and structure
>pdb|3Q04|A Chain A, Crystal Structure Of The Apo-Form Of Human Ck2 Alpha At Ph 8.5 Length = 328 Back     alignment and structure
>pdb|3BQC|A Chain A, High Ph-Value Crystal Structure Of Emodin In Complex With The Catalytic Subunit Of Protein Kinase Ck2 Length = 335 Back     alignment and structure
>pdb|1Z9X|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 3 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|1PJK|A Chain A, Crystal Structure Of A C-terminal Deletion Mutant Of Human Protein Kinase Ck2 Catalytic Subunit Length = 334 Back     alignment and structure
>pdb|1JWH|A Chain A, Crystal Structure Of Human Protein Kinase Ck2 Holoenzyme Length = 337 Back     alignment and structure
>pdb|2ZJW|A Chain A, Crystal Structure Of Human Ck2 Alpha Complexed With Ellagic Acid Length = 340 Back     alignment and structure
>pdb|3NGA|A Chain A, Human Ck2 Catalytic Domain In Complex With Cx-4945 Length = 333 Back     alignment and structure
>pdb|1V0O|A Chain A, Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulphonate Ligand Complex Length = 288 Back     alignment and structure
>pdb|1WMK|A Chain A, Human Death-Associated Kinase Drp-1, Mutant S308d D40 Length = 321 Back     alignment and structure
>pdb|1ZWS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Drp-1 Kinase Length = 288 Back     alignment and structure
>pdb|1OB3|A Chain A, Structure Of P. Falciparum Pfpk5 Length = 288 Back     alignment and structure
>pdb|1V0B|A Chain A, Crystal Structure Of The T198a Mutant Of Pfpk5 Length = 288 Back     alignment and structure
>pdb|2YA9|A Chain A, Crystal Structure Of The Autoinhibited Form Of Mouse Dapk2 Length = 361 Back     alignment and structure
>pdb|2POP|A Chain A, The Crystal Structure Of Tab1 And Bir1 Complex Length = 353 Back     alignment and structure
>pdb|3GC9|A Chain A, The Structure Of P38beta C119s, C162s In Complex With A Dihydroquinazolinone Inhibitor Length = 370 Back     alignment and structure
>pdb|3GC8|A Chain A, The Structure Of P38beta C162s In Complex With A Dihydroquinazolinone Length = 370 Back     alignment and structure
>pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 Back     alignment and structure
>pdb|2A2A|A Chain A, High-resolution Crystallographic Analysis Of The Autoinhibited Conformation Of A Human Death-associated Protein Kinase Length = 321 Back     alignment and structure
>pdb|3GP0|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 11 (p38 Beta) In Complex With Nilotinib Length = 348 Back     alignment and structure
>pdb|3O8P|A Chain A, Conformational Plasticity Of P38 Map Kinase Dfg Motif Mutants In Response To Inhibitor Binding Length = 360 Back     alignment and structure
>pdb|3MTL|A Chain A, Crystal Structure Of The Pctaire1 Kinase In Complex With Ind E804 Length = 324 Back     alignment and structure
>pdb|3MH0|A Chain A, Mutagenesis Of P38 Map Kinase Eshtablishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|4DGL|C Chain C, Crystal Structure Of The Ck2 Tetrameric Holoenzyme Length = 335 Back     alignment and structure
>pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 Back     alignment and structure
>pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 Back     alignment and structure
>pdb|3GI3|A Chain A, Crystal Structure Of A N-Phenyl-N'-Naphthylurea Analog In Complex With P38 Map Kinase Length = 360 Back     alignment and structure
>pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 Back     alignment and structure
>pdb|2CLQ|A Chain A, Structure Of Mitogen-Activated Protein Kinase Kinase Kinase 5 Length = 295 Back     alignment and structure
>pdb|2PVH|A Chain A, Structure-Based Design Of Pyrazolo[1,5-A][1,3,5]triazine Derivatives As Potent Inhibitors Of Protein Kinase Ck2 Length = 352 Back     alignment and structure
>pdb|3VW6|A Chain A, Crystal Structure Of Human Apoptosis Signal-Regulating Kinase 1 (Ask1) With Imidazopyridine Inhibitor Length = 269 Back     alignment and structure
>pdb|3MH3|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|1UNG|A Chain A, Structural Mechanism For The Inhibition Of Cdk5-P25 By Roscovitine, Aloisine And Indirubin. Length = 292 Back     alignment and structure
>pdb|3MH1|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|2VRX|A Chain A, Structure Of Aurora B Kinase In Complex With Zm447439 Length = 285 Back     alignment and structure
>pdb|3N9X|A Chain A, Crystal Structure Of Map Kinase From Plasmodium Berghei, Pb000659.00.0 Length = 432 Back     alignment and structure
>pdb|1DAW|A Chain A, Crystal Structure Of A Binary Complex Of Protein Kinase Ck2 (Alpha-Subunit) And Mg-Amppnp Length = 327 Back     alignment and structure
>pdb|3PVG|A Chain A, Crystal Structure Of Z. Mays Ck2 Alpha Subunit In Complex With The Inhibitor 4,5,6,7-Tetrabromo-1-Carboxymethylbenzimidazole (K68) Length = 331 Back     alignment and structure
>pdb|4ANM|A Chain A, Complex Of Ck2 With A Cdc7 Inhibitor Length = 335 Back     alignment and structure
>pdb|2QC6|A Chain A, Protein Kinase Ck2 In Complex With Dbc Length = 332 Back     alignment and structure
>pdb|1M2P|A Chain A, Crystal Structure Of 1,8-Di-Hydroxy-4-Nitro- AnthraquinoneCK2 KINASE COMPLEX Length = 325 Back     alignment and structure
>pdb|3KXG|A Chain A, Crystal Structure Of Z. Mays Ck2 Kinase Alpha Subunit In Complex With The Inhibitor 3,4,5,6,7-Pentabromo-1h-Indazole (K64) Length = 327 Back     alignment and structure
>pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 Back     alignment and structure
>pdb|1DS5|A Chain A, Dimeric Crystal Structure Of The Alpha Subunit In Complex With Two Beta Peptides Mimicking The Architecture Of The Tetrameric Protein Kinase Ck2 Holoenzyme. Length = 332 Back     alignment and structure
>pdb|2BFY|A Chain A, Complex Of Aurora-B With Incenp And Hesperidin. Length = 284 Back     alignment and structure
>pdb|4DGN|A Chain A, Crystal Structure Of Maize Ck2 In Complex With The Inhibitor Luteolin Length = 326 Back     alignment and structure
>pdb|4DGM|A Chain A, Crystal Structure Of Maize Ck2 In Complex With The Inhibitor Apigenin Length = 326 Back     alignment and structure
>pdb|4EOO|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With Atp Length = 299 Back     alignment and structure
>pdb|4EOP|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|3TKU|A Chain A, Mrck Beta In Complex With Fasudil Length = 433 Back     alignment and structure
>pdb|2POM|A Chain A, Tab1 With Manganese Ion Length = 372 Back     alignment and structure
>pdb|4EOI|A Chain A, Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 299 Back     alignment and structure
>pdb|4EON|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|4EOM|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|3QFV|A Chain A, Mrck Beta In Complex With Tpca-1 Length = 415 Back     alignment and structure
>pdb|2J4O|A Chain A, Structure Of Tab1 Length = 401 Back     alignment and structure
>pdb|1O9U|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide Length = 350 Back     alignment and structure
>pdb|2PML|X Chain X, Crystal Structure Of Pfpk7 In Complex With An Atp Analogue Length = 348 Back     alignment and structure
>pdb|2I6L|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 6 (Mapk6) Length = 320 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|1GII|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|3PXF|A Chain A, Cdk2 In Complex With Two Molecules Of 8-Anilino-1-Naphthalene Sulfonate Length = 306 Back     alignment and structure
>pdb|2W4K|A Chain A, X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 Back     alignment and structure
>pdb|3EZR|A Chain A, Cdk-2 With Indazole Inhibitor 17 Bound At Its Active Site Length = 300 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure
>pdb|1H8F|A Chain A, Glycogen Synthase Kinase 3 Beta. Length = 352 Back     alignment and structure
>pdb|1PF8|A Chain A, Crystal Structure Of Human Cyclin-dependent Kinase 2 Complexed With A Nucleoside Inhibitor Length = 298 Back     alignment and structure
>pdb|2IW8|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82h-L83v- H84d Mutant With An O6-Cyclohexylmethylguanine Inhibitor Length = 302 Back     alignment and structure
>pdb|2IW6|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A Complexed With A Bisanilinopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|4EOS|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|1OGU|A Chain A, Structure Of Human Thr160-phospho Cdk2/cyclin A Complexed With A 2-arylamino-4-cyclohexylmethyl-5-nitroso-6- aminopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|2Y0A|A Chain A, Structure Of Dapk1 Construct Residues 1-304 Length = 326 Back     alignment and structure
>pdb|3PJ8|A Chain A, Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D]pyrimidine Bioisostere Of Roscovitine Length = 299 Back     alignment and structure
>pdb|1OIT|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-dependent Kinase Inhibitors Identified Through Structure-based Hybridisation Length = 299 Back     alignment and structure
>pdb|1OIR|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-Dependent Kinase Inhibitors Identified Through Structure-Based Hybridisation Length = 299 Back     alignment and structure
>pdb|1H01|A Chain A, Cdk2 In Complex With A Disubstituted 2, 4-Bis Anilino Pyrimidine Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|4ERW|A Chain A, Cdk2 In Complex With Staurosporine Length = 306 Back     alignment and structure
>pdb|1H1P|A Chain A, Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMPLEXED With The Inhibitor Nu2058 Length = 303 Back     alignment and structure
>pdb|1VYW|A Chain A, Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 309 Back     alignment and structure
>pdb|3BHT|A Chain A, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX WITH THE Inhibitor Meriolin 3 Length = 300 Back     alignment and structure
>pdb|2JGZ|A Chain A, Crystal Structure Of Phospho-Cdk2 In Complex With Cyclin B Length = 289 Back     alignment and structure
>pdb|3QHR|A Chain A, Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic Length = 298 Back     alignment and structure
>pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 Back     alignment and structure
>pdb|2YAK|A Chain A, Structure Of Death-Associated Protein Kinase 1 (Dapk1) In Complex With A Ruthenium Octasporine Ligand (Osv) Length = 285 Back     alignment and structure
>pdb|4EOQ|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|4BCQ|A Chain A, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 301 Back     alignment and structure
>pdb|1W98|A Chain A, The Structural Basis Of Cdk2 Activation By Cyclin E Length = 298 Back     alignment and structure
>pdb|1E9H|A Chain A, Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex With The Inhibitor Indirubin-5-Sulphonate Bound Length = 297 Back     alignment and structure
>pdb|4E7W|A Chain A, Structure Of Gsk3 From Ustilago Maydis Length = 394 Back     alignment and structure
>pdb|4I3Z|A Chain A, Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNESIUM IONS Length = 296 Back     alignment and structure
>pdb|2W17|A Chain A, Cdk2 In Complex With The Imidazole Pyrimidine Amide, Compound (S)-8b Length = 299 Back     alignment and structure
>pdb|1FIN|A Chain A, Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 298 Back     alignment and structure
>pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 Back     alignment and structure
>pdb|4EOK|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With The Inhibitor Nu6102 Length = 300 Back     alignment and structure
>pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 Back     alignment and structure
>pdb|1QMZ|A Chain A, Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Complex Length = 299 Back     alignment and structure
>pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|1JST|A Chain A, Phosphorylated Cyclin-Dependent Kinase-2 Bound To Cyclin A Length = 298 Back     alignment and structure
>pdb|2W4J|A Chain A, X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 Back     alignment and structure
>pdb|1WVW|A Chain A, Crystal Structures Of Kinase Domain Of Dap Kinase In Complex With Small Molecular Inhibitors Length = 278 Back     alignment and structure
>pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Inhibitor 2-Amino-6-(3'-Methyl-2'-Oxo)butoxypurine Length = 299 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 Back     alignment and structure
>pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 Back     alignment and structure
>pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 Back     alignment and structure
>pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 Back     alignment and structure
>pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 Back     alignment and structure
