Citrus Sinensis ID: 002375

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------93

MRGLKFIEKFKSTQVHALNQQDASSGGCNGCANGSKLSNHKRTKFTGSKSNKTKSGSVAQALLPYGLPSTDLLEPSIDPHLKPIHCVKSLADLYRRFETCLESDKSMLFIEQYAYLCGLGDAKLLRRCLRSARQYAGDLHLKVVLSAWLKFERREDELLGSSSMDCCGFILECPKAALISGCDPNSTYDHCKCFEENAKSNLGPIVEKFVCLSLEEDDSVTFCVRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGKLDQAENCYINALDIKHTRAHQGLARVYYLKNELKAAYDEMTKLLEKAQYSASAFEKRSEYSDREMAKNDLNMATQLDPLRTYPYRYRAAVLMDDQKEVEAVEELSKAIAFKPDLQMLHLRAAFYESIGDLTSAIRDSQAALCLDPNHMETLDLYNRARDQASHQQK

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccccccccccccccccccHHHHccccccccccccccccccccccccccccHHHHcccccccccEEEEEcccEEEEHHHHHHcccHHHHHHHccccccccccccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccccccHHHHHHccHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHccccHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccc

**GLK**EKFKSTQVHA********************************************LLPYGLPSTDLLEPSIDPHLKPIHCVKSLADLYRRFETCLESDKSMLFIEQYAYLCGLGDAKLLRRCLRSARQYAGDLHLKVVLSAWLKFERREDELLGSSSMDCCGFILECPKAALISGCDPNSTYDHCKCFEENAKSNLGPIVEKFVCLSLEEDDSVTFCVRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGKLDQAENCYINALDIKHTRAHQGLARVYYLKNELKAAYDEMTKLLEKAQYSASAFEKRSEYSDREMAKNDLNMATQLDPLRTYPYRYRAAVLMDDQKEVEAVEELSKAIAFKPDLQMLHLRAAFYESIGDLTSAIRDSQAALCLDPNHMETLDLYNR**********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MRGLKFIEKFKSTQVHALNQQDASSGGCNGCANGSKLSNHKRTKFTGSKSNKTKSGSVAQALLPYGLPSTDLLEPSIDPHLKPIHCVKSLADLYRRFETCLESDKSMLFIEQYAYLCGLGDAKLLRRCLRSARQYAGDLHLKVVLSAWLKFERREDELLGSSSMDCCGFILECPKAALISGCDPNSTYDHCKCFEENAKSNLGPIVEKFVCLSLEEDDSVTFCVRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGKLDQAENCYINALDIKHTRAHQGLARVYYLxxxxxxxxxxxxxxxxxxxxxASAFEKRSEYSDREMAKNDLNMATQLDPLRTYPYRYRAAVLMDDQKEVEAVEELSKAIAFKPDLQMLHLRAAFYESIGDLTSAIRDSQAALCLDPNHMETLDLYNRARDQASHQQK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Ethylene-overproduction protein 1	Essential regulator of the ethylene pathway, which acts by regulating the stability of 1-aminocyclopropane-1-carboxylate synthase (ACS) enzymes. May act as a substrate-specific adapter that connects ACS enzymes, such as ACS5, to ubiquitin ligase complexes, leading to proteasomal degradation of ACS enzymes.	probable	O65020

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FP2, chain A
Confidence level:very confident
Coverage over the Query: 416-472,496-543,557-607,626-707,748-918
View the alignment between query and template
View the model in PyMOL

Template: 3FP2, chain A
Confidence level:very confident
Coverage over the Query: 484-576,590-707,749-926
View the alignment between query and template
View the model in PyMOL

Template: 4G1T, chain A
Confidence level:very confident
Coverage over the Query: 418-453,507-607,626-721,733-738,756-849,860-894
View the alignment between query and template
View the model in PyMOL

Template: 4G1T, chain A
Confidence level:very confident
Coverage over the Query: 383-455,510-611,630-707,748-861
View the alignment between query and template
View the model in PyMOL

Template: 4EOZ, chain A
Confidence level:very confident
Coverage over the Query: 207-313
View the alignment between query and template
View the model in PyMOL

Template: 4B4T, chain Q
Confidence level:confident
Coverage over the Query: 640-838
View the alignment between query and template
View the model in PyMOL

Template: 3HVE, chain A
Confidence level:confident
Coverage over the Query: 206-363
View the alignment between query and template
View the model in PyMOL