Citrus Sinensis ID: 002438


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-
MAWVEKDVSNGRERDPVQDNGFLKGPQSLPGTSGSPVAVGSTLKGFEGKDALSYANILRSRNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKLDPQNACAHTHCGILYKDEGRLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVPSLKRMEMLQQQVVSEEPSKFSEPTKIIFAKEGSPGSVMPNGFNQASPSMLNLSNIEENGVQLNQHY
cHHHHHHHHHHHHccccccHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHcHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHccccEEEEccccccccHHHHHHHccHHHHHcccccccccccccccEEEEcccccccccccccccccEEcccccccccccccccccccccccccccEEEEEccccccccHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHcccccccEEEcccccccHHHHHHcccccEEcccccccccHHHHHHHHccccEEEccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccHHHHccccccccc
cHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHcHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEEcccccccHHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHHHHHHcHHHHHHcccHHHHHHHHHHccccEEEEcccccccccccEEEEccccEEEEEEccccccccccEEEEEEccccccHHHHHcHHHHHHcccccEEEccccccccccccccccccccEEEEEccccccccHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHccccHHHEEEccccccHHHHHHHHHHccEEcccccccccccHHHHHHccccEEEcccccHHHHHHHHHHHHccccHHccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcccccccccccccccEcccccccccccccccccccccccccccccccccccccccc
mawvekdvsngrerdpvqdngflkgpqslpgtsgspvavgstlkgfegkdaLSYANILRSRNKFVDALALYEIVLEkdsgnveahIGKGICLqmqnmgrlafdsfseavkldpqnacahthcgilykdegrLVEAAESYHKalsadpsykpAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALkidphyapayynLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERClavspnfeiaKNNMAIALTDlgtkvklegdinQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLgviykdrdnLDKAVECYQMALSikpnfsqslNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQClkidpdsrnagqNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYtswdntkdperplvigyvspdyfthSVSYFIeaplvyhdyqnYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTghtannklgmmacqpapvqvtwigypnttglptidyritdsladppetkQKHVEELIrlpecflcytpspeagpvcptpaltngfitfgsfnnlakitPKVLQVWARILCavpnsrlvvkckpfccdsvrhRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDisldtfpyagttttceslymgvpcvtmagsvhahnVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDlmskspvcdgqnfalglESTYRNMWHryckgdvpslKRMEMLQQQVvseepskfseptkiifakegspgsvmpngfnqaspsmlnlsnieeNGVQLNQHY
mawvekdvsngrerdpvqdngflkgpqslpgtsgSPVAVGSTLKGFEGKDALSYANILRSRNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKLDPQNACAHTHCGILYKDEGRLVEAAESYHKAlsadpsykPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSikpnfsqslNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTswdntkdperPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKadaktirfrekvmkkggiwrdiygiDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCavpnsrlvvKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVPSLKRMEMLQQQVvseepskfsepTKIIFAKEGSPGSVMPNGFNQASPSMLNLSNIEENGVQLNQHY
MAWVEKDVSNGRERDPVQDNGFLKGPQSLPGTSGSPVAVGSTLKGFEGKDALSYANILRSRNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKLDPQNACAHTHCGILYKDEGRLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGkmdaaaemiekaiaaNPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYkvvvysavvkadakTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVPSLKRMEMLQQQVVSEEPSKFSEPTKIIFAKEGSPGSVMPNGFNQASPSMLNLSNIEENGVQLNQHY
******************************************LKGFEGKDALSYANILRSRNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKLDPQNACAHTHCGILYKDEGRLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSL*********HVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVP******************************************************************
MAWVEKDVSNGRERDPVQDNGFLKGPQSLPGTSGSPVAVGSTLKGFEGKDALSYANILRSRNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKLDPQNACAHTHCGILYKDEGRLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVPS*****************************************************************
*************RDPVQDNGFLKGPQSLPGTSGSPVAVGSTLKGFEGKDALSYANILRSRNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKLDPQNACAHTHCGILYKDEGRLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVPSLKRMEMLQ************EPTKIIFAKEGSPGSVMPNGFNQASPSMLNLSNIEENGVQLNQHY
MAWVEKDVSNGRERDPVQDNGFLKGPQSLPGTSGSPVAVGSTLKGFEGKDALSYANILRSRNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKLDPQNACAHTHCGILYKDEGRLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVPSLKRMEMLQQQV******************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAWVEKDVSNGRERDPVQDNGFLKGPQSLPGTSGSPVAVGSTLKGFEGKDALSYANILRSRNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKLDPQNACAHTHCGILYKDEGRLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVPSLKRMEMLQQQVVSEEPSKFSEPTKIIFAKEGSPGSVMPNGFNQASPSMLNLSNIEENGVQLNQHY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query921 2.2.26 [Sep-21-2011]
O82039932 Probable UDP-N-acetylgluc N/A no 0.994 0.982 0.838 0.0
Q96301914 Probable UDP-N-acetylgluc yes no 0.965 0.972 0.837 0.0
Q8RVB2931 Probable UDP-N-acetylgluc N/A no 0.996 0.986 0.822 0.0
Q8LP10918 Probable UDP-N-acetylgluc N/A no 0.946 0.949 0.796 0.0
O82422944 Probable UDP-N-acetylgluc N/A no 0.891 0.869 0.840 0.0
Q6YZI0927 Probable UDP-N-acetylgluc yes no 0.921 0.915 0.806 0.0
Q9M8Y0977 Probable UDP-N-acetylgluc no no 0.800 0.754 0.285 2e-82
Q27HV01046 UDP-N-acetylglucosamine-- yes no 0.615 0.542 0.261 1e-55
Q8CGY81046 UDP-N-acetylglucosamine-- yes no 0.615 0.542 0.261 1e-55
P565581036 UDP-N-acetylglucosamine-- yes no 0.615 0.547 0.261 1e-55
>sp|O82039|SPY_PETHY Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Petunia hybrida GN=SPY PE=2 SV=1 Back     alignment and function desciption
 Score = 1634 bits (4232), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 777/927 (83%), Positives = 840/927 (90%), Gaps = 11/927 (1%)

Query: 1   MAWVEKDVSNGRERDPVQDNGFLKGPQSLPGTSGSPVAVGSTLKGFEGKDALSYANILRS 60
           MAW EKDV NG+E D + +NGFLKG QS   + GSPV +    K FEGKDA++YANILRS
Sbjct: 1   MAWTEKDVENGKESDSLGNNGFLKGVQSSSDSKGSPVRISPVKKSFEGKDAITYANILRS 60

Query: 61  RNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKLDPQNACAHT 120
           RNKFVDALA+YE VL+KDSG++E+ IGKGICLQMQNMGRLAF+SF+EA+KLDPQNACA T
Sbjct: 61  RNKFVDALAIYESVLQKDSGSIESLIGKGICLQMQNMGRLAFESFAEAIKLDPQNACALT 120

Query: 121 HCGILYKDEGRLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKY 180
           HCGILYKDEGRLVEAAESY KAL ADPSYKPAAECLAIVLTD+GTSLKLAGN+Q+GIQKY
Sbjct: 121 HCGILYKDEGRLVEAAESYQKALKADPSYKPAAECLAIVLTDIGTSLKLAGNSQEGIQKY 180

Query: 181 YEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGD 240
           YEA+KID HYAPAYYNLGVVYSE+MQYD AL CYEKAA+ERPMYAEAYCNMGVIYKNRGD
Sbjct: 181 YEAIKIDSHYAPAYYNLGVVYSEMMQYDMALNCYEKAAIERPMYAEAYCNMGVIYKNRGD 240

Query: 241 LESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYA 300
           LESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYA
Sbjct: 241 LESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYA 300

Query: 301 DAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMA 360
           DAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMA
Sbjct: 301 DAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMA 360

Query: 361 LSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISL 420
           L+IKPNFSQSLNNLGVVYTVQGKMDAAA MIEKAI ANPTYAEAYNNLGVLYRDAG+ISL
Sbjct: 361 LTIKPNFSQSLNNLGVVYTVQGKMDAAASMIEKAIIANPTYAEAYNNLGVLYRDAGNISL 420

Query: 421 AIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDN 480
           AI+AYEQCLKIDPDSRNAGQNRLLAMNYINEG DDKL+EAHRDWG RFMRLY QY SWDN
Sbjct: 421 AIEAYEQCLKIDPDSRNAGQNRLLAMNYINEGSDDKLYEAHRDWGWRFMRLYQQYNSWDN 480