>pdb|2X0G|A Chain A, X-ray Structure Of A Dap-kinase Calmodulin Complex Length = 334 Back     alignment and structure
>pdb|3F88|A Chain A, Glycogen Synthase Kinase 3beta Inhibitor Complex Length = 349 Back     alignment and structure
>pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 Back     alignment and structure
>pdb|3GB2|A Chain A, Gsk3beta Inhibitor Complex Length = 353 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|3F5U|A Chain A, Crystal Structure Of The Death Associated Protein Kinase In Complex With Amppnp And Mg2+ Length = 295 Back     alignment and structure
>pdb|1IG1|A Chain A, 1.8a X-Ray Structure Of Ternary Complex Of A Catalytic Domain Of Death-Associated Protein Kinase With Atp Analogue And Mn. Length = 294 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|3F7Z|A Chain A, X-ray Co-crystal Structure Of Glycogen Synthase Kinase 3beta In Complex With An Inhibitor Length = 350 Back     alignment and structure
>pdb|2XZS|A Chain A, Death Associated Protein Kinase 1 Residues 1-312 Length = 312 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 Back     alignment and structure
>pdb|3DFC|B Chain B, Crystal Structure Of A Glycine-Rich Loop Mutant Of The Death Associated Protein Kinase Catalytic Domain With Amppnp Length = 295 Back     alignment and structure
>pdb|2OW3|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With Bis- (Indole)maleimide Pyridinophane Inhibitor Length = 352 Back     alignment and structure
>pdb|3ZDI|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide And Inhibitor 7d Length = 350 Back     alignment and structure
>pdb|4AFJ|A Chain A, 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selective Gsk-3 Inhibitors Length = 367 Back     alignment and structure
>pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 Back     alignment and structure
>pdb|3GU8|A Chain A, Crystal Structure Of Dapkl93g With N6-Cyclopentyladenosine Length = 295 Back     alignment and structure
>pdb|3GU4|A Chain A, Crystal Structure Of Dapkq23v-Amppnp Length = 295 Back     alignment and structure
>pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|4EOJ|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With Atp Length = 302 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|4DIT|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Imidazopyridine Inhibitor Length = 382 Back     alignment and structure
>pdb|3ZRK|A Chain A, Identification Of 2-(4-Pyridyl)thienopyridinones As Gsk-3beta Inhibitors Length = 371 Back     alignment and structure
>pdb|3R1N|A Chain A, Mk3 Kinase Bound To Compound 5b Length = 317 Back     alignment and structure
>pdb|1P4F|A Chain A, Death Associated Protein Kinase Catalytic Domain With Bound Inhibitor Fragment Length = 293 Back     alignment and structure
>pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 Back     alignment and structure
>pdb|3SAY|A Chain A, Crystal Structure Of Human Glycogen Synthase Kinase 3 Beta (Gsk3b) In Complex With Inhibitor 142 Length = 430 Back     alignment and structure
>pdb|3FHR|A Chain A, High Resolution Crystal Structure Of Mitogen-Activated Protein Kinase-Activated Protein Kinase 3 (Mk3)-Inhibitor Complex Length = 336 Back     alignment and structure
>pdb|1GNG|A Chain A, Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With Frattide Peptide Length = 378 Back     alignment and structure
>pdb|3IS5|A Chain A, Crystal Structure Of Cdpk Kinase Domain From Toxoplasma Gondii, Tgme49_018720 Length = 285 Back     alignment and structure
>pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 Back     alignment and structure
>pdb|3A62|A Chain A, Crystal Structure Of Phosphorylated P70s6k1 Length = 327 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|3A60|A Chain A, Crystal Structure Of Unphosphorylated P70s6k1 (Form I) Length = 327 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|1R0E|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With 3-Indolyl-4- Arylmaleimide Inhibitor Length = 391 Back     alignment and structure
>pdb|1UV5|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With 6-Bromoindirubin-3'-Oxime Length = 350 Back     alignment and structure
>pdb|3SD0|A Chain A, Identification Of A Glycogen Synthase Kinase-3b Inhibitor That Attenuates Hyperactivity In Clock Mutant Mice Length = 350 Back     alignment and structure
>pdb|1Q5K|A Chain A, Crystal Structure Of Glycogen Synthase Kinase 3 In Complexed With Inhibitor Length = 414 Back     alignment and structure
>pdb|3LLT|A Chain A, Crystal Structure Of Pf14_0431, Kinase Domain Length = 360 Back     alignment and structure
>pdb|3OZ6|A Chain A, Crystal Structure Of Mapk From Cryptosporidium Parvum, Cgd2_1960 Length = 388 Back     alignment and structure
>pdb|2ISN|A Chain A, Crystal Structure Of A Phosphatase From A Pathogenic Strain Toxoplasma Gondii Length = 364 Back     alignment and structure
>pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 Back     alignment and structure
>pdb|2O5K|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Benzoimidazol Inhibitor Length = 372 Back     alignment and structure
>pdb|1I09|A Chain A, Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Length = 420 Back     alignment and structure
>pdb|1Q3D|A Chain A, Gsk-3 Beta Complexed With Staurosporine Length = 424 Back     alignment and structure
>pdb|1PYX|A Chain A, Gsk-3 Beta Complexed With Amp-Pnp Length = 422 Back     alignment and structure
>pdb|3MFR|A Chain A, Cask-4m Cam Kinase Domain, Native Length = 351 Back     alignment and structure
>pdb|3F3Z|A Chain A, Crystal Structure Of Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 In Presence Of Indirubin E804 Length = 277 Back     alignment and structure
>pdb|4AW2|A Chain A, Crystal Structure Of Cdc42 Binding Protein Kinase Alpha (Mrck Alpha) Length = 437 Back     alignment and structure
>pdb|4ACC|A Chain A, Gsk3b In Complex With Inhibitor Length = 465 Back     alignment and structure
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure
>pdb|2QG5|A Chain A, Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 Length = 294 Back     alignment and structure
>pdb|2I3O|A Chain A, Crystal Structure Of Gamma-Glutamyl Transferase Related Protein From Thermoplasma Acidophilum Length = 516 Back     alignment and structure
>pdb|4EQM|A Chain A, Structural Analysis Of Staphylococcus Aureus SerineTHREONINE KINASE Pknb Length = 294 Back     alignment and structure
>pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 Back     alignment and structure
>pdb|3DFA|A Chain A, Crystal Structure Of Kinase Domain Of Calcium-dependent Protein Kinase Cgd3_920 From Cryptosporidium Parvum Length = 286 Back     alignment and structure
>pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 Back     alignment and structure
>pdb|2WEI|A Chain A, Crystal Structure Of The Kinase Domain Of Cryptosporidium Parvum Calcium Dependent Protein Kinase In Complex With 3- Mb-Pp1 Length = 287 Back     alignment and structure
>pdb|3HKO|A Chain A, Crystal Structure Of A Cdpk Kinase Domain From Cryptosporidium Parvum, Cgd7_40 Length = 345 Back     alignment and structure
>pdb|2VZ6|A Chain A, Structure Of Human Calcium Calmodulin Dependent Protein Kinase Type Ii Alpha (Camk2a) In Complex With Indirubin E804 Length = 313 Back     alignment and structure
>pdb|3NIZ|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Adp Bound Length = 311 Back     alignment and structure
>pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 Back     alignment and structure
>pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 Back     alignment and structure
>pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 Back     alignment and structure
>pdb|2QNJ|A Chain A, Kinase And Ubiquitin-Associated Domains Of Mark3PAR-1 Length = 328 Back     alignment and structure
>pdb|2QKR|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Indirubin 3'-Monoxime Bound Length = 313 Back     alignment and structure
>pdb|3KL8|A Chain A, Camkiintide Inhibitor Complex Length = 269 Back     alignment and structure
>pdb|3KK8|A Chain A, Camkii Substrate Complex A Length = 284 Back     alignment and structure
>pdb|3FE3|A Chain A, Crystal Structure Of The Kinase Mark3PAR-1: T211a-S215a Double Mutant Length = 328 Back     alignment and structure
>pdb|3KK9|A Chain A, Camkii Substrate Complex B Length = 282 Back     alignment and structure
>pdb|2BDW|A Chain A, Crystal Structure Of The Auto-Inhibited Kinase Domain Of CalciumCALMODULIN ACTIVATED KINASE II Length = 362 Back     alignment and structure
>pdb|2HAK|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark1PAR-1 Length = 328 Back     alignment and structure
>pdb|2XUU|A Chain A, Crystal Structure Of A Dap-Kinase 1 Mutant Length = 334 Back     alignment and structure
>pdb|1HOW|A Chain A, The X-Ray Crystal Structure Of Sky1p, An Sr Protein Kinase In Yeast Length = 373 Back     alignment and structure
>pdb|1Q8Y|A Chain A, The Structure Of The Yeast Sr Protein Kinase, Sky1p, With Bound Adp Length = 373 Back     alignment and structure
>pdb|4AAA|A Chain A, Crystal Structure Of The Human Cdkl2 Kinase Domain Length = 331 Back     alignment and structure
>pdb|3BHH|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase Iib Isoform 1 (camk2b) Length = 295 Back     alignment and structure
>pdb|2WEL|A Chain A, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 327 Back     alignment and structure
>pdb|2PK9|A Chain A, Structure Of The Pho85-pho80 Cdk-cyclin Complex Of The Phosphate-responsive Signal Transduction Pathway Length = 317 Back     alignment and structure
>pdb|3UC3|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.3 Length = 361 Back     alignment and structure
>pdb|3GBZ|A Chain A, Structure Of The Cmgc Cdk Kinase From Giardia Lamblia Length = 329 Back     alignment and structure
>pdb|4EC8|A Chain A, Structure Of Full Length Cdk9 In Complex With Cyclint And Drb Length = 373 Back     alignment and structure
>pdb|2VN9|A Chain A, Crystal Structure Of Human Calcium Calmodulin Dependent Protein Kinase Ii Delta Isoform 1, Camkd Length = 301 Back     alignment and structure
>pdb|1YHS|A Chain A, Crystal Structure Of Pim-1 Bound To Staurosporine Length = 273 Back     alignment and structure
>pdb|1ZYC|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: Wild- Type In Apo Form. Length = 303 Back     alignment and structure
>pdb|2Y7J|A Chain A, Structure Of Human Phosphorylase Kinase, Gamma 2 Length = 365 Back     alignment and structure
>pdb|1ZMV|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: K82r Mutant Length = 327 Back     alignment and structure
>pdb|2R0I|A Chain A, Crystal Structure Of A Kinase Mark2PAR-1 Mutant Length = 327 Back     alignment and structure
>pdb|1ZMU|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Wild Type Length = 327 Back     alignment and structure
>pdb|4FG8|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-315 In Complex With Atp Length = 315 Back     alignment and structure
>pdb|4BCF|A Chain A, Structure Of Cdk9 In Complex With Cyclin T And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 331 Back     alignment and structure
>pdb|4A07|A Chain A, Human Pdk1 Kinase Domain In Complex With Allosteric Activator Ps171 Bound To The Pif-Pocket Length = 311 Back     alignment and structure
>pdb|4FG9|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-320 In Complex With Atp Length = 320 Back     alignment and structure
>pdb|1Y8G|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Inactive Double Mutant With Selenomethionine Length = 327 Back     alignment and structure
>pdb|3BLH|A Chain A, Crystal Structure Of Human Cdk9CYCLINT1 Length = 331 Back     alignment and structure
>pdb|1A06|A Chain A, Calmodulin-Dependent Protein Kinase From Rat Length = 332 Back     alignment and structure
>pdb|1QL6|A Chain A, The Catalytic Mechanism Of Phosphorylase Kinase Probed By Mutational Studies Length = 298 Back     alignment and structure
>pdb|4ALV|A Chain A, Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 328 Back     alignment and structure
>pdb|4ALU|A Chain A, Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 328 Back     alignment and structure
>pdb|3IEC|A Chain A, Helicobacter Pylori Caga Inhibits Par1MARK FAMILY KINASES BY Mimicking Host Substrates Length = 319 Back     alignment and structure
>pdb|1ZY4|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: R794g Hyperactivating Mutant In Apo Form. Length = 303 Back     alignment and structure
>pdb|1XWS|A Chain A, Crystal Structure Of The Human Pim1 Kinase Domain Length = 313 Back     alignment and structure
>pdb|3NAX|A Chain A, Pdk1 In Complex With Inhibitor Mp7 Length = 311 Back     alignment and structure
