Citrus Sinensis ID: 002353

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930--
MADTPSTPDSPTSAGFNSDQLPPNTSQNYSTDDEAAVDPNIIRDEPEEPEDEEEGEDLFNDNFMDDYRRLDEHDQYESLGLDESLEDERDLDQIIADRRAAELELEARDGQMSINPSRKKLPQLLHDQDTDDDSYRPSKRSRADFRPRRSQIDNDAMQSSPRQSRDDVPMTDATDDYPYEDDDGDEAEFEMYRVQGTLREWVTRDEVRRFIAKKFKEFLLTYVSPKSEQGDFEYVRLINEIVSANKCSLEIDYKQFIYIHPNIAIWLADAPQSVLEVMEDVARNVVFNLHPNYKRIHQKIYVRITNLPVYDQIRNIRQIHLNTMIRIGGVVTRRTGVFPQLQQVKYDCNKCGAILGPFFQNSYSEVKVGSCPECQSKGPFTINIEQTIYRNYQKLTLQESPGIVPAGRLPRYKEVILLNDLIDCARPGEEIEVTGIYTNNFDLSLNTKNGFPVFATVVEANHITKKHDLFSAYKLTQEDKEEIEKLAKDPRIGERIIKSIAPSIYGHEDIKTALALSMFGGQEKNVKGKHRLRGDINVLLLGDPGTAKSQFLKYVEKTGQRAVYTTGKGASAVGLTAAVHKDPVTREWTLEGGALVLADRGICLIDEFDKMNDQDRVSIHEAMEQQSISISKAGIVTSLQARCSVIAAANPVGGRYDSSKTFSENVELTDPIISRFDVLCVVKDVVDPVVDEMLAKFVIDSHFKSQPKGVNLDDKSKNESEEDIQVADREIDPEILPQDLLKKYITYAKLNVFPRLHDPDMEKLTHVYAELRRESSHGQGVPIAVRHIESMIRMSEAHARMRLRQHVTQEDVNMAIRVLLDSFISTQKFGVQKALQRSFRKYMTFKKEYNALLLDLLRELVKNALHFEEIISGSRSTSGLSHIDVKVVDLLNRAQELEIYDLHPFFSSAEFSGAGFQLDEARGVIRHRLARQ
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccEEEEEccHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHcccCEEEECcHHHHHHcHHHHHHHHHcHHHHHHHHHHHHHHHHHHccccccccccEEEEEEcccccccccccccccccccEEEEccEEEEccccccCEEEEEEEccccccEECcEEccccccccccccccccccccEEEEEcccEEEEcEEEEEEccccccccccccccEEEEEEcccccccccccEEEEEEEEEccccccccccccccEEEEEEEEEEEEEcccccccccccHHHHHHHHHHHccccHHHHHHHcccccccccHHHHHHHHHHHHcccccccccccccccccEEEEEccccHHHHHHHHHHHHHcccEEEEccccccccccEEEEECccccccEEEEccEEEEEcccEEccccccccccccHHHHHHHHccccEEEEEcccEEEEcHHHHHHHHccccccccccccccccccccccHHHHcccEEEEEcccccHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHcccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEHHHHHHHHHHccccccccccccccccccccCCcccccEEEEEcccc
*******************************************************EDLFNDNFMDDYRRLDEHDQYESLGLDESLEDERDLDQIIADRRAA***************************************************************************************FEM*RVQGTLREWVTRDEVRRFIAKKFKEFLLTYVSPKSEQGDFEYVRLINEIVSANKCSLEIDYKQFIYIHPNIAIWLADAPQSVLEVMEDVARNVVFNLHPNYKRIHQKIYVRITNLPVYDQIRNIRQIHLNTMIRIGGVVTRRTGVFPQLQQVKYDCNKCGAILGPFFQNSYSEVKVGSCPECQSKGPFTINIEQTIYRNYQKLTLQESPGIVPAGRLPRYKEVILLNDLIDCARPGEEIEVTGIYTNNFDLSLNTKNGFPVFATVVEANHITKKHDLFSAYKLTQ**KEEIEKLAKDPRIGERIIKSIAPSIYGHEDIKTALALSMFGGQEKNVKGKHRLRGDINVLLLGDPGTAKSQFLKYVEKTGQRAVYTTGKGASAVGLTAAVHKDPVTREWTLEGGALVLADRGICLIDEFDKMNDQDRVSIHEAMEQQSISISKAGIVTSLQARCSVIAAANPVGGRYDSSKTFSENVELTDPIISRFDVLCVVKDVVDPVVDEMLAKFVIDSHF*****************************PEILPQDLLKKYITYAKLNVFPRLHDPDMEKLTHVYAELR*******GVPIAVRHIESMIRMSEAHARMRLRQHVTQEDVNMAIRVLLDSFISTQKFGVQKALQRSFRKYMTFKKEYNALLLDLLRELVKNALHFEEIISGSRSTSGLSHIDVKVVDLLNRAQELEIYDLHPFFSSAEFSGAGFQLDEARGVIRHRLA**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADTPSTPDSPTSAGFNSDQLPPNTSQNYSTDDEAAVDPNIIRDEPEEPEDEEEGEDLFNDNFMDDYRRLDEHDQYESLGLDESLEDERDLDQIIADRRAAELELEARDGQMSINPSRKKLPQLLHDQDTDDDSYRPSKRSRADFRPRRSQIDNDAMQSSPRQSRDDVPMTDATDDYPYEDDDGDEAEFEMYRVQGTLREWVTRDEVRRFIAKKFKEFLLTYVSPKSEQGDFEYVRLINEIVSANKCSLEIDYKQFIYIHPNIAIWLADAPQSVLEVMEDVARNVVFNLHPNYKRIHQKIYVRITNLPVYDQIRNIRQIHLNTMIRIGGVVTRRTGVFPQLQQVKYDCNKCGAILGPFFQNSYSEVKVGSCPECQSKGPFTINIEQTIYRNYQKLTLQESPGIVPAGRLPRYKEVILLNDLIDCARPGEEIEVTGIYTNNFDLSLNTKNGFPVFATVVEANHITKKHDLFSAYKLTQEDKEEIEKLAKDPRIGERIIKSIAPSIYGHEDIKTALALSMFGGQEKNVKGKHRLRGDINVLLLGDPGTAKSQFLKYVEKTGQRAVYTTGKGASAVGLTAAVHKDPVTREWTLEGGALVLADRGICLIDEFDKMNDQDRVSIHEAMEQQSISISKAGIVTSLQARCSVIAAANPVGGRYDSSKTFSENVELTDPIISRFDVLCVVKDVVDPVVDEMLAKFVIDSHFKSQPKGVNLDDKSKNESEEDIQVADREIDPEILPQDLLKKYITYAKLNVFPRLHDPDMEKLTHVYAELRRESSHGQGVPIAVRHIESMIRMSEAHARMRLRQHVTQEDVNMAIRVLLDSFISTQKFGVQKALQRSFRKYMTFKKEYNALLLDLLRELVKNALHFEEIISGSRSTSGLSHIDVKVVDLLNRAQELEIYDLHPFFSSAEFSGAGFQLDEARGVIRHRLARQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA replication licensing factor mcm2 Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity.probableQ6DIH3
DNA replication licensing factor mcm2 Acts as component of the mcm2-7 complex (mcm complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the mcm2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity (By similarity). Plays an important role in DNA replication.probableP40377
DNA replication licensing factor MCM2 Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity. Required for the entry in S phase and for cell division.probableP97310

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3F9V, chain A
Confidence level:very confident
Coverage over the Query: 210-706,732-825
View the alignment between query and template
View the model in PyMOL
Template: 1HQC, chain A
Confidence level:confident
Coverage over the Query: 502-572,585-653,667-688,739-767,781-829,846-900
View the alignment between query and template
View the model in PyMOL