Query: 481 TKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKV 540
           +KDPER LVIGYVSPDYFTHSVSYFIEAPL YHDY NYKVV+YSAVVKADAKT RFR+KV
Sbjct: 481 SKDPERQLVIGYVSPDYFTHSVSYFIEAPLAYHDYANYKVVIYSAVVKADAKTNRFRDKV 540

Query: 541 MKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYP 600
           +KKGG+WRDIYGIDEKKV++M+REDK+DI++ELTGHTANNKLGMMAC+PAPVQVTWIGYP
Sbjct: 541 LKKGGVWRDIYGIDEKKVSSMIREDKVDIMIELTGHTANNKLGMMACRPAPVQVTWIGYP 600

Query: 601 NTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFI 660
           NTTGLPTIDYRITDS+ADPP TKQKHVEEL+RLP+ FLCYTPSPEAGPV P PALTNGF+
Sbjct: 601 NTTGLPTIDYRITDSMADPPSTKQKHVEELVRLPDSFLCYTPSPEAGPVSPAPALTNGFV 660

Query: 661 TFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLR 720
           TFGSFNNLAKITPKVLQVWARILCAVP+SRL+VKCKPF CDSVR RFLS LEQLGLE  R
Sbjct: 661 TFGSFNNLAKITPKVLQVWARILCAVPHSRLIVKCKPFGCDSVRQRFLSILEQLGLEPQR 720

Query: 721 VDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVS 780
           VDL+PLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTM GSVHAHNVGVS
Sbjct: 721 VDLVPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMGGSVHAHNVGVS 780

Query: 781 LLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLES 840
           LL  VGL+ L+A+NEDEYV+LA+QLASDVT+L+NLRMSLR+LM+KSP+CDG  F   LES
Sbjct: 781 LLKTVGLRKLVARNEDEYVELAIQLASDVTSLSNLRMSLRELMAKSPLCDGAQFTQNLES 840

Query: 841 TYRNMWHRYCKGDVPSLKRME-------MLQQQVVSEE-PSKFSEPTKIIFAKEGSPGSV 892
           TYR+MW RYC GDVPSL+RME        L + VV EE P    E T+I  +K+   G +
Sbjct: 841 TYRSMWRRYCDGDVPSLRRMELLQQQQQTLAELVVPEESPVSPIEKTRISASKD---GPI 897

Query: 893 MPNGFNQASPSMLNLSNIEENGVQLNQ 919
             NGF  +   + N S IEENGVQLNQ
Sbjct: 898 KENGFTVSPALVYNSSTIEENGVQLNQ 924




Probable O-linked N-acetylglucosamine transferase (OGT) involved in various processes such as gibberellin (GA) signaling pathway. OGTs catalyze the addition of nucleotide-activated sugars directly onto the polypeptide through O-glycosidic linkage with the hydroxyl of serine or threonine. Probably acts by adding O-linked sugars to yet unknown proteins.
Petunia hybrida (taxid: 4102)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: -
>sp|Q96301|SPY_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Arabidopsis thaliana GN=SPY PE=1 SV=1 Back     alignment and function description
>sp|Q8RVB2|SPY_SOLLC Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Solanum lycopersicum GN=SPY PE=2 SV=1 Back     alignment and function description
>sp|Q8LP10|SPY_EUSER Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Eustoma exaltatum subsp. russellianum GN=SPY PE=2 SV=1 Back     alignment and function description
>sp|O82422|SPY_HORVU Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Hordeum vulgare GN=SPY PE=2 SV=1 Back     alignment and function description
>sp|Q6YZI0|SPY_ORYSJ Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Oryza sativa subsp. japonica GN=SPY PE=3 SV=1 Back     alignment and function description
>sp|Q9M8Y0|SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana GN=SEC PE=2 SV=1 Back     alignment and function description
>sp|Q27HV0|OGT1_PIG UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa GN=OGT PE=2 SV=1 Back     alignment and function description
>sp|Q8CGY8|OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus GN=Ogt PE=1 SV=2 Back     alignment and function description
>sp|P56558|OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus GN=Ogt PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query921
255579381930 o-linked n-acetylglucosamine transferase 0.996 0.987 0.874 0.0
225440809914 PREDICTED: probable UDP-N-acetylglucosam 0.991 0.998 0.872 0.0
224088480934 predicted protein [Populus trichocarpa] 0.995 0.981 0.850 0.0
224140075917 predicted protein [Populus trichocarpa] 0.978 0.982 0.868 0.0
356500631928 PREDICTED: probable UDP-N-acetylglucosam 0.994 0.987 0.856 0.0
256772634916 putative SPINDLY protein [Rosa lucieae] 0.990 0.995 0.857 0.0
75318818932 RecName: Full=Probable UDP-N-acetylgluco 0.994 0.982 0.838 0.0
356534448929 PREDICTED: probable UDP-N-acetylglucosam 0.994 0.986 0.841 0.0
356505394919 PREDICTED: probable UDP-N-acetylglucosam 0.969 0.971 0.835 0.0
449526080925 PREDICTED: probable UDP-N-acetylglucosam 0.990 0.985 0.844 0.0
>gi|255579381|ref|XP_002530535.1| o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus communis] gi|223529939|gb|EEF31867.1| o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1683 bits (4358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 807/923 (87%), Positives = 857/923 (92%), Gaps = 5/923 (0%)

Query: 1   MAWVEKDVSNGRERDPVQDNGFLKGPQS-LPGTSGSPVAVGSTLKGFEGKDALSYANILR 59
           MAW EK+  NG+E  P++DNGFLKG Q   P  SGSPVAV + LKG E KD+LSYANILR
Sbjct: 1   MAWTEKNNGNGKEGGPIEDNGFLKGTQEPSPSASGSPVAVAAGLKGIEEKDSLSYANILR 60

Query: 60  SRNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKLDPQNACAH 119
           SRNKFVDALA+YE VLEKDSGNVEA+IGKGICLQMQNMGRLAFDSF+EA+KLDPQNACA 
Sbjct: 61  SRNKFVDALAIYESVLEKDSGNVEAYIGKGICLQMQNMGRLAFDSFAEAIKLDPQNACAL 120

Query: 120 THCGILYKDEGRLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQK 179
           THCGILYK+EGRLVEAAESY KAL ADP YKPAAECL+IVLTDLGTSLKL+GNTQ+GIQK
Sbjct: 121 THCGILYKEEGRLVEAAESYQKALRADPLYKPAAECLSIVLTDLGTSLKLSGNTQEGIQK 180

Query: 180 YYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRG 239
           YYEALKIDPHYAPAYYNLGVVYSE+MQYDTAL CYEKAALERPMYAEAYCNMGVIYKNRG
Sbjct: 181 YYEALKIDPHYAPAYYNLGVVYSEMMQYDTALNCYEKAALERPMYAEAYCNMGVIYKNRG 240

Query: 240 DLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHY 299
           DLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQG+AYYKKALYYNWHY
Sbjct: 241 DLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGIAYYKKALYYNWHY 300

Query: 300 ADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQM 359
           ADAMYNLGVAYGEMLKFD AIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQ 
Sbjct: 301 ADAMYNLGVAYGEMLKFDNAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQT 360

Query: 360 ALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSIS 419
           ALSIKPNFSQSLNNLGVVYTVQGKMDAAA MIEKAI ANPTYAEAYNNLGVLYRDAG+I 
Sbjct: 361 ALSIKPNFSQSLNNLGVVYTVQGKMDAAASMIEKAIMANPTYAEAYNNLGVLYRDAGNIP 420

Query: 420 LAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWD 479
           +AI+AYEQCLKIDPDSRNAGQNRLLAMNYINEGHD+KLFEAHRDWG+RFMRLY QYT WD
Sbjct: 421 MAINAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDEKLFEAHRDWGRRFMRLYPQYTMWD 480

Query: 480 NTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREK 539
           N KD +RPLVIGYVSPDYFTHSVSYFIEAPLVYHDY NYKVVVYSAVVKADAKTIRFREK
Sbjct: 481 NPKDLDRPLVIGYVSPDYFTHSVSYFIEAPLVYHDYANYKVVVYSAVVKADAKTIRFREK 540

Query: 540 VMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGY 599
           V+K+GGIWRDIYGIDEKKVA+MVRED +DILVELTGHTANNKLGMMAC+PAP+QVTWIGY
Sbjct: 541 VLKQGGIWRDIYGIDEKKVASMVREDNVDILVELTGHTANNKLGMMACRPAPIQVTWIGY 600

