BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 002421
(925 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1N80|A Chain A, Bacteriophage T4 Baseplate Structural Protein Gp8
pdb|1N80|B Chain B, Bacteriophage T4 Baseplate Structural Protein Gp8
pdb|1N80|C Chain C, Bacteriophage T4 Baseplate Structural Protein Gp8
pdb|1N80|D Chain D, Bacteriophage T4 Baseplate Structural Protein Gp8
pdb|1N8B|A Chain A, Bacteriophage T4 Baseplate Structural Protein Gp8
pdb|1N8B|B Chain B, Bacteriophage T4 Baseplate Structural Protein Gp8
pdb|1N8B|C Chain C, Bacteriophage T4 Baseplate Structural Protein Gp8
pdb|1N8B|D Chain D, Bacteriophage T4 Baseplate Structural Protein Gp8
pdb|1PDM|A Chain A, Fitting Of Gp8 Structure Into The Cryoem Reconstruction
Of The Bacteriophage T4 Baseplate
pdb|1PDM|B Chain B, Fitting Of Gp8 Structure Into The Cryoem Reconstruction
Of The Bacteriophage T4 Baseplate
pdb|1PDM|C Chain C, Fitting Of Gp8 Structure Into The Cryoem Reconstruction
Of The Bacteriophage T4 Baseplate
pdb|1PDM|D Chain D, Fitting Of Gp8 Structure Into The Cryoem Reconstruction
Of The Bacteriophage T4 Baseplate
pdb|1PDM|E Chain E, Fitting Of Gp8 Structure Into The Cryoem Reconstruction
Of The Bacteriophage T4 Baseplate
pdb|1PDM|F Chain F, Fitting Of Gp8 Structure Into The Cryoem Reconstruction
Of The Bacteriophage T4 Baseplate
pdb|1PDM|G Chain G, Fitting Of Gp8 Structure Into The Cryoem Reconstruction
Of The Bacteriophage T4 Baseplate
pdb|1PDM|H Chain H, Fitting Of Gp8 Structure Into The Cryoem Reconstruction
Of The Bacteriophage T4 Baseplate
pdb|1PDM|I Chain I, Fitting Of Gp8 Structure Into The Cryoem Reconstruction
Of The Bacteriophage T4 Baseplate
pdb|1PDM|J Chain J, Fitting Of Gp8 Structure Into The Cryoem Reconstruction
Of The Bacteriophage T4 Baseplate
pdb|1PDM|K Chain K, Fitting Of Gp8 Structure Into The Cryoem Reconstruction
Of The Bacteriophage T4 Baseplate
pdb|1PDM|L Chain L, Fitting Of Gp8 Structure Into The Cryoem Reconstruction
Of The Bacteriophage T4 Baseplate
pdb|1TJA|A Chain A, Fitting Of Gp8, Gp9, And Gp11 Into The Cryo-em
Reconstruction Of The Bacteriophage T4 Contracted Tail
pdb|1TJA|B Chain B, Fitting Of Gp8, Gp9, And Gp11 Into The Cryo-em
Reconstruction Of The Bacteriophage T4 Contracted Tail
Length = 334
Score = 32.3 bits (72), Expect = 1.2, Method: Compositional matrix adjust.
Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 2/38 (5%)
Query: 22 LNPPSPVDEVINLLDKVEHLLANVEQAPSRSMRDALLP 59
PP P D V+ + D H++ V+ P SM DA++P
Sbjct: 56 FAPPYPTDSVLGVTDMWTHMMGTVKVLP--SMLDAVIP 91
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.308 0.126 0.349
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 25,740,636
Number of Sequences: 62578
Number of extensions: 1026041
Number of successful extensions: 1922
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 1922
Number of HSP's gapped (non-prelim): 4
length of query: 925
length of database: 14,973,337
effective HSP length: 108
effective length of query: 817
effective length of database: 8,214,913
effective search space: 6711583921
effective search space used: 6711583921
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 56 (26.2 bits)