>pdb|3MI9|A Chain A, Crystal Structure Of Hiv-1 Tat Complexed With Human P-Tefb Length = 351 Back     alignment and structure
>pdb|3CXW|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Beta Carboline Ligand I Length = 314 Back     alignment and structure
>pdb|3C4E|A Chain A, Pim-1 Kinase Domain In Complex With 3-Aminophenyl-7- Azaindole Length = 273 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query934
3kdj_B316 Protein phosphatase 2C 56; ABA, PYL1, abscisic aci 2e-62
3qn1_B337 Protein phosphatase 2C 16; start domain, BET V dom 2e-61
2iq1_A274 Protein phosphatase 2C kappa, PPM1K; structural ge 2e-59
4da1_A389 Protein phosphatase 1K, mitochondrial; metal-ION-a 1e-58
2i44_A324 Serine-threonine phosphatase 2C; PSI-2, 8817Z, str 1e-56
2p8e_A307 PPM1B beta isoform variant 6; structural genomics, 3e-56
1a6q_A382 Phosphatase 2C; catalytic mechanism, metalloenzyme 1e-54
2i0o_A304 Ser/Thr phosphatase; beta sandwich, structural gen 3e-54
3d8k_A377 PP2C, protein phosphatase 2C; nysgrc, PSI-II, STR 1e-53
2isn_A364 NYSGXRC-8828Z, phosphatase; pathogenic strain, pra 6e-51
2irm_A358 Mitogen-activated protein kinase kinase kinase 7 i 2e-45
2j4o_A401 Mitogen-activated protein kinase kinase kinase 7-i 9e-44
2pnq_A467 [pyruvate dehydrogenase [lipoamide]]-phosphatase 1 1e-31
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 6e-22
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 1e-21
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 5e-21
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 6e-21
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 4e-20
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 2e-19
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 5e-19
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 1e-18
3rp9_A458 Mitogen-activated protein kinase; structural genom 2e-18
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 2e-18
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 2e-18
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 3e-18
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 7e-18
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 8e-18
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 8e-18
2fst_X367 Mitogen-activated protein kinase 14; active mutant 9e-18
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 1e-17
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 1e-17
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 2e-17
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 3e-17
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 5e-17
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 6e-17
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 1e-16
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 1e-16
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 2e-16
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 2e-16
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 2e-16
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 2e-16
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 3e-16
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 4e-16
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 8e-16
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 2e-15
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 3e-15
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 3e-15
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 6e-15
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 1e-14
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 2e-14
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 4e-14
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 5e-14
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 8e-14
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 1e-13
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 1e-13
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 3e-13
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 4e-13
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 4e-13
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 5e-13
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 9e-13
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 1e-12
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 1e-12
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 1e-12
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 2e-12
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 2e-12
3niz_A311 Rhodanese family protein; structural genomics, str 2e-12
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 2e-12
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 3e-12
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 8e-04
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 3e-12
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 4e-12
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 5e-12
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 9e-12
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 1e-11
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 2e-11
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 2e-11
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 2e-11
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 3e-11
3bhy_A283 Death-associated protein kinase 3; death associate 4e-11
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 5e-11
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 5e-11
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 5e-11
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 6e-11
2y0a_A326 Death-associated protein kinase 1; transferase, ca 7e-11
3o0g_A292 Cell division protein kinase 5; kinase activator c 7e-11
2a19_B284 Interferon-induced, double-stranded RNA-activated 8e-11
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 1e-10
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 1e-10
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 1e-10
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 1e-10
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 1e-10
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 1e-10
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 1e-10
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 1e-10
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 2e-10
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 2e-10
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 2e-10
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 2e-10
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 2e-10
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 2e-10
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 3e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-10
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 6e-10
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 7e-10
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 7e-10
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 7e-10
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 8e-10
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 9e-10
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 1e-09
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 1e-09
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 2e-09
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 2e-09
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 2e-09
2dyl_A318 Dual specificity mitogen-activated protein kinase 2e-09
3dls_A335 PAS domain-containing serine/threonine-protein KI; 3e-09
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 3e-09
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 4e-09
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 4e-09
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 4e-09
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 5e-09
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 6e-09
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 1e-08
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 3e-08
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 3e-08
1uu3_A310 HPDK1, 3-phosphoinositide dependent protein kinase 3e-08
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 3e-08
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 3e-08
3eqc_A360 Dual specificity mitogen-activated protein kinase; 4e-08
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 4e-08
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 4e-08
3aln_A327 Dual specificity mitogen-activated protein kinase; 5e-08
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 5e-08
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 6e-08
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 7e-08
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 7e-08
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 1e-07
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 1e-07
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 2e-07
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 2e-07
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 3e-07
2eue_A275 Carbon catabolite derepressing protein kinase; kin 3e-07
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 4e-07
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 4e-07
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 5e-07
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 5e-07
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 5e-07
2pk0_A250 Serine/threonine protein phosphatase STP1; SI moti 7e-07
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 7e-07
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 7e-07
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 9e-07
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 1e-06
3pvu_A 695 Beta-adrenergic receptor kinase 1; transferase, se 1e-06
3fme_A290 Dual specificity mitogen-activated protein kinase; 1e-06
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 1e-06
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 2e-06
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 2e-06
3q4u_A301 Activin receptor type-1; structural genomics conso 2e-06
3an0_A340 Dual specificity mitogen-activated protein kinase; 2e-06
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 2e-06
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 2e-06
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 3e-06
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 3e-06
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 3e-06
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 5e-06
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 5e-06
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 6e-06
2jfr_A234 Ser-Thr phosphatase MSPP; hydrolase, PPM phosphata 7e-06
1txo_A237 Putative bacterial enzyme; serine/threonine protei 7e-06
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 9e-06
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 9e-06
3soc_A322 Activin receptor type-2A; structural genomics cons 1e-05
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 1e-05
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 1e-05
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 1e-05
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 1e-05
3ork_A311 Serine/threonine protein kinase; structural genomi 2e-05
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 2e-05
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 3e-05
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 5e-05
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 6e-05
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 8e-05
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 8e-05
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 8e-05
3g51_A325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 9e-05
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 1e-04
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 1e-04
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 1e-04
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 2e-04
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 3e-04
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 3e-04
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 5e-04
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 7e-04
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 8e-04
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 8e-04
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 9e-04
>3kdj_B Protein phosphatase 2C 56; ABA, PYL1, abscisic acid signaling pathway, cell membr hydrolase, magnesium, manganese, metal-binding, nucleus; HET: A8S; 1.88A {Arabidopsis thaliana} PDB: 3nmn_B* 3jrq_A* 3ujk_A 3nmv_B 3ujl_B* Length = 316 Back     alignment and structure
 Score =  213 bits (544), Expect = 2e-62
 Identities = 92/390 (23%), Positives = 137/390 (35%), Gaps = 118/390 (30%)