Query: 600 PNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGF 659
           PNTTGLPTIDYRITDSLADP +TKQKHVEEL+RLP+CFLCYTPSPEAGPVCPTPAL NGF
Sbjct: 601 PNTTGLPTIDYRITDSLADPRDTKQKHVEELVRLPDCFLCYTPSPEAGPVCPTPALANGF 660

Query: 660 ITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESL 719
           ITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVR RFL+ LE+LGLESL
Sbjct: 661 ITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRQRFLTMLEELGLESL 720

Query: 720 RVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGV 779
           RVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAG++HAHNVGV
Sbjct: 721 RVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGAIHAHNVGV 780

Query: 780 SLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLE 839
           SLL+KVGL HL+A+NED YVQLALQLASD+ AL+NLRMSLRDLMSKSPVCDG  F LGLE
Sbjct: 781 SLLSKVGLGHLVAQNEDNYVQLALQLASDIPALSNLRMSLRDLMSKSPVCDGSKFTLGLE 840

Query: 840 STYRNMWHRYCKGDVPSLKRMEMLQQQVVSEE-PSKFSEPTKIIFAKEGSPGSVMPNGFN 898
           S+YR+MWHRYCKGDVPSLKRME+L+QQ  SE  P++  EPT+  F  EG P SV  NG+N
Sbjct: 841 SSYRDMWHRYCKGDVPSLKRMELLKQQKGSEAVPNENFEPTRNAFPVEGPPESVKLNGYN 900

Query: 899 QASPSMLNLSNIEEN--GVQLNQ 919
             S S+LN S+ EEN    QLN 
Sbjct: 901 IVSSSILNRSS-EENVSQTQLNH 922




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225440809|ref|XP_002281883.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY [Vitis vinifera] gi|297740152|emb|CBI30334.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224088480|ref|XP_002308458.1| predicted protein [Populus trichocarpa] gi|222854434|gb|EEE91981.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224140075|ref|XP_002323412.1| predicted protein [Populus trichocarpa] gi|222868042|gb|EEF05173.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356500631|ref|XP_003519135.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY-like [Glycine max] gi|401721241|gb|AFP99901.1| putative UDP-N-acetylglucosamin [Glycine max] Back     alignment and taxonomy information
>gi|256772634|emb|CAX46402.1| putative SPINDLY protein [Rosa lucieae] Back     alignment and taxonomy information
>gi|75318818|sp|O82039.1|SPY_PETHY RecName: Full=Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY; AltName: Full=PhSPY gi|3319682|emb|CAA76834.1| SPINDLY protein [Petunia x hybrida] Back     alignment and taxonomy information
>gi|356534448|ref|XP_003535766.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY-like [Glycine max] Back     alignment and taxonomy information
>gi|356505394|ref|XP_003521476.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY-like [Glycine max] Back     alignment and taxonomy information
>gi|449526080|ref|XP_004170042.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query921
TAIR|locus:2080722914 SPY "SPINDLY" [Arabidopsis tha 0.973 0.981 0.802 0.0
UNIPROTKB|Q749Z1585 GSU2601 "TPR domain/SEC-C moti 0.595 0.936 0.382 4.2e-102
TIGR_CMR|GSU_2601585 GSU_2601 "TPR domain/SEC-C mot 0.595 0.936 0.382 4.2e-102
UNIPROTKB|Q608I2699 MCA1509 "TPR domain protein" [ 0.668 0.881 0.319 3e-78
TAIR|locus:2103025977 SEC "secret agent" [Arabidopsi 0.391 0.369 0.286 5.3e-73
WB|WBGene00003858 1151 ogt-1 [Caenorhabditis elegans 0.426 0.341 0.271 1.8e-67
UNIPROTKB|O18158 1151 ogt-1 "UDP-N-acetylglucosamine 0.426 0.341 0.271 1.8e-67
UNIPROTKB|A5D7G11036 OGT "OGT protein" [Bos taurus 0.563 0.500 0.263 1.4e-66
UNIPROTKB|F1RSV21046 OGT "UDP-N-acetylglucosamine-- 0.563 0.496 0.263 1.5e-66
UNIPROTKB|P814361046 OGT "UDP-N-acetylglucosamine-- 0.563 0.496 0.263 1.5e-66
TAIR|locus:2080722 SPY "SPINDLY" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3861 (1364.2 bits), Expect = 0., P = 0.
 Identities = 728/907 (80%), Positives = 793/907 (87%)

Query:     1 MAWVEKDVSNGRERDPVQDNGFLKGPQSLPGTSGSPVAVGSTLKGFEGKDALSYANILRS 60
             M  +E D    RER PV +NGF  G +S   ++G    +  + K  +G D LSYANILR+
Sbjct:     1 MVGLEDDTE--RERSPVVENGFSNGSRSSSSSAG---VLSPSRKVTQGNDTLSYANILRA 55

Query:    61 RNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKLDPQNACAHT 120
             RNKF DALALYE +LEKDS NVEAHIGKGICLQ QN G LAFD FSEA++LDP NACA T
Sbjct:    56 RNKFADALALYEAMLEKDSKNVEAHIGKGICLQTQNKGNLAFDCFSEAIRLDPHNACALT 115

Query:   121 HCGILYKDEGRLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKY 180
             HCGIL+K+EGRLVEAAESY KAL AD SYKPAAECLAIVLTDLGTSLKLAGNTQ+GIQKY
Sbjct:   116 HCGILHKEEGRLVEAAESYQKALMADASYKPAAECLAIVLTDLGTSLKLAGNTQEGIQKY 175

Query:   181 YEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGD 240
             YEALKIDPHYAPAYYNLGVVYSE+MQYD AL CYEKAALERPMYAEAYCNMGVIYKNRGD
Sbjct:   176 YEALKIDPHYAPAYYNLGVVYSEMMQYDNALSCYEKAALERPMYAEAYCNMGVIYKNRGD 235

Query:   241 LESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYA 300
             LE AI CYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGD+ QGVAYYKKALYYNWHYA
Sbjct:   236 LEMAITCYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDVTQGVAYYKKALYYNWHYA 295

Query:   301 DAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMA 360
             DAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGV+YKDRDNLDKAVECYQMA
Sbjct:   296 DAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVLYKDRDNLDKAVECYQMA 355

Query:   361 LSIKPNFSQSLNNLGVVYTVQGXXXXXXXXXXXXXXXNPTYAEAYNNLGVLYRDAGSISL 420
             LSIKPNF+QSLNNLGVVYTVQG               NPTYAEA+NNLGVLYRDAG+I++
Sbjct:   356 LSIKPNFAQSLNNLGVVYTVQGKMDAAASMIEKAILANPTYAEAFNNLGVLYRDAGNITM 415

Query:   421 AIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDN 480
             AIDAYE+CLKIDPDSRNAGQNRLLAMNYINEG DDKLFEAHRDWG RF RL+ QYTSWDN
Sbjct:   416 AIDAYEECLKIDPDSRNAGQNRLLAMNYINEGLDDKLFEAHRDWGWRFTRLHPQYTSWDN 475

Query:   481 TKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYXXXXXXXXXXXXXXTIRFREKV 540
              KDPERP+ IGY+SPD+FTHSVSYFIEAPL +HDY  Y              T RFR+KV
Sbjct:   476 LKDPERPITIGYISPDFFTHSVSYFIEAPLTHHDYTKYKVVVYSAVVKADAKTYRFRDKV 535

Query:   541 MKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYP 600
             +KKGG+W+DIYGIDEKK+A+MVREDKIDILVELTGHTANNKLG MAC+PAPVQVTWIGYP
Sbjct:   536 LKKGGVWKDIYGIDEKKIASMVREDKIDILVELTGHTANNKLGTMACRPAPVQVTWIGYP 595

Query:   601 NTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFI 660
             NTTGLPT+DYRITDSLADPP+TKQK VEEL+RLP+CFLCYTPSPEAGPVCPTPAL+NGF+
Sbjct:   596 NTTGLPTVDYRITDSLADPPDTKQKQVEELVRLPDCFLCYTPSPEAGPVCPTPALSNGFV 655

Query:   661 TFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLR 720
             TFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDS+R RFL+TLEQLGLES R
Sbjct:   656 TFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSIRQRFLTTLEQLGLESKR 715

Query:   721 VDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVS 780
             VDLLPLIL NHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVS
Sbjct:   716 VDLLPLILFNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVS 775

Query:   781 LLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLES 840
             LLTKVGL HL+AKNEDEYVQL++ LASDVTAL+ LRMSLRDLM+ SPVC+G +FA+GLES
Sbjct:   776 LLTKVGLGHLVAKNEDEYVQLSVDLASDVTALSKLRMSLRDLMAGSPVCNGPSFAVGLES 835

Query:   841 TYRNMWHRYCKGDVPSLKRMEMLQQQVVSEEP--SKFSEPTKIIFAKEGSPGSVMPNGFN 898
              YRNMW +YCKG+VPSL+RMEMLQ++V  ++P  SK   P+++    E +P S+  NG +
Sbjct:   836 AYRNMWKKYCKGEVPSLRRMEMLQKEV-HDDPLISKDLGPSRVSVTGEATP-SLKANG-S 892

Query:   899 QASPSML 905
                PS L
Sbjct:   893 APVPSSL 899




GO:0005634 "nucleus" evidence=ISM;IDA;TAS
GO:0016757 "transferase activity, transferring glycosyl groups" evidence=ISS
GO:0016262 "protein N-acetylglucosaminyltransferase activity" evidence=TAS
GO:0009938 "negative regulation of gibberellic acid mediated signaling pathway" evidence=IGI
GO:0005737 "cytoplasm" evidence=IDA
GO:0009740 "gibberellic acid mediated signaling pathway" evidence=TAS
GO:0005515 "protein binding" evidence=IPI
GO:0009736 "cytokinin mediated signaling pathway" evidence=IMP
GO:0005829 "cytosol" evidence=IDA
GO:2000377 "regulation of reactive oxygen species metabolic process" evidence=IMP
GO:0000278 "mitotic cell cycle" evidence=RCA
GO:0000956 "nuclear-transcribed mRNA catabolic process" evidence=RCA
GO:0006346 "methylation-dependent chromatin silencing" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA
GO:0006396 "RNA processing" evidence=RCA
GO:0016246 "RNA interference" evidence=RCA
GO:0043687 "post-translational protein modification" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
UNIPROTKB|Q749Z1 GSU2601 "TPR domain/SEC-C motif domain protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2601 GSU_2601 "TPR domain/SEC-C motif domain protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|Q608I2 MCA1509 "TPR domain protein" [Methylococcus capsulatus str. Bath (taxid:243233)] Back     alignment and assigned GO terms
TAIR|locus:2103025 SEC "secret agent" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
WB|WBGene00003858 ogt-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|O18158 ogt-1 "UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|A5D7G1 OGT "OGT protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RSV2 OGT "UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P81436 OGT "UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O82422SPY_HORVU2, ., 4, ., 1, ., -0.84040.89140.8697N/Ano
O82039SPY_PETHY2, ., 4, ., 1, ., -0.83810.99450.9828N/Ano
Q8LP10SPY_EUSER2, ., 4, ., 1, ., -0.79670.94670.9498N/Ano
Q96301SPY_ARATH2, ., 4, ., 1, ., -0.83740.96520.9726yesno
Q6YZI0SPY_ORYSJ2, ., 4, ., 1, ., -0.80640.92180.9158yesno
Q8RVB2SPY_SOLLC2, ., 4, ., 1, ., -0.82280.99670.9860N/Ano

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query921
COG3914620 COG3914, Spy, Predicted O-linked N-acetylglucosami 4e-94
pfam13844468 pfam13844, Glyco_transf_41, Glycosyl transferase f 1e-23
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 5e-23
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 6e-23
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 1e-22
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 1e-21
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 9e-21
pfam13844468 pfam13844, Glyco_transf_41, Glycosyl transferase f 2e-20
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 5e-20
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 7e-20
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 1e-18
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 3e-18
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 7e-17
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 4e-16
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-14
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 2e-14
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 3e-14
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 4e-14
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 5e-14
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 1e-11
pfam1341469 pfam13414, TPR_11, TPR repeat 1e-11
pfam1341469 pfam13414, TPR_11, TPR repeat 2e-11
pfam1341469 pfam13414, TPR_11, TPR repeat 4e-11
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 2e-10
COG3063250 COG3063, PilF, Tfp pilus assembly protein PilF [Ce 2e-10
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 3e-10
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 3e-10
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 4e-10
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 2e-09
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 2e-09
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 2e-09
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 4e-09
PRK02603172 PRK02603, PRK02603, photosystem I assembly protein 7e-09
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 1e-08
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-08
pfam1341469 pfam13414, TPR_11, TPR repeat 3e-08
pfam1341469 pfam13414, TPR_11, TPR repeat 4e-08
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 5e-08
pfam1341469 pfam13414, TPR_11, TPR repeat 2e-07
PRK02603172 PRK02603, PRK02603, photosystem I assembly protein 2e-07
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 4e-07
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 4e-07
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 4e-07
COG3063250 COG3063, PilF, Tfp pilus assembly protein PilF [Ce 5e-07
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 7e-07
CHL00033168 CHL00033, ycf3, photosystem I assembly protein Ycf 9e-07
smart0002834 smart00028, TPR, Tetratricopeptide repeats 1e-06
smart0002834 smart00028, TPR, Tetratricopeptide repeats 1e-06
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 2e-06
COG3063250 COG3063, PilF, Tfp pilus assembly protein PilF [Ce 4e-06
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 4e-06
PRK12370553 PRK12370, PRK12370, invasion protein regulator; Pr 5e-06
COG5010257 COG5010, TadD, Flp pilus assembly protein TadD, co 9e-06
smart0002834 smart00028, TPR, Tetratricopeptide repeats 1e-05
COG5010257 COG5010, TadD, Flp pilus assembly protein TadD, co 1e-05
TIGR00990615 TIGR00990, 3a0801s09, mitochondrial precursor prot 1e-05
COG4785297 COG4785, NlpI, Lipoprotein NlpI, contains TPR repe 1e-05
COG0790292 COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily 1e-05
COG3063250 COG3063, PilF, Tfp pilus assembly protein PilF [Ce 2e-05
COG3063250 COG3063, PilF, Tfp pilus assembly protein PilF [Ce 3e-05
pfam1318134 pfam13181, TPR_8, Tetratricopeptide repeat 3e-05
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 4e-05
pfam1341469 pfam13414, TPR_11, TPR repeat 7e-05
pfam0771934 pfam07719, TPR_2, Tetratricopeptide repeat 8e-05
COG4976287 COG4976, COG4976, Predicted methyltransferase (con 8e-05
TIGR00990615 TIGR00990, 3a0801s09, mitochondrial precursor prot 9e-05
pfam1343134 pfam13431, TPR_17, Tetratricopeptide repeat 9e-05
pfam1341469 pfam13414, TPR_11, TPR repeat 1e-04
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 1e-04
pfam1318134 pfam13181, TPR_8, Tetratricopeptide repeat 1e-04
TIGR03939 800 TIGR03939, PGA_TPR_OMP, poly-beta-1,6 N-acetyl-D-g 1e-04
PRK02603172 PRK02603, PRK02603, photosystem I assembly protein 2e-04
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 2e-04
COG5010257 COG5010, TadD, Flp pilus assembly protein TadD, co 2e-04
COG2956389 COG2956, COG2956, Predicted N-acetylglucosaminyl t 2e-04
PRK11189296 PRK11189, PRK11189, lipoprotein NlpI; Provisional 2e-04
pfam0771934 pfam07719, TPR_2, Tetratricopeptide repeat 3e-04
pfam1343134 pfam13431, TPR_17, Tetratricopeptide repeat 3e-04
COG2956389 COG2956, COG2956, Predicted N-acetylglucosaminyl t 3e-04
COG3063250 COG3063, PilF, Tfp pilus assembly protein PilF [Ce 4e-04
pfam10373276 pfam10373, EST1_DNA_bind, Est1 DNA/RNA binding dom 4e-04
COG4785297 COG4785, NlpI, Lipoprotein NlpI, contains TPR repe 5e-04
pfam0771934 pfam07719, TPR_2, Tetratricopeptide repeat 5e-04
pfam1341469 pfam13414, TPR_11, TPR repeat 6e-04
pfam1341469 pfam13414, TPR_11, TPR repeat 6e-04
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 0.001
CHL00033168 CHL00033, ycf3, photosystem I assembly protein Ycf 0.001
pfam1318134 pfam13181, TPR_8, Tetratricopeptide repeat 0.001
PRK11447 1157 PRK11447, PRK11447, cellulose synthase subunit Bcs 0.001
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 0.002
smart0002834 smart00028, TPR, Tetratricopeptide repeats 0.002
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 0.002
COG4783484 COG4783, COG4783, Putative Zn-dependent protease, 0.003
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 0.004
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 0.004
COG4235287 COG4235, COG4235, Cytochrome c biogenesis factor [ 0.004
>gnl|CDD|226428 COG3914, Spy, Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
 Score =  309 bits (793), Expect = 4e-94
 Identities = 166/562 (29%), Positives = 248/562 (44%), Gaps = 56/562 (9%)

Query: 317 DMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECY-QMALSIKPNFSQSLNNLG 375
            +A +   +    NP    A  NL    +       A+    ++A  + P+ ++ L +L 
Sbjct: 84  TLAFLAKRIPLSVNPENCPAVQNLAAALELDGLQFLALADISEIAEWLSPDNAEFLGHLI 143

Query: 376 VVYTVQ------GKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISL--------- 420
             Y +       G+   A   +E+A+   P Y      L    ++  S            
Sbjct: 144 RFYQLGRYLKLLGRTAEAELALERAVDLLPKYPRVLGALMTARQEQCSWPEEAPTNLLSQ 203

Query: 421 ------AIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQ 474
                         L  DP    A  N+LL +   N     +                  
Sbjct: 204 LALFLGIYGFSLAYLADDPLKNLAIANQLLKILSQNAPELVR------------------ 245

Query: 475 YTSWDNTKDPE-RPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYS-AVVKADAK 532
           +   D       + L +GY+S D  +H+V + +     YHD   ++V  YS      DA 
Sbjct: 246 FPIRDENIKRNGKRLRVGYLSSDLRSHAVGFLLRWVFEYHDRDKFEVFAYSLGPPHTDAL 305

Query: 533 TIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPV 592
             R    V K    W  I  +D+ ++A  +R D IDILV+L GHT + +  + A +PAP+
Sbjct: 306 QERISAAVEK----WYPIGRMDDAEIANAIRTDGIDILVDLDGHTVDTRCQVFAHRPAPI 361

Query: 593 QVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPT 652
           QV+W+GYP TTG P +DY I+D    PP  ++ + E+L RLP    CY P     PV P 
Sbjct: 362 QVSWLGYPATTGSPNMDYFISDPYTVPPTAEEYYSEKLWRLP---QCYQPVDGFEPVTPP 418

Query: 653 PA-----LTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRF 707
           P+     L    + F  FNN  KITP+V  +W +IL AVPNS L++K        +  R 
Sbjct: 419 PSRAQLGLPEDAVVFCCFNNYFKITPEVFALWMQILSAVPNSVLLLKAGG-DDAEINARL 477

Query: 708 LSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVT 767
               E+ G++S R+  LP    N DH   Y + D+ LDT+PY G TT  ++L+MGVP +T
Sbjct: 478 RDLAEREGVDSERLRFLP-PAPNEDHRARYGIADLVLDTYPYGGHTTASDALWMGVPVLT 536

Query: 768 MAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSP 827
             G   A   G S+ T  G+  L+A +  +YV+ A+   SD      +R  L+     SP
Sbjct: 537 RVGEQFASRNGASIATNAGIPELVADSRADYVEKAVAFGSDRALRQQVRAELKRSRQTSP 596

Query: 828 VCDGQNFALGLESTYRNMWHRY 849
           + D + FA  LE+ Y  MW  Y
Sbjct: 597 LFDPKAFARKLETLYWGMWSEY 618


Length = 620

>gnl|CDD|206015 pfam13844, Glyco_transf_41, Glycosyl transferase family 41 Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|206015 pfam13844, Glyco_transf_41, Glycosyl transferase family 41 Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|225605 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|179448 PRK02603, PRK02603, photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|179448 PRK02603, PRK02603, photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|225605 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|176974 CHL00033, ycf3, photosystem I assembly protein Ycf3 Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|225605 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|237080 PRK12370, PRK12370, invasion protein regulator; Provisional Back     alignment and domain information
>gnl|CDD|227343 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|227343 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|227124 COG4785, NlpI, Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|223861 COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|225605 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|225605 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|205362 pfam13181, TPR_8, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|191825 pfam07719, TPR_2, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|227310 COG4976, COG4976, Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|205609 pfam13431, TPR_17, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205362 pfam13181, TPR_8, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|234406 TIGR03939, PGA_TPR_OMP, poly-beta-1,6 N-acetyl-D-glucosamine export porin PgaA Back     alignment and domain information
>gnl|CDD|179448 PRK02603, PRK02603, photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|227343 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|225504 COG2956, COG2956, Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|236875 PRK11189, PRK11189, lipoprotein NlpI; Provisional Back     alignment and domain information
>gnl|CDD|191825 pfam07719, TPR_2, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205609 pfam13431, TPR_17, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|225504 COG2956, COG2956, Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|225605 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|220721 pfam10373, EST1_DNA_bind, Est1 DNA/RNA binding domain Back     alignment and domain information
>gnl|CDD|227124 COG4785, NlpI, Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|191825 pfam07719, TPR_2, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|176974 CHL00033, ycf3, photosystem I assembly protein Ycf3 Back     alignment and domain information
>gnl|CDD|205362 pfam13181, TPR_8, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|183140 PRK11447, PRK11447, cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|227122 COG4783, COG4783, Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|226687 COG4235, COG4235, Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 921
KOG4626966 consensus O-linked N-acetylglucosamine transferase 100.0
COG3914620 Spy Predicted O-linked N-acetylglucosamine transfe 100.0
PF13844468 Glyco_transf_41: Glycosyl transferase family 41; P 100.0
KOG4626966 consensus O-linked N-acetylglucosamine transferase 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK114471157 cellulose synthase subunit BcsC; Provisional 100.0
PRK114471157 cellulose synthase subunit BcsC; Provisional 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK15174656 Vi polysaccharide export protein VexE; Provisional 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.98
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 99.98
KOG0547606 consensus Translocase of outer mitochondrial membr 99.97
PRK10049765 pgaA outer membrane protein PgaA; Provisional 99.97
PRK10049765 pgaA outer membrane protein PgaA; Provisional 99.97
KOG20021018 consensus TPR-containing nuclear phosphoprotein th 99.96
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 99.96
KOG20021018 consensus TPR-containing nuclear phosphoprotein th 99.96
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.96
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 99.95
KOG0547606 consensus Translocase of outer mitochondrial membr 99.94
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.94
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.93
KOG1126638 consensus DNA-binding cell division cycle control 99.93
PRK14574822 hmsH outer membrane protein; Provisional 99.93
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.93
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.93
KOG1126638 consensus DNA-binding cell division cycle control 99.93
KOG2076895 consensus RNA polymerase III transcription factor 99.93
PRK11788389 tetratricopeptide repeat protein; Provisional 99.92
PRK11788389 tetratricopeptide repeat protein; Provisional 99.92
KOG2003840 consensus TPR repeat-containing protein [General f 99.91
KOG2003840 consensus TPR repeat-containing protein [General f 99.91
PRK14574822 hmsH outer membrane protein; Provisional 99.91
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.9
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.9
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.89
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.89
KOG2076895 consensus RNA polymerase III transcription factor 99.89
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.89
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.88
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.88
PLN032181060 maturation of RBCL 1; Provisional 99.85
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.85
KOG11271238 consensus TPR repeat-containing protein [RNA proce 99.84
KOG1129478 consensus TPR repeat-containing protein [General f 99.84
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.84
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.84
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.83
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.83
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.82
PLN032181060 maturation of RBCL 1; Provisional 99.82
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.82
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.82
PRK12370553 invasion protein regulator; Provisional 99.82
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.81
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.81
PLN03077857 Protein ECB2; Provisional 99.81
PRK12370553 invasion protein regulator; Provisional 99.81
KOG1125579 consensus TPR repeat-containing protein [General f 99.81
KOG1129478 consensus TPR repeat-containing protein [General f 99.81
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.81
KOG1125579 consensus TPR repeat-containing protein [General f 99.8
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.8
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.8
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.78
PRK11189296 lipoprotein NlpI; Provisional 99.78
KOG11271238 consensus TPR repeat-containing protein [RNA proce 99.77
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.76
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.76
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.76
KOG2376652 consensus Signal recognition particle, subunit Srp 99.76
PRK11189296 lipoprotein NlpI; Provisional 99.76
PLN03077857 Protein ECB2; Provisional 99.76
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.75
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.75
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.74
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.74
KOG1915677 consensus Cell cycle control protein (crooked neck 99.73
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.73
PRK15490578 Vi polysaccharide biosynthesis protein TviE; Provi 99.72
PLN02789320 farnesyltranstransferase 99.72
PLN02789320 farnesyltranstransferase 99.69
KOG1915677 consensus Cell cycle control protein (crooked neck 99.68
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.67
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.66
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.65
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.62
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.61
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 99.6
KOG2376652 consensus Signal recognition particle, subunit Srp 99.58
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.57
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.55
PLN02949463 transferase, transferring glycosyl groups 99.54
PRK04841903 transcriptional regulator MalT; Provisional 99.54
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.53
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 99.53
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.53
PRK15359144 type III secretion system chaperone protein SscB; 99.51
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.51
cd03796398 GT1_PIG-A_like This family is most closely related 99.5
TIGR03088374 stp2 sugar transferase, PEP-CTERM/EpsH1 system ass 99.49
PRK15359144 type III secretion system chaperone protein SscB; 99.48
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.48
PLN02871465 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase 99.47
PRK15427406 colanic acid biosynthesis glycosyltransferase WcaL 99.47
PRK04841903 transcriptional regulator MalT; Provisional 99.45
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.45
PRK10370198 formate-dependent nitrite reductase complex subuni 99.45
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.43
cd03801374 GT1_YqgM_like This family is most closely related 99.43
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.42
cd03820348 GT1_amsD_like This family is most closely related 99.41
cd03822366 GT1_ecORF704_like This family is most closely rela 99.4
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.4
cd03792372 GT1_Trehalose_phosphorylase Trehalose phosphorylas 99.39
PRK10370198 formate-dependent nitrite reductase complex subuni 99.39
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.38
cd05844367 GT1_like_7 Glycosyltransferases catalyze the trans 99.37
cd04962371 GT1_like_5 This family is most closely related to 99.37
KOG1128777 consensus Uncharacterized conserved protein, conta 99.36
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.36
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.36
TIGR03449405 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-ino 99.35
cd03807365 GT1_WbnK_like This family is most closely related 99.34
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.34
cd03813475 GT1_like_3 This family is most closely related to 99.34
PRK15484380 lipopolysaccharide 1,2-N-acetylglucosaminetransfer 99.33
cd03811353 GT1_WabH_like This family is most closely related 99.33
KOG0553304 consensus TPR repeat-containing protein [General f 99.32
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.32
cd03806419 GT1_ALG11_like This family is most closely related 99.32
cd03818396 GT1_ExpC_like This family is most closely related 99.32
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 99.31
cd03805392 GT1_ALG2_like This family is most closely related 99.31
cd03821375 GT1_Bme6_like This family is most closely related 99.3
cd03812358 GT1_CapH_like This family is most closely related 99.3
cd03799355 GT1_amsK_like This is a family of GT1 glycosyltran 99.3
KOG1128777 consensus Uncharacterized conserved protein, conta 99.29
KOG0553304 consensus TPR repeat-containing protein [General f 99.29
cd04951360 GT1_WbdM_like This family is most closely related 99.27
cd03798377 GT1_wlbH_like This family is most closely related 99.27
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.26
cd03817374 GT1_UGDG_like This family is most closely related 99.26
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.25
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.23
PRK09922359 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D 99.22
PRK10307412 putative glycosyl transferase; Provisional 99.22
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.2
TIGR02149388 glgA_Coryne glycogen synthase, Corynebacterium fam 99.19
cd03795357 GT1_like_4 This family is most closely related to 99.19
cd03808359 GT1_cap1E_like This family is most closely related 99.19
TIGR02918500 accessory Sec system glycosylation protein GtfA. M 99.18
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.18
PLN02939977 transferase, transferring glycosyl groups 99.18
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.18
cd03825365 GT1_wcfI_like This family is most closely related 99.16
cd04949372 GT1_gtfA_like This family is most closely related 99.16
TIGR03087397 stp1 sugar transferase, PEP-CTERM/EpsH1 system ass 99.15
cd03823359 GT1_ExpE7_like This family is most closely related 99.15
cd03819355 GT1_WavL_like This family is most closely related 99.14
cd04955363 GT1_like_6 This family is most closely related to 99.14
cd03814364 GT1_like_2 This family is most closely related to 99.13
cd04946407 GT1_AmsK_like This family is most closely related 99.12
PLN02846462 digalactosyldiacylglycerol synthase 99.12
TIGR02470784 sucr_synth sucrose synthase. This model represents 99.12
cd03809365 GT1_mtfB_like This family is most closely related 99.11
PLN00142815 sucrose synthase 99.11
cd03802335 GT1_AviGT4_like This family is most closely relate 99.1
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.1
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 99.1
PLN023161036 synthase/transferase 99.09
cd03800398 GT1_Sucrose_synthase This family is most closely r 99.09
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.08
TIGR02472439 sucr_P_syn_N sucrose-phosphate synthase, putative, 99.07
TIGR02468 1050 sucrsPsyn_pln sucrose phosphate synthase/possible 99.07
KOG1941518 consensus Acetylcholine receptor-associated protei 99.07
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.06
PLN02501794 digalactosyldiacylglycerol synthase 99.06
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.05
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.05
KOG1941518 consensus Acetylcholine receptor-associated protei 99.05
KOG1111426 consensus N-acetylglucosaminyltransferase complex, 99.05
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.03
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.03
PF00534172 Glycos_transf_1: Glycosyl transferases group 1; In 98.99
cd03816415 GT1_ALG1_like This family is most closely related 98.98
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.98
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.97
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.97
PRK00654466 glgA glycogen synthase; Provisional 98.96
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.96
PRK14098489 glycogen synthase; Provisional 98.96
KOG2053932 consensus Mitochondrial inheritance and actin cyto 98.96
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.94
COG3898531 Uncharacterized membrane-bound protein [Function u 98.92
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.9
KOG2300629 consensus Uncharacterized conserved protein [Funct 98.89
PRK14099485 glycogen synthase; Provisional 98.89
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.89
TIGR02095473 glgA glycogen/starch synthases, ADP-glucose type. 98.88
cd03804351 GT1_wbaZ_like This family is most closely related 98.88
PRK05749425 3-deoxy-D-manno-octulosonic-acid transferase; Revi 98.88
PRK13609380 diacylglycerol glucosyltransferase; Provisional 98.88
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.88
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.87
cd03794394 GT1_wbuB_like This family is most closely related 98.87
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.87
PLN02605382 monogalactosyldiacylglycerol synthase 98.87
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.86
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.85
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.85
PHA01633335 putative glycosyl transferase group 1 98.85
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.84
PRK13608391 diacylglycerol glucosyltransferase; Provisional 98.83
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.82
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.82
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.81
PHA01630331 putative group 1 glycosyl transferase 98.81
KOG4648536 consensus Uncharacterized conserved protein, conta 98.81
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.8
PRK10125405 putative glycosyl transferase; Provisional 98.8
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.78
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.78
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.77
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.77
PRK10803263 tol-pal system protein YbgF; Provisional 98.77
PF13692135 Glyco_trans_1_4: Glycosyl transferases group 1; PD 98.77
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.76
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.76
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.74
KOG2300629 consensus Uncharacterized conserved protein [Funct 98.73
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.73
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.72
cd03791476 GT1_Glycogen_synthase_DULL1_like This family is mo 98.72
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.72
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.71
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.7
COG3898531 Uncharacterized membrane-bound protein [Function u 98.7
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.69
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.69
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.69
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.69
PRK15331165 chaperone protein SicA; Provisional 98.68
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 98.68
PRK11906458 transcriptional regulator; Provisional 98.67
PRK15331165 chaperone protein SicA; Provisional 98.66
KOG4648536 consensus Uncharacterized conserved protein, conta 98.66
PRK00726357 murG undecaprenyldiphospho-muramoylpentapeptide be 98.66
PRK10803263 tol-pal system protein YbgF; Provisional 98.66
PRK11906458 transcriptional regulator; Provisional 98.66
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.63
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.63
TIGR02400456 trehalose_OtsA alpha,alpha-trehalose-phosphate syn 98.62
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.62
cd03785350 GT1_MurG MurG is an N-acetylglucosaminyltransferas 98.61
TIGR00236365 wecB UDP-N-acetylglucosamine 2-epimerase. Epimeras 98.61
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.6
KOG2471696 consensus TPR repeat-containing protein [General f 98.57
cd03788460 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a 98.57
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.57
KOG2471696 consensus TPR repeat-containing protein [General f 98.56
KOG4234271 consensus TPR repeat-containing protein [General f 98.54
cd03786363 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of th 98.54
PRK00025380 lpxB lipid-A-disaccharide synthase; Reviewed 98.51
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.51
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.49
KOG1387465 consensus Glycosyltransferase [Cell wall/membrane/ 98.49
TIGR01133348 murG undecaprenyldiphospho-muramoylpentapeptide be 98.48
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.48
PF13512142 TPR_18: Tetratricopeptide repeat 98.46
PF12688120 TPR_5: Tetratrico peptide repeat 98.46
PLN02275371 transferase, transferring glycosyl groups 98.45
KOG4234271 consensus TPR repeat-containing protein [General f 98.45
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.45
TIGR00215385 lpxB lipid-A-disaccharide synthase. Lipid-A precur 98.42
PF12688120 TPR_5: Tetratrico peptide repeat 98.42
cd04950373 GT1_like_1 Glycosyltransferases catalyze the trans 98.41
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.4
cd01635229 Glycosyltransferase_GTB_type Glycosyltransferases 98.39
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.39
PRK14501 726 putative bifunctional trehalose-6-phosphate syntha 98.38
COG4700251 Uncharacterized protein conserved in bacteria cont 98.36
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.35
PF1337173 TPR_9: Tetratricopeptide repeat 98.31
KOG1586288 consensus Protein required for fusion of vesicles 98.3
PLN03063 797 alpha,alpha-trehalose-phosphate synthase (UDP-form 98.28
PF1337173 TPR_9: Tetratricopeptide repeat 98.28
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.28
PF13512142 TPR_18: Tetratricopeptide repeat 98.27
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.25
KOG0853495 consensus Glycosyltransferase [Cell wall/membrane/ 98.24
TIGR03713519 acc_sec_asp1 accessory Sec system protein Asp1. Th 98.22
KOG4555175 consensus TPR repeat-containing protein [Function 98.2
KOG1586288 consensus Protein required for fusion of vesicles 98.19
KOG4507886 consensus Uncharacterized conserved protein, conta 98.18
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.18
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.17
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 98.14
KOG1585308 consensus Protein required for fusion of vesicles 98.11
COG4700251 Uncharacterized protein conserved in bacteria cont 98.09
KOG1258577 consensus mRNA processing protein [RNA processing 98.09
KOG1585308 consensus Protein required for fusion of vesicles 98.07
KOG4555175 consensus TPR repeat-containing protein [Function 98.04
KOG1258577 consensus mRNA processing protein [RNA processing 98.04
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.03
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 98.03
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.03
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 98.02
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.01
COG0438381 RfaG Glycosyltransferase [Cell envelope biogenesis 97.99
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 97.97
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.96
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.94
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.93
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.92
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.92
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.88
KOG2610491 consensus Uncharacterized conserved protein [Funct 97.82
KOG1550552 consensus Extracellular protein SEL-1 and related 97.81
KOG09851666 consensus Vesicle coat protein clathrin, heavy cha 97.8
TIGR01426392 MGT glycosyltransferase, MGT family. This model de 97.79
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.76
KOG2610491 consensus Uncharacterized conserved protein [Funct 97.76
cd03793590 GT1_Glycogen_synthase_GSY2_like Glycogen synthase, 97.75
KOG1550552 consensus Extracellular protein SEL-1 and related 97.75
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.74
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.73
TIGR02919438 accessory Sec system glycosyltransferase GtfB. Mem 97.73
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.72
TIGR03492396 conserved hypothetical protein. This protein famil 97.7
KOG09851666 consensus Vesicle coat protein clathrin, heavy cha 97.69
COG1819406 Glycosyl transferases, related to UDP-glucuronosyl 97.69
PLN02670472 transferase, transferring glycosyl groups 97.68
KOG4507886 consensus Uncharacterized conserved protein, conta 97.67
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.66
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 97.63
PF1352492 Glyco_trans_1_2: Glycosyl transferases group 1 97.59
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.59
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 97.57
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.57
KOG08902382 consensus Protein kinase of the PI-3 kinase family 97.54
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.54
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.53
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 97.52
PF1342844 TPR_14: Tetratricopeptide repeat 97.5
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.5
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 97.48
PLN03004451 UDP-glycosyltransferase 97.47
PLN02992481 coniferyl-alcohol glucosyltransferase 97.45
PHA03392507 egt ecdysteroid UDP-glucosyltransferase; Provision 97.45
PF1342844 TPR_14: Tetratricopeptide repeat 97.43
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.4
TIGR02398487 gluc_glyc_Psyn glucosylglycerol-phosphate synthase 97.39
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.39
COG0707357 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosami 97.37
PF1343134 TPR_17: Tetratricopeptide repeat 97.36
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.36
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 97.35
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.34
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.33
PLN02863477 UDP-glucoronosyl/UDP-glucosyl transferase family p 97.31
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.3
PF1343134 TPR_17: Tetratricopeptide repeat 97.3
PLN02410451 UDP-glucoronosyl/UDP-glucosyl transferase family p 97.3
PLN02167475 UDP-glycosyltransferase family protein 97.28
PLN03064 934 alpha,alpha-trehalose-phosphate synthase (UDP-form 97.28
PLN03007482 UDP-glucosyltransferase family protein 97.28
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.27
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.27
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.26
KOG0530318 consensus Protein farnesyltransferase, alpha subun 97.24
PLN02764453 glycosyltransferase family protein 97.23
PLN02554481 UDP-glycosyltransferase family protein 97.23
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 97.2
cd03784401 GT1_Gtf_like This family includes the Gtfs, a grou 97.2
PLN02210456 UDP-glucosyl transferase 97.17
KOG0530318 consensus Protein farnesyltransferase, alpha subun 97.17
PLN00414446 glycosyltransferase family protein 97.14
PF00201500 UDPGT: UDP-glucoronosyl and UDP-glucosyl transfera 97.12
PLN02207468 UDP-glycosyltransferase 97.09
PLN02448459 UDP-glycosyltransferase family protein 97.09
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.04
PF13528318 Glyco_trans_1_3: Glycosyl transferase family 1 97.04
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 97.01
PLN02562448 UDP-glycosyltransferase 97.01
PLN02173449 UDP-glucosyl transferase family protein 97.01
PLN00164480 glucosyltransferase; Provisional 97.01
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 96.96
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 96.94
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 96.93
PLN02555480 limonoid glucosyltransferase 96.93
COG2976207 Uncharacterized protein conserved in bacteria [Fun 96.92
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.91
TIGR03590279 PseG pseudaminic acid biosynthesis-associated prot 96.9
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.89
PLN02208442 glycosyltransferase family protein 96.89
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.85
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.84
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.81
COG0297487 GlgA Glycogen synthase [Carbohydrate transport and 96.8
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 96.79
PLN03015470 UDP-glucosyl transferase 96.78
PLN02152455 indole-3-acetate beta-glucosyltransferase 96.7
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.69
PF02350346 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; 96.65
PRK12446352 undecaprenyldiphospho-muramoylpentapeptide beta-N- 96.64
PLN02534491 UDP-glycosyltransferase 96.59
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 96.57
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 96.46
KOG3783546 consensus Uncharacterized conserved protein [Funct 96.37
KOG1463411 consensus 26S proteasome regulatory complex, subun 96.3
PRK02797322 4-alpha-L-fucosyltransferase; Provisional 96.23
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 96.22
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 96.2
PRK09814333 beta-1,6-galactofuranosyltransferase; Provisional 96.19
PF02684373 LpxB: Lipid-A-disaccharide synthetase; InterPro: I 96.14
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 96.08
TIGR00661321 MJ1255 conserved hypothetical protein. This model 96.05
KOG1463411 consensus 26S proteasome regulatory complex, subun 96.01
PF06258311 Mito_fiss_Elm1: Mitochondrial fission ELM1; InterP 96.0
KOG20411189 consensus WD40 repeat protein [General function pr 95.99
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 95.95
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 95.94
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 95.93
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 95.91
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.91
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 95.9
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 95.88
KOG3783546 consensus Uncharacterized conserved protein [Funct 95.83
KOG20411189 consensus WD40 repeat protein [General function pr 95.74
PRK11619644 lytic murein transglycosylase; Provisional 95.72
PRK15180831 Vi polysaccharide biosynthesis protein TviD; Provi 95.68
PRK11619644 lytic murein transglycosylase; Provisional 95.62
KOG15381081 consensus Uncharacterized conserved protein WDR10, 95.62
TIGR02094601 more_P_ylases alpha-glucan phosphorylases. This fa 95.59
PRK15180831 Vi polysaccharide biosynthesis protein TviD; Provi 95.58
PF05693633 Glycogen_syn: Glycogen synthase; InterPro: IPR0086 95.55
COG1519419 KdtA 3-deoxy-D-manno-octulosonic-acid transferase 95.55
TIGR03568365 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, 95.54
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 95.44
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 95.34
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 95.32
COG5159421 RPN6 26S proteasome regulatory complex component [ 95.18
COG3914620 Spy Predicted O-linked N-acetylglucosamine transfe 95.03
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 94.98
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 94.95
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 94.82
COG4976287 Predicted methyltransferase (contains TPR repeat) 94.78
cd04299778 GT1_Glycogen_Phosphorylase_like This family is mos 94.77
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 94.72
KOG1192496 consensus UDP-glucuronosyl and UDP-glucosyl transf 94.66
PRK10941269 hypothetical protein; Provisional 94.66
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 94.63
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 94.55
KOG2941444 consensus Beta-1,4-mannosyltransferase [Posttransl 94.5
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 94.5
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 94.48
PRK10941269 hypothetical protein; Provisional 94.44
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 94.42
PF09986214 DUF2225: Uncharacterized protein conserved in bact 94.34
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 94.19
PF04007335 DUF354: Protein of unknown function (DUF354); Inte 94.19
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 94.11
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 93.95
COG4649221 Uncharacterized protein conserved in bacteria [Fun 93.94
COG4649221 Uncharacterized protein conserved in bacteria [Fun 93.92
PF09986214 DUF2225: Uncharacterized protein conserved in bact 93.91
PF07429360 Glyco_transf_56: 4-alpha-L-fucosyltransferase glyc 93.9
cd03789279 GT1_LPS_heptosyltransferase Lipopolysaccharide hep 93.81
KOG4814872 consensus Uncharacterized conserved protein [Funct 93.5
COG5159421 RPN6 26S proteasome regulatory complex component [ 93.46
KOG3364149 consensus Membrane protein involved in organellar 93.46
PF05159269 Capsule_synth: Capsule polysaccharide biosynthesis 93.29
COG4370412 Uncharacterized protein conserved in bacteria [Fun 93.24
KOG3364149 consensus Membrane protein involved in organellar 93.18
PF04101167 Glyco_tran_28_C: Glycosyltransferase family 28 C-t 93.17
KOG1310758 consensus WD40 repeat protein [General function pr 93.15
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 93.1
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 93.0
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 92.95
COG1747711 Uncharacterized N-terminal domain of the transcrip 92.78
PF01075247 Glyco_transf_9: Glycosyltransferase family 9 (hept 92.78
KOG1310758 consensus WD40 repeat protein [General function pr 92.78
KOG15381081 consensus Uncharacterized conserved protein WDR10, 92.74
PRK01021608 lpxB lipid-A-disaccharide synthase; Reviewed 92.67
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 92.55
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 92.54
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 92.44
KOG2422665 consensus Uncharacterized conserved protein [Funct 91.92
KOG3807556 consensus Predicted membrane protein ST7 (tumor su 91.89
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 91.84
PRK10916348 ADP-heptose:LPS heptosyltransferase II; Provisiona 91.7
KOG2422665 consensus Uncharacterized conserved protein [Funct 91.6
TIGR02201344 heptsyl_trn_III lipopolysaccharide heptosyltransfe 91.57
COG0763381 LpxB Lipid A disaccharide synthetase [Cell envelop 91.47
TIGR02195334 heptsyl_trn_II lipopolysaccharide heptosyltransfer 91.45
KOG0529421 consensus Protein geranylgeranyltransferase type I 91.33
COG4976287 Predicted methyltransferase (contains TPR repeat) 91.23
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=5.9e-161  Score=1263.00  Aligned_cols=837  Identities=40%  Similarity=0.589  Sum_probs=787.8

Q ss_pred             CCCCCCccccCcccCCCCCCCCCCCCCcccccccCCcchHHHHHHHHHHHhCCCHHHHHHHHHHHHHhCCCCHHHHHHHH
Q 002438           10 NGRERDPVQDNGFLKGPQSLPGTSGSPVAVGSTLKGFEGKDALSYANILRSRNKFVDALALYEIVLEKDSGNVEAHIGKG   89 (921)
Q Consensus        10 ~~~~~~~~~~~~~~~~~~~~~~~s~s~~~~~~~~~~~~~~~~l~~A~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la   89 (921)
                      ...++-.+.+..+-.+.........+..  .....+.-++.+-.+|+++..+|++++|+..|+.++++.|+..++|.++|
T Consensus        80 t~~~~llll~ai~~q~~r~d~s~a~~~~--a~r~~~q~ae~ysn~aN~~kerg~~~~al~~y~~aiel~p~fida~inla  157 (966)
T KOG4626|consen   80 TNTERLLLLSAIFFQGSRLDKSSAGSLL--AIRKNPQGAEAYSNLANILKERGQLQDALALYRAAIELKPKFIDAYINLA  157 (966)
T ss_pred             Ccccceeeehhhhhcccchhhhhhhhhh--hhhccchHHHHHHHHHHHHHHhchHHHHHHHHHHHHhcCchhhHHHhhHH
Confidence            3456666677777766664443332222  22334445677777999999999999999999999999999999999999


Q ss_pred             HHHHHhCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCChHhHHHHHHHHHHHHHHHHH
Q 002438           90 ICLQMQNMGRLAFDSFSEAVKLDPQNACAHTHCGILYKDEGRLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKL  169 (921)
Q Consensus        90 ~~~~~~g~~~~A~~~~~~al~~~p~~~~a~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~lg~~~~~  169 (921)
                      .++...|+.+.|.++|..+++++|....+...+|.++..+|+..+|..+|.++++..|..       +.+|.++|-.+..
T Consensus       158 ~al~~~~~~~~a~~~~~~alqlnP~l~ca~s~lgnLlka~Grl~ea~~cYlkAi~~qp~f-------AiawsnLg~~f~~  230 (966)
T KOG4626|consen  158 AALVTQGDLELAVQCFFEALQLNPDLYCARSDLGNLLKAEGRLEEAKACYLKAIETQPCF-------AIAWSNLGCVFNA  230 (966)
T ss_pred             HHHHhcCCCcccHHHHHHHHhcCcchhhhhcchhHHHHhhcccchhHHHHHHHHhhCCce-------eeeehhcchHHhh
Confidence            999999999999999999999999999999999999999999999999999999999975       4458888999999


Q ss_pred             cCChHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHCCCHHHHHHHHH
Q 002438          170 AGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYE  249 (921)
Q Consensus       170 ~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~  249 (921)
                      +|+...|+.+|+++++++|+..++|++||.+|.+.+.+++|+.+|.+++...|++..++.++|.+|+++|..+-|+..|+
T Consensus       231 ~Gei~~aiq~y~eAvkldP~f~dAYiNLGnV~ke~~~~d~Avs~Y~rAl~lrpn~A~a~gNla~iYyeqG~ldlAI~~Yk  310 (966)
T KOG4626|consen  231 QGEIWLAIQHYEEAVKLDPNFLDAYINLGNVYKEARIFDRAVSCYLRALNLRPNHAVAHGNLACIYYEQGLLDLAIDTYK  310 (966)
T ss_pred             cchHHHHHHHHHHhhcCCCcchHHHhhHHHHHHHHhcchHHHHHHHHHHhcCCcchhhccceEEEEeccccHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhCCChHHHHHHHHHHHHhhhhhhhhcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCChHHHHHHHHHHHhh
Q 002438          250 RCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHF  329 (921)
Q Consensus       250 ~al~~~p~~~~~~~~la~~~~~lg~~~~~~~~~~~A~~~~~~al~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~  329 (921)
                      +++++.|++++++.+++.++..+       |+..+|..+|.+++.+.|..+++.++||.+|.++|++++|..+|.++++.
T Consensus       311 ral~~~P~F~~Ay~NlanALkd~-------G~V~ea~~cYnkaL~l~p~hadam~NLgni~~E~~~~e~A~~ly~~al~v  383 (966)
T KOG4626|consen  311 RALELQPNFPDAYNNLANALKDