BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 002385
         (929 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1N80|A Chain A, Bacteriophage T4 Baseplate Structural Protein Gp8
 pdb|1N80|B Chain B, Bacteriophage T4 Baseplate Structural Protein Gp8
 pdb|1N80|C Chain C, Bacteriophage T4 Baseplate Structural Protein Gp8
 pdb|1N80|D Chain D, Bacteriophage T4 Baseplate Structural Protein Gp8
 pdb|1N8B|A Chain A, Bacteriophage T4 Baseplate Structural Protein Gp8
 pdb|1N8B|B Chain B, Bacteriophage T4 Baseplate Structural Protein Gp8
 pdb|1N8B|C Chain C, Bacteriophage T4 Baseplate Structural Protein Gp8
 pdb|1N8B|D Chain D, Bacteriophage T4 Baseplate Structural Protein Gp8
 pdb|1PDM|A Chain A, Fitting Of Gp8 Structure Into The Cryoem Reconstruction
          Of The Bacteriophage T4 Baseplate
 pdb|1PDM|B Chain B, Fitting Of Gp8 Structure Into The Cryoem Reconstruction
          Of The Bacteriophage T4 Baseplate
 pdb|1PDM|C Chain C, Fitting Of Gp8 Structure Into The Cryoem Reconstruction
          Of The Bacteriophage T4 Baseplate
 pdb|1PDM|D Chain D, Fitting Of Gp8 Structure Into The Cryoem Reconstruction
          Of The Bacteriophage T4 Baseplate
 pdb|1PDM|E Chain E, Fitting Of Gp8 Structure Into The Cryoem Reconstruction
          Of The Bacteriophage T4 Baseplate
 pdb|1PDM|F Chain F, Fitting Of Gp8 Structure Into The Cryoem Reconstruction
          Of The Bacteriophage T4 Baseplate
 pdb|1PDM|G Chain G, Fitting Of Gp8 Structure Into The Cryoem Reconstruction
          Of The Bacteriophage T4 Baseplate
 pdb|1PDM|H Chain H, Fitting Of Gp8 Structure Into The Cryoem Reconstruction
          Of The Bacteriophage T4 Baseplate
 pdb|1PDM|I Chain I, Fitting Of Gp8 Structure Into The Cryoem Reconstruction
          Of The Bacteriophage T4 Baseplate
 pdb|1PDM|J Chain J, Fitting Of Gp8 Structure Into The Cryoem Reconstruction
          Of The Bacteriophage T4 Baseplate
 pdb|1PDM|K Chain K, Fitting Of Gp8 Structure Into The Cryoem Reconstruction
          Of The Bacteriophage T4 Baseplate
 pdb|1PDM|L Chain L, Fitting Of Gp8 Structure Into The Cryoem Reconstruction
          Of The Bacteriophage T4 Baseplate
 pdb|1TJA|A Chain A, Fitting Of Gp8, Gp9, And Gp11 Into The Cryo-em
          Reconstruction Of The Bacteriophage T4 Contracted Tail
 pdb|1TJA|B Chain B, Fitting Of Gp8, Gp9, And Gp11 Into The Cryo-em
          Reconstruction Of The Bacteriophage T4 Contracted Tail
          Length = 334

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 2/38 (5%)

Query: 22 LNPPSPVDEVINLLDKVEHLLANVEQAPSRSMRDALLP 59
            PP P D V+ + D   H++  V+  P  SM DA++P
Sbjct: 56 FAPPYPTDSVLGVTDMWTHMMGTVKVLP--SMLDAVIP 91


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.308    0.126    0.351 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 25,924,309
Number of Sequences: 62578
Number of extensions: 1031515
Number of successful extensions: 1855
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 1855
Number of HSP's gapped (non-prelim): 4
length of query: 929
length of database: 14,973,337
effective HSP length: 108
effective length of query: 821
effective length of database: 8,214,913
effective search space: 6744443573
effective search space used: 6744443573
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 56 (26.2 bits)