Query: 73  SAMRQGRRKSQEDRTLCALDLHIPF----PGRRGRQEVTVGIVAVFDGHNGAEASELASK 128
           +++  GRR   ED                   R   +       V+DGH G++ +    +
Sbjct: 14  TSI-CGRRPEMEDAVSTIPRFLQSSSGSMLDGRFDPQSAAHFFGVYDGHGGSQVANYCRE 72

Query: 129 LLLEYFALHTYFLLDATYSAVLKKSARRLPNKGERDIVFQVLNWDEKLGRHELKFERFKF 188
            +                                                H    E    
Sbjct: 73  RM------------------------------------------------HLALAEEIAK 84

Query: 189 SLPDIFDDSFHLEILREALLRAIHDIDTAFSKEASRKKLDSGSTATVVLIAEGQILVANI 248
             P + D    LE  ++AL  +   +D+     A       GST+ V ++    I VAN 
Sbjct: 85  EKPMLSDGDTWLEKWKKALFNSFLRVDSEIESVAPET---VGSTSVVAVVFPSHIFVANC 141

Query: 249 GDSKALLCSEKFQSPAEAKATLLRLYRKRRDNNAISTSQGYNYLKSTVSNGLAHFTVKEL 308
           GDS+A+LC                     R   A+                        L
Sbjct: 142 GDSRAVLC---------------------RGKTAL-----------------------PL 157

Query: 309 TRDHHPDREDERYRVEAAGGYVLQWGGVSRVNGQLAVSRAIGDLSYKSYGVISVPEVTDW 368
           + DH PDREDE  R+EAAGG V+QW G +RV G LA+SR+IGD   K   +I  PEVT  
Sbjct: 158 SVDHKPDREDEAARIEAAGGKVIQWNG-ARVFGVLAMSRSIGDRYLKPS-IIPDPEVTAV 215

Query: 369 QSLTANDSYLVAASDGVFEKLSLQDVCDV---------------FWEVHTHGTAGPGFPS 413
           +     D  L+ ASDGV++ ++ ++ C++                               
Sbjct: 216 K-RVKEDDCLILASDGVWDVMTDEEACEMARKRILLWHKKNAVAGGASLLADERRKEGKD 274

Query: 414 SCSYSLADCLVDTAFEKGSMDNMAAVVVPL 443
             + S A+ L   A ++GS DN++ VVV L
Sbjct: 275 PAAMSAAEYLSKLAIQRGSKDNISVVVVDL 304


>3qn1_B Protein phosphatase 2C 16; start domain, BET V domain, PYR/PYL/RCAR, PP2C, abscisic ACI receptor, type 2C protein phosphatase; HET: A8S; 1.80A {Arabidopsis thaliana} PDB: 3ujg_B 3nmt_B* 3rt0_A 3kb3_B* Length = 337 Back     alignment and structure
>2iq1_A Protein phosphatase 2C kappa, PPM1K; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Homo sapiens} Length = 274 Back     alignment and structure
>4da1_A Protein phosphatase 1K, mitochondrial; metal-ION-assisted catalysis, dehydrogenase phosphatase, hydrolase; 2.38A {Homo sapiens} PDB: 3qht_A 1l2n_A Length = 389 Back     alignment and structure
>2i44_A Serine-threonine phosphatase 2C; PSI-2, 8817Z, structural genomics, protein structure initiative; 2.04A {Toxoplasma gondii} Length = 324 Back     alignment and structure
>2p8e_A PPM1B beta isoform variant 6; structural genomics, hydrolase, PSI-2, protein structure initiative; 1.82A {Homo sapiens} Length = 307 Back     alignment and structure
>1a6q_A Phosphatase 2C; catalytic mechanism, metalloenzyme, transductuin, hydrolase; 2.00A {Homo sapiens} SCOP: a.159.1.1 d.219.1.1 PDB: 3fxk_A 3fxj_A 3fxl_A* 3fxm_A* 3fxo_A Length = 382 Back     alignment and structure
>2i0o_A Ser/Thr phosphatase; beta sandwich, structural genomics, PSI, protei structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Anopheles gambiae} Length = 304 Back     alignment and structure
>3d8k_A PP2C, protein phosphatase 2C; nysgrc, PSI-II, STR genomics, protein structure initiative, NEW YORK structural research consortium, nysgxrc; 2.71A {Toxoplasma gondii} Length = 377 Back     alignment and structure
>2isn_A NYSGXRC-8828Z, phosphatase; pathogenic strain, praseodymium, sulfate structural genomics, PSI-2, protein structure initiative; 1.90A {Toxoplasma gondii} Length = 364 Back     alignment and structure
>2irm_A Mitogen-activated protein kinase kinase kinase 7 interacting protein 1; TAK1-binding protein, TAB1; 3.00A {Anopheles gambiae} Length = 358 Back     alignment and structure
>2j4o_A Mitogen-activated protein kinase kinase kinase 7-interacting protein 1; TGF-beta, pseudo-phosphatase, TAK1 binding protein, protein binding; 2.25A {Homo sapiens} PDB: 2pom_A 2pop_A Length = 401 Back     alignment and structure
>2pnq_A [pyruvate dehydrogenase [lipoamide]]-phosphatase 1; pyruvate dehydrogenase phosphatase 1, catalytic subunit, PDP1C, hydrolase; 1.81A {Rattus norvegicus} PDB: 3n3c_A 3mq3_A Length = 467 Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Length = 355 Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Length = 339 Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Length = 360 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Length = 397 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Length = 330 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Length = 298 Back     alignment and structure
>2pk0_A Serine/threonine protein phosphatase STP1; SI motif, signaling protein; 2.65A {Streptococcus agalactiae} Length = 250 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Length = 483 Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Length = 296 Back     alignment and structure
>2jfr_A Ser-Thr phosphatase MSPP; hydrolase, PPM phosphatase, manganese, phosphate; 0.83A {Mycobacterium smegmatis} PDB: 2jfs_A 2jft_A 2v06_A Length = 234 Back     alignment and structure
>1txo_A Putative bacterial enzyme; serine/threonine protein phosphatases, PSTP/PPP, structural genomics, PSI, protein structure initiative; 1.95A {Mycobacterium tuberculosis} SCOP: d.219.1.1 PDB: 2cm1_A Length = 237 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Length = 364 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Length = 345 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Length = 352 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query934
2pnq_A467 [pyruvate dehydrogenase [lipoamide]]-phosphatase 1 100.0
3qn1_B337 Protein phosphatase 2C 16; start domain, BET V dom 100.0
2p8e_A307 PPM1B beta isoform variant 6; structural genomics, 100.0
3kdj_B316 Protein phosphatase 2C 56; ABA, PYL1, abscisic aci 100.0
1a6q_A382 Phosphatase 2C; catalytic mechanism, metalloenzyme 100.0
2i0o_A304 Ser/Thr phosphatase; beta sandwich, structural gen 100.0
2iq1_A274 Protein phosphatase 2C kappa, PPM1K; structural ge 100.0
2i44_A324 Serine-threonine phosphatase 2C; PSI-2, 8817Z, str 100.0
2isn_A364 NYSGXRC-8828Z, phosphatase; pathogenic strain, pra 100.0
2j4o_A401 Mitogen-activated protein kinase kinase kinase 7-i 100.0
3d8k_A377 PP2C, protein phosphatase 2C; nysgrc, PSI-II, STR 100.0
2irm_A358 Mitogen-activated protein kinase kinase kinase 7 i 100.0
4da1_A389 Protein phosphatase 1K, mitochondrial; metal-ION-a 100.0
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 100.0
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 100.0
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 100.0
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 100.0
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 100.0
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 100.0
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 100.0
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 100.0
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 100.0
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 100.0
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 100.0
4aoj_A329 High affinity nerve growth factor receptor; transf 100.0
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 100.0
2pk0_A250 Serine/threonine protein phosphatase STP1; SI moti 100.0
4ase_A353 Vascular endothelial growth factor receptor 2; tra 100.0
3o0g_A292 Cell division protein kinase 5; kinase activator c 100.0
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 100.0
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 100.0
3niz_A311 Rhodanese family protein; structural genomics, str 100.0
1txo_A237 Putative bacterial enzyme; serine/threonine protei 100.0
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 100.0
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 100.0
2j82_A240 TPPHA, protein serine-threonine phosphatase; PP2C 100.0
3rp9_A458 Mitogen-activated protein kinase; structural genom 100.0
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 100.0
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 100.0
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 100.0
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 100.0
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 100.0
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 100.0
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 100.0
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 100.0
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 100.0
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 100.0
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 100.0
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 100.0
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 100.0
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 100.0
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 100.0
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 100.0
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 100.0
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 100.0
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 100.0
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 100.0
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 100.0
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 100.0
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 100.0
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 100.0
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 100.0
2fst_X367 Mitogen-activated protein kinase 14; active mutant 100.0
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 100.0
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 100.0
2y0a_A326 Death-associated protein kinase 1; transferase, ca 100.0
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 100.0
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 100.0
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 100.0
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 100.0
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 100.0
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 100.0
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 100.0
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 100.0
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 100.0
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 100.0
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 100.0
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 100.0
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 100.0
3dls_A335 PAS domain-containing serine/threonine-protein KI; 100.0
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 100.0
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 100.0
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 100.0
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 100.0
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 100.0
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 100.0
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 100.0
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 100.0
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 100.0
2eue_A275 Carbon catabolite derepressing protein kinase; kin 100.0
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 100.0
2jfr_A234 Ser-Thr phosphatase MSPP; hydrolase, PPM phosphata 100.0
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 100.0
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 100.0
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 100.0
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 100.0
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 100.0
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 100.0
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 100.0
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 100.0
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 100.0
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 100.0
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 100.0
3eqc_A360 Dual specificity mitogen-activated protein kinase; 100.0
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 100.0
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 100.0
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 100.0
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 100.0
3fme_A290 Dual specificity mitogen-activated protein kinase; 100.0
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 100.0
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 100.0
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 100.0
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 100.0
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 100.0
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 100.0
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 100.0
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 100.0
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 100.0
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 100.0
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 100.0
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 100.0
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 100.0
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 100.0
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 100.0
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 100.0
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 100.0
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 100.0
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 100.0
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 100.0
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 100.0
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 100.0
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 100.0
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 100.0
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 100.0
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 100.0
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 100.0
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 100.0
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 100.0
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 100.0
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 100.0
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 100.0
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 100.0
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 100.0
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 100.0
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 100.0
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 100.0
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 100.0
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 100.0
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 100.0
3bhy_A283 Death-associated protein kinase 3; death associate 100.0
3ork_A311 Serine/threonine protein kinase; structural genomi 100.0
3an0_A340 Dual specificity mitogen-activated protein kinase; 100.0
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 100.0
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 100.0
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 100.0
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.98
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 99.98
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 99.98
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.98
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.98
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 99.98
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 99.98
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.97
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 99.97
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.97
3aln_A327 Dual specificity mitogen-activated protein kinase; 99.97
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.97
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 99.97
3lzb_A327 Epidermal growth factor receptor; epidermal growth 99.97
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.97
3poz_A327 Epidermal growth factor receptor; kinase domain, a 99.97
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.97
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 99.97
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.97
2dyl_A318 Dual specificity mitogen-activated protein kinase 99.97
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.97
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.97
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 99.97
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 99.97
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.97
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 99.97
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.97
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.97
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.97
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 99.97
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.97
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.97
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 99.97
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 99.97
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 99.97
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.97
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.97
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 99.97
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 99.97
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 99.97
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.97
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.97
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.97
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 99.97
3soc_A322 Activin receptor type-2A; structural genomics cons 99.97
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 99.97
3q4u_A301 Activin receptor type-1; structural genomics conso 99.97
3pls_A298 Macrophage-stimulating protein receptor; protein k 99.97
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 99.97
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.97
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 99.97
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 99.97
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.97
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.97
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.97
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 99.97
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.97
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 99.97
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 99.97
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 99.97
2a19_B284 Interferon-induced, double-stranded RNA-activated 99.97
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 99.97
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.97
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.97
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 99.97
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 99.97
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.97
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.97
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.97
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.97
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 99.97
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.97
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.97
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.97
2xir_A316 Vascular endothelial growth factor receptor 2; ang 99.97
3rnr_A211 Stage II sporulation E family protein; structural 99.97
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 99.97
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.97
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.97
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.96
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.96
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.96
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 99.96
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 99.96
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.96
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.96
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.96
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 99.96
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.96
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 99.96
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.96
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.96
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.96
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 99.96
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.96
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 99.96
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.96
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.96
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 99.96
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.96
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.96
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.96
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.96
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 99.95
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 99.95
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.95
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 99.95
3uqc_A286 Probable conserved transmembrane protein; structur 99.94
4azs_A569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.77
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.64
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 99.63
3t91_A242 Stage II sporulation protein E; SPOIIE, phosphatas 99.57
3pu9_A242 Protein serine/threonine phosphatase; PSI-biology, 99.54
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 99.43
3f79_A255 Probable two-component response regulator; adaptor 99.27
3zt9_A193 Serine phosphatase; hydrolase, signal transduction 99.19
4gyi_A397 RIO2 kinase; protein kinase, ADP complex, phosphoa 99.16
3ke6_A399 Protein RV1364C/MT1410; anti-sigma factor, anti-si 98.21
3tm0_A263 Aminoglycoside 3'-phosphotransferase; protein kina 97.47
1nd4_A264 Aminoglycoside 3'-phosphotransferase; protein kina 97.3
3dxp_A359 Putative acyl-COA dehydrogenase; protein kinase-li 97.27
3sg8_A304 APH(2'')-ID; antibiotic resistance enzyme, transfe 97.23
3eq2_A394 Probable two-component response regulator; adaptor 95.62
3r70_A320 Aminoglycoside phosphotransferase; structural geno 95.16
3tdw_A306 Gentamicin resistance protein; kinase, phosphoryl 93.31
2q83_A346 YTAA protein; 2635576, structural genomics, joint 90.52
2olc_A397 MTR kinase, methylthioribose kinase; kinase ADP-2H 90.52
2yle_A229 Protein spire homolog 1; actin-binding protein, ac 90.04
3ovc_A362 Hygromycin-B 4-O-kinase; aminoglycoside phosphotra 87.94
3d1u_A288 Putative fructosamine-3-kinase; YP_290396.1, struc 87.82
2pyw_A420 Uncharacterized protein; 5-methylthioribose kinase 83.25
>2pnq_A [pyruvate dehydrogenase [lipoamide]]-phosphatase 1; pyruvate dehydrogenase phosphatase 1, catalytic subunit, PDP1C, hydrolase; 1.81A {Rattus norvegicus} PDB: 3n3c_A 3mq3_A Back     alignment and structure
Probab=100.00  E-value=1.1e-50  Score=466.87  Aligned_cols=353  Identities=22%  Similarity=0.234  Sum_probs=217.1

Q ss_pred             eeeeeeecc-CCccccceeeeeccCCCCCCCCCCccceEEEEEEecCCCchHHHHHHHHHHHHHHHHHhhhhhhhHHHHH
Q 002341           71 CQSAMRQGR-RKSQEDRTLCALDLHIPFPGRRGRQEVTVGIVAVFDGHNGAEASELASKLLLEYFALHTYFLLDATYSAV  149 (934)
Q Consensus        71 ~~~~~~~G~-R~~~ED~~~~~~~~~~~~~~~~~~~~~~~~lfgVfDGHgG~~~a~~~s~~L~~~i~~~~~~~~~~~~~~~  149 (934)
                      ....+++|. |+.|||++.+..++.           .+..||||||||||+.||++|+++|+.+|..++..  ...+...
T Consensus        39 ~~~~s~~g~~R~~nED~~~v~~~~~-----------~~~~lfgVfDGHGG~~aa~~as~~L~~~i~~~l~~--~~~l~~~  105 (467)
T 2pnq_A           39 LGFDSNRLPANAPIEDRRSATTCLQ-----------TRGMLLGVFDGHAGCACSQAVSERLFYYIAVSLLP--HETLLEI  105 (467)
T ss_dssp             EEEEEEEECCSSSCCEEEEEEEESS-----------SSCEEEEEEEEESSSHHHHHHHHHHHHHHHHHHCC--HHHHHHH
T ss_pred             EEEEeeccCCCCCCCCceeeeeccC-----------CCcEEEEEECCCCCHHHHHHHHHHHHHHHHHhhcc--hhhhhhh
Confidence            334455665 999999998776532           24589999999999999999999999999865311  0000000


Q ss_pred             HHhhhccCCCCCCccchhhcccchhh---------hccchhhhhhcccCCCcccccchhHHHHHHHHHHHHHHHHHHHHH
Q 002341          150 LKKSARRLPNKGERDIVFQVLNWDEK---------LGRHELKFERFKFSLPDIFDDSFHLEILREALLRAIHDIDTAFSK  220 (934)
Q Consensus       150 ~~~~~~~~~~~~~~~~~~~~~~~~~~---------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~al~~af~~~d~~i~~  220 (934)
                      .......       .....+++|...         ...|+..+..++..+............+.++|++||.++|++|.+
T Consensus       106 ~~~~~~~-------~~~~~~l~~~~~~~~~~~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~aL~~af~~~d~~i~~  178 (467)
T 2pnq_A          106 ENAVESG-------RALLPILQWHKHPNDYFSKEASKLYFNGLRTYWQELIDLNTGESADIDVKEALINAFKRLDNDISL  178 (467)
T ss_dssp             HTTTC-----------CCCCEEECCCTTCCCCSTTHHHHHHHHHHHHHHHHHC------CCCHHHHHHHHHHHHHHHHHH
T ss_pred             hhhhhcc-------ccccccccccccccccchhhhhhhhhcchhhhhhhhccccccccchhhHHHHHHHHHHHHHHHHHH
Confidence            0000000       000111222111         112222232222110000000000014688999999999999987


Q ss_pred             Hhcc------------CCCCCCceeEeeeeeCCeEEEEEcccceeEEeccCCCChhHHHHHHHHHHhhccCCcccccccc
Q 002341          221 EASR------------KKLDSGSTATVVLIAEGQILVANIGDSKALLCSEKFQSPAEAKATLLRLYRKRRDNNAISTSQG  288 (934)
Q Consensus       221 ~~~~------------~~~~sGsTa~v~~i~~~~l~vAnvGDSRavl~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~  288 (934)
                      .+..            ....+||||++++|.+++|||||||||||||++.+                             
T Consensus       179 ~~~~~~~~~~~~~~~~~~~~~GtTa~v~li~~~~l~vAnvGDSRa~l~r~~-----------------------------  229 (467)
T 2pnq_A          179 EAQVGDPNSFLNYLVLRVAFSGATACVAHVDGVDLHVANTGDSRAMLGVQE-----------------------------  229 (467)
T ss_dssp             HHHHCCSSHHHHHHHHHHHHSEECEEEEEEETTEEEEEEESSCEEEEEEEC-----------------------------
T ss_pred             hhhhcccccccccccccCCCCcceEEEEEEECCEEEEEECCCceEEEEEec-----------------------------
Confidence            6642            23458999999999999999999999999999642                             


Q ss_pred             cccccccccCCcccceeeecCCCCCCCChhHHHHHHHcCCEEEe--ccCcccccCccceecccCCCCCccC---------
Q 002341          289 YNYLKSTVSNGLAHFTVKELTRDHHPDREDERYRVEAAGGYVLQ--WGGVSRVNGQLAVSRAIGDLSYKSY---------  357 (934)
Q Consensus       289 ~~~~~~~~~~G~~~~~~~~Lt~DH~~~~~~E~~RI~~~gg~v~~--~~~~~Rv~g~L~~sRa~GD~~~K~~---------  357 (934)
                              .+  +.|.+++||+||++.++.|++||.++|+.+..  ....+||+|.|++||||||..||+.         
T Consensus       230 --------~~--g~~~~~~LT~DH~~~~~~E~~Ri~~~g~~~~~~~~~~~~Rv~G~l~vtRAlGd~~~K~~~~~~~~~~~  299 (467)
T 2pnq_A          230 --------ED--GSWSAVTLSNDHNAQNERELQRLKLEHPKNEAKSVVKQDRLLGLLMPFRAFGDVKFKWSIDLQKRVIE  299 (467)
T ss_dssp             --------TT--SCEEEEECCCCCSTTCHHHHHHHHHTSCGGGHHHHBSSSSBTTTBSSSBCEECGGGTSCHHHHHHHHS
T ss_pred             --------CC--CcEEEEECCCCCCCCCHHHHHHHHHcCCCcccceeEecCccccccccchhcCchhhcccchhhhhhhc
Confidence                    01  35789999999999999999999999963210  1113799999999999999999851         


Q ss_pred             ---C--------------------cccCCceeEEeecCCCCeEEEEEcCCCccccCHHHHHHHHHHHhhcCCCCCC----
Q 002341          358 ---G--------------------VISVPEVTDWQSLTANDSYLVAASDGVFEKLSLQDVCDVFWEVHTHGTAGPG----  410 (934)
Q Consensus       358 ---g--------------------v~a~Pev~~~~~l~~~d~fLVLaSDGLwd~ls~~evv~~v~~~~~~~~~~~~----  410 (934)
                         |                    |+++|+|+.+. +.++|+|||||||||||+|+++||+++|..++.......+    
T Consensus       300 ~~~G~~~~~~~~~~~~~~~~~~p~v~~~Pdv~~~~-l~~~D~fLVLaSDGLwd~ls~~eiv~iv~~~~~~~~~~~p~~~~  378 (467)
T 2pnq_A          300 SGPDQLNDNEYTKFIPPNYHTPPYLTAEPEVTYHR-LRPQDKFLVLATDGLWETMHRQDVVRIVGEYLTGMHHQQPIAVG  378 (467)
T ss_dssp             SSCC-----------CTTCSSSCCCBCCCEEEEEE-CCTTEEEEEEECHHHHTTSCHHHHHHHHHHHHTTCSSCC-----
T ss_pred             ccccccccccccccccccccCCCcccccceEEEEE-cCCCCeEEEEEecCccccCChHHHHHHHHHHHhhccccCccccc
Confidence               1                    89999999986 8999999999999999999999999999988753321110    


Q ss_pred             CCCcchHHHHHHHHHHHHhcCCCCCcEEEEEEcCCCcccchhhhcccccc-CCCCCCCccc-cccc---ceecCCCcccc
Q 002341          411 FPSSCSYSLADCLVDTAFEKGSMDNMAAVVVPLGSIYVSENLHRERRMEE-GDIDCPSKGL-QKLV---YKQSGSGMNMN  485 (934)
Q Consensus       411 ~~~~~~~~~a~~lv~~A~~~gs~DNiT~ivv~l~~~~~~~~~~~~~~~~~-~~~~~~~~~~-~~~p---~r~~rddit~~  485 (934)
                      ........+++.|++.+....        -+..+.++++|+++++++.+. |.++...+.. ++||   .|+|||||||+
T Consensus       379 ~~~~~~~~~~~~l~~r~~~~~--------~~~~~~naA~~Lir~Al~~~~~Ge~~~~~~~~ll~~~~~~~R~~~DdITVi  450 (467)
T 2pnq_A          379 GYKVTLGQMHGLLTERRAKMS--------SVFEDQNAATHLIRHAVGNNEFGAVDHERLSKMLSLPEELARMYRDDITII  450 (467)
T ss_dssp             ----------------------------------CCHHHHHHHHHHC-------------------------CCSCEEEE
T ss_pred             ccCccHHHHHHHHHHhhhccc--------CCchhhHHHHHHHHHHhcCCCcCcchHHHHHhhhcCCccccccCCCCcEEE
Confidence            011223445666655443221        123467899999999998764 5466655444 4777   78899999999


Q ss_pred             ceeccc
Q 002341          486 LLQLKH  491 (934)
Q Consensus       486 v~~~~~  491 (934)
                      ||+|+.
T Consensus       451 Vv~~~~  456 (467)
T 2pnq_A          451 VVQFNS  456 (467)
T ss_dssp             EEEECH
T ss_pred             EEEeCc
Confidence            999974



>3qn1_B Protein phosphatase 2C 16; start domain, BET V domain, PYR/PYL/RCAR, PP2C, abscisic ACI receptor, type 2C protein phosphatase; HET: A8S; 1.80A {Arabidopsis thaliana} PDB: 3zvu_B* 3ujg_B 3nmt_B* 4ds8_B* 3rt0_A 3kb3_B* Back     alignment and structure
>2p8e_A PPM1B beta isoform variant 6; structural genomics, hydrolase, PSI-2, protein structure initiative; 1.82A {Homo sapiens} Back     alignment and structure
>3kdj_B Protein phosphatase 2C 56; ABA, PYL1, abscisic acid signaling pathway, cell membr hydrolase, magnesium, manganese, metal-binding, nucleus; HET: A8S; 1.88A {Arabidopsis thaliana} PDB: 3nmn_B* 3jrq_A* 3ujk_A 3nmv_B 3ujl_B* Back     alignment and structure
>1a6q_A Phosphatase 2C; catalytic mechanism, metalloenzyme, transductuin, hydrolase; 2.00A {Homo sapiens} SCOP: a.159.1.1 d.219.1.1 PDB: 3fxk_A 3fxj_A 3fxl_A* 3fxm_A* 3fxo_A Back     alignment and structure
>2i0o_A Ser/Thr phosphatase; beta sandwich, structural genomics, PSI, protei structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Anopheles gambiae} Back     alignment and structure
>2iq1_A Protein phosphatase 2C kappa, PPM1K; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Homo sapiens} Back     alignment and structure
>2i44_A Serine-threonine phosphatase 2C; PSI-2, 8817Z, structural genomics, protein structure initiative; 2.04A {Toxoplasma gondii} Back     alignment and structure
>2isn_A NYSGXRC-8828Z, phosphatase; pathogenic strain, praseodymium, sulfate structural genomics, PSI-2, protein structure initiative; 1.90A {Toxoplasma gondii} Back     alignment and structure
>2j4o_A Mitogen-activated protein kinase kinase kinase 7-interacting protein 1; TGF-beta, pseudo-phosphatase, TAK1 binding protein, protein binding; 2.25A {Homo sapiens} PDB: 2pom_A 2pop_A Back     alignment and structure
>3d8k_A PP2C, protein phosphatase 2C; nysgrc, PSI-II, STR genomics, protein structure initiative, NEW YORK structural research consortium, nysgxrc; 2.71A {Toxoplasma gondii} Back     alignment and structure
>2irm_A Mitogen-activated protein kinase kinase kinase 7 interacting protein 1; TAK1-binding protein, TAB1; 3.00A {Anopheles gambiae} Back     alignment and structure
>4da1_A Protein phosphatase 1K, mitochondrial; metal-ION-assisted catalysis, dehydrogenase phosphatase, hydrolase; 2.38A {Homo sapiens} PDB: 3qht_A 1l2n_A Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>2pk0_A Serine/threonine protein phosphatase STP1; SI motif, signaling protein; 2.65A {Streptococcus agalactiae} Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>1txo_A Putative bacterial enzyme; serine/threonine protein phosphatases, PSTP/PPP, structural genomics, PSI, protein structure initiative; 1.95A {Mycobacterium tuberculosis} SCOP: d.219.1.1 PDB: 2cm1_A Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>2j82_A TPPHA, protein serine-threonine phosphatase; PP2C family phosphatase, hydrolase; 1.28A {Synechococcus elongatus} PDB: 2j86_A 2y09_A 2xzv_A Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>2jfr_A Ser-Thr phosphatase MSPP; hydrolase, PPM phosphatase, manganese, phosphate; 0.83A {Mycobacterium smegmatis} PDB: 2jfs_A 2jft_A 2v06_A Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>3rnr_A Stage II sporulation E family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.00A {Thermanaerovibrio acidaminovorans} Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>3t91_A Stage II sporulation protein E; SPOIIE, phosphatase, manganese binding, PP2C PH domain; HET: GL0 MAN; 2.64A {Bacillus subtilis} PDB: 3t9q_A* Back     alignment and structure
>3pu9_A Protein serine/threonine phosphatase; PSI-biology, MCSG, structural genomics; HET: MSE; 1.55A {Sphaerobacter thermophilus} Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>3f79_A Probable two-component response regulator; adaptor, signaling protein; 2.80A {Pseudomonas aeruginosa} PDB: 3es2_A Back     alignment and structure
>3zt9_A Serine phosphatase; hydrolase, signal transduction, protein protein interaction,; HET: PEG; 1.75A {Moorella thermoacetica} Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>3ke6_A Protein RV1364C/MT1410; anti-sigma factor, anti-sigma factor antagonist, phosphatase serine kinase, ATPase, unknown function; 2.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure
>3sg8_A APH(2'')-ID; antibiotic resistance enzyme, transferase, aminoglycoside, phosphorylation, transferase-antibiotic complex; HET: TOY; 1.80A {Enterococcus casseliflavus} PDB: 3sg9_A* 3n4v_A 3n4t_A 3n4u_A 3r81_A* 3r80_A* 3r7z_A* 3r82_A* 3vcq_A* 4dbx_A 4de4_A* 4dfb_A* 4dfu_A* 4dt9_A* 4dt8_A* 4dtb_A* 3sgc_A 4dta_A* 3lzh_A Back     alignment and structure
>3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A Back     alignment and structure
>3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* Back     alignment and structure
>2q83_A YTAA protein; 2635576, structural genomics, joint center for structu genomics, JCSG, protein structure initiative, PSI-2, transf; HET: ADN CIT UNL; 2.50A {Bacillus subtilis} Back     alignment and structure
>2olc_A MTR kinase, methylthioribose kinase; kinase ADP-2HO complex, transferase; HET: CPS ADP; 2.00A {Bacillus subtilis} SCOP: d.144.1.6 PDB: 2pu8_A* 2pui_A* 2pul_A* 2pun_A* 2pup_A* Back     alignment and structure
>2yle_A Protein spire homolog 1; actin-binding protein, actin polymerization; 1.80A {Homo sapiens} PDB: 2ylf_A 3r7g_A 3rbw_A Back     alignment and structure
>2pyw_A Uncharacterized protein; 5-methylthioribose kinase, plant methionine recycling, refol transferase; HET: SR1 ADP; 1.90A {Arabidopsis thaliana} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 934
d1a6qa2295 d.219.1.1 (A:2-296) Protein serine/threonine phosp 2e-25
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 1e-21
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 2e-21
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 6e-20
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 1e-19
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 1e-19
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 6e-19
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 1e-18
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 2e-18
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 8e-18
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 9e-18
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 4e-17
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 7e-17
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 1e-16
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 1e-16
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 1e-16
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 1e-16
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 1e-16
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 2e-16
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 4e-16
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 2e-15
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 3e-15
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 4e-15
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 4e-15
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 9e-15
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 9e-15
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 1e-14
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 9e-14
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 1e-13
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 2e-13
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 4e-13
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 7e-13
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 1e-12
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 4e-12
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 5e-12
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 7e-12
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 8e-12
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 9e-12
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 9e-11
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 1e-10
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 2e-10
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 4e-10
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 9e-10
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 2e-09
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 2e-09
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 2e-09
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 3e-09
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 8e-09
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 2e-08
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 2e-08
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 2e-08
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 3e-08
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 3e-08
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 5e-08
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 7e-08
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 1e-07
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 2e-07
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 2e-07
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 2e-07
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 3e-07
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 3e-07
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 3e-07
d1zara2191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 1e-06
d1txoa_235 d.219.1.1 (A:) putative serine/threonine phosphata 2e-05
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 6e-05
>d1a6qa2 d.219.1.1 (A:2-296) Protein serine/threonine phosphatase 2C, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 295 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: PP2C-like
superfamily: PP2C-like
family: PP2C-like
domain: Protein serine/threonine phosphatase 2C, catalytic domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  105 bits (262), Expect = 2e-25
 Identities = 80/384 (20%), Positives = 127/384 (33%), Gaps = 125/384 (32%)

Query: 70  RCQSAMRQGRRKSQEDRTLCALDLHIPFPGRRGRQEVTVGIVAVFDGHNGAEASELASKL 129
           R   +  QG R   ED     + L                  AV+DGH G++ ++   + 
Sbjct: 22  RYGLSSMQGWRVEMEDAHTAVIGLPSGLES--------WSFFAVYDGHAGSQVAKYCCEH 73

Query: 130 LLEYFALHTYFLLDATYSAVLKKSARRLPNKGERDIVFQVLNWDEKLGRHELKFERFKFS 189
           LL++   +  F                                                 
Sbjct: 74  LLDHITNNQDFKGS---------------------------------------------- 87

Query: 190 LPDIFDDSFHLEILREALLRAIHDIDTAFSKEASRKKL--DSGSTATVVLIAEGQILVAN 247
                  +  +E ++  +     +ID      + +K     SGSTA  VLI+       N
Sbjct: 88  -----AGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFIN 142

Query: 248 IGDSKALLCSEKFQSPAEAKATLLRLYRKRRDNNAISTSQGYNYLKSTVSNGLAHFTVKE 307
            GDS+ LLC                                             +  V  
Sbjct: 143 CGDSRGLLCR--------------------------------------------NRKVHF 158

Query: 308 LTRDHHPDREDERYRVEAAGGYVLQWGGVSRVNGQLAVSRAIGDLSYKSYG--------V 359
            T+DH P    E+ R++ AGG V+      RVNG LAVSRA+GD  YK           V
Sbjct: 159 FTQDHKPSNPLEKERIQNAGGSVMIQ----RVNGSLAVSRALGDFDYKCVHGKGPTEQLV 214

Query: 360 ISVPEVTDWQSLTANDSYLVAASDGVFEKLSLQDVCDVFWEVHTHGTAGPGFPSSCSYSL 419
              PEV D +    +D +++ A DG+++ +  +++CD                      +
Sbjct: 215 SPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLE--------KV 266

Query: 420 ADCLVDTAFEKGSMDNMAAVVVPL 443
            + +VDT   KGS DNM+ +++  
Sbjct: 267 CNEVVDTCLYKGSRDNMSVILICF 290


>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure
>d1txoa_ d.219.1.1 (A:) putative serine/threonine phosphatase pstp/ppp {Mycobacterium tuberculosis [TaxId: 1773]} Length = 235 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query934
d1a6qa2295 Protein serine/threonine phosphatase 2C, catalytic 100.0
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d1s9ja_322 Dual specificity mitogen-activated protein kinase 100.0
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 100.0
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 100.0
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 100.0
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 100.0
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 100.0
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 100.0
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 100.0
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 100.0
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 100.0
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 100.0
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 100.0
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 100.0
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 100.0
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 100.0
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 100.0
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 100.0
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 100.0
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 100.0
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 100.0
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 100.0
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 100.0
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 100.0
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 100.0
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 100.0
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 100.0
d1txoa_235 putative serine/threonine phosphatase pstp/ppp {My 100.0
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 100.0
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 100.0
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 100.0
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 100.0
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 100.0
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 100.0
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 100.0
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 100.0
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 100.0
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 100.0
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 100.0
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 100.0
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 100.0
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 100.0
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 100.0
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 100.0
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 100.0
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 100.0
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 100.0
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 100.0
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 100.0
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 100.0
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 100.0
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 100.0
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.98
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.7
d2ppqa1316 Homoserine kinase ThrB {Agrobacterium tumefaciens 80.18
>d1a6qa2 d.219.1.1 (A:2-296) Protein serine/threonine phosphatase 2C, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: PP2C-like
superfamily: PP2C-like
family: PP2C-like
domain: Protein serine/threonine phosphatase 2C, catalytic domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=9.7e-53  Score=457.56  Aligned_cols=264  Identities=30%  Similarity=0.452  Sum_probs=225.6

Q ss_pred             cceeeeeeeeccCCccccceeeeeccCCCCCCCCCCccceEEEEEEecCCCchHHHHHHHHHHHHHHHHHhhhhhhhHHH
Q 002341           68 TSRCQSAMRQGRRKSQEDRTLCALDLHIPFPGRRGRQEVTVGIVAVFDGHNGAEASELASKLLLEYFALHTYFLLDATYS  147 (934)
Q Consensus        68 ~~~~~~~~~~G~R~~~ED~~~~~~~~~~~~~~~~~~~~~~~~lfgVfDGHgG~~~a~~~s~~L~~~i~~~~~~~~~~~~~  147 (934)
                      .++||++++||+|++|||+|.+..++.        ....++.||||||||||+.||++|+++|+.+|.+++.....    
T Consensus        20 ~~~~g~~s~~G~R~~~ED~~~~~~~~~--------~~~~~~~lf~V~DGhGG~~~s~~~~~~l~~~l~~~~~~~~~----   87 (295)
T d1a6qa2          20 GLRYGLSSMQGWRVEMEDAHTAVIGLP--------SGLESWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFKGS----   87 (295)
T ss_dssp             TEEEEEEEEEETSSSCCEEEEEEEEET--------TTEEEEEEEEEEEEESCSHHHHHHHHHHHHHHHTSHHHHCS----
T ss_pred             ceEEEEEeCccCCCcccCeeEEEcccC--------CCCCceEEEEEEeCCCChHHHHHHHHHHHHHHHHhhhhccc----
Confidence            457999999999999999999887652        12356889999999999999999999999998764321000    


Q ss_pred             HHHHhhhccCCCCCCccchhhcccchhhhccchhhhhhcccCCCcccccchhHHHHHHHHHHHHHHHHHHHHHHhc--cC
Q 002341          148 AVLKKSARRLPNKGERDIVFQVLNWDEKLGRHELKFERFKFSLPDIFDDSFHLEILREALLRAIHDIDTAFSKEAS--RK  225 (934)
Q Consensus       148 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~al~~af~~~d~~i~~~~~--~~  225 (934)
                                                                     ......+.+.++|.+||.++|+.+.....  ..
T Consensus        88 -----------------------------------------------~~~~~~~~~~~al~~a~~~~~~~~~~~~~~~~~  120 (295)
T d1a6qa2          88 -----------------------------------------------AGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHG  120 (295)
T ss_dssp             -----------------------------------------------SSSCCHHHHHHHHHHHHHHHHHHHHHHHHHTTC
T ss_pred             -----------------------------------------------cccchHHHHHHHHHHHHHHHHHHHhhhhhhccC
Confidence                                                           01112356889999999999999876433  34


Q ss_pred             CCCCCceeEeeeeeCCeEEEEEcccceeEEeccCCCChhHHHHHHHHHHhhccCCcccccccccccccccccCCccccee
Q 002341          226 KLDSGSTATVVLIAEGQILVANIGDSKALLCSEKFQSPAEAKATLLRLYRKRRDNNAISTSQGYNYLKSTVSNGLAHFTV  305 (934)
Q Consensus       226 ~~~sGsTa~v~~i~~~~l~vAnvGDSRavl~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~G~~~~~~  305 (934)
                      ...+||||++++|.+++|||||||||||||++.+                                            .+
T Consensus       121 ~~~~GtTa~~~~i~~~~l~vanvGDSR~~l~~~~--------------------------------------------~~  156 (295)
T d1a6qa2         121 ADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNR--------------------------------------------KV  156 (295)
T ss_dssp             CCCCEECEEEEEECSSEEEEEEESSCEEEEEETT--------------------------------------------EE
T ss_pred             cCCCCCeEEEEEeeCCEEEEEecCCCeEEEeecc--------------------------------------------cc
Confidence            4568999999999999999999999999999643                                            78


Q ss_pred             eecCCCCCCCChhHHHHHHHcCCEEEeccCcccccCccceecccCCCCCccCC--------cccCCceeEEeecCCCCeE
Q 002341          306 KELTRDHHPDREDERYRVEAAGGYVLQWGGVSRVNGQLAVSRAIGDLSYKSYG--------VISVPEVTDWQSLTANDSY  377 (934)
Q Consensus       306 ~~Lt~DH~~~~~~E~~RI~~~gg~v~~~~~~~Rv~g~L~~sRa~GD~~~K~~g--------v~a~Pev~~~~~l~~~d~f  377 (934)
                      ++||.||+|.++.|++||+++||.|..    +|++|.|++||||||+.+|..+        |+++|+|..+....++|+|
T Consensus       157 ~~lT~dH~~~~~~E~~Ri~~~gg~v~~----~r~~g~l~~tRa~Gd~~~k~~~~~~~~~~~v~~~Pdi~~~~~~~~~~~f  232 (295)
T d1a6qa2         157 HFFTQDHKPSNPLEKERIQNAGGSVMI----QRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQF  232 (295)
T ss_dssp             EEECCCCCTTSHHHHHHHHHTTCCEET----TEETTTBSCSBCEECGGGSCCTTCCGGGSSSBCCCEEEEEECCTTTEEE
T ss_pred             eeeccccCcccHHHHhhHhhcCCcccc----cccCCceeeeeccCcHHhhhccccCcccccccccccceEEEeeccccee
Confidence            999999999999999999999999986    8999999999999999999643        9999999998755677889


Q ss_pred             EEEEcCCCccccCHHHHHHHHHHHhhcCCCCCCCCCcchHHHHHHHHHHHHhcCCCCCcEEEEEEcCCC
Q 002341          378 LVAASDGVFEKLSLQDVCDVFWEVHTHGTAGPGFPSSCSYSLADCLVDTAFEKGSMDNMAAVVVPLGSI  446 (934)
Q Consensus       378 LVLaSDGLwd~ls~~evv~~v~~~~~~~~~~~~~~~~~~~~~a~~lv~~A~~~gs~DNiT~ivv~l~~~  446 (934)
                      ||||||||||+|+++||+++|.+.+.....        ++.+|+.|++.|+.+|+.||||||||+|++.
T Consensus       233 lvL~SDGl~d~l~~~ei~~~v~~~~~~~~~--------~~~~a~~Lv~~A~~~gs~DNiTvivv~~~~~  293 (295)
T d1a6qa2         233 IILACDGIWDVMGNEELCDFVRSRLEVTDD--------LEKVCNEVVDTCLYKGSRDNMSVILICFPNA  293 (295)
T ss_dssp             EEEECHHHHTTSCHHHHHHHHHHHHTTCCC--------HHHHHHHHHHHHHHTTCCSCEEEEEEECTTS
T ss_pred             EeeecCcccccCCHHHHHHHHHHHhhcCCC--------HHHHHHHHHHHHHhcCCCCCeEEEEEeccCC
Confidence            999999999999999999999887653322        7899999999999999999999999999864



>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1txoa_ d.219.1.1 (A:) putative serine/threonine phosphatase pstp/ppp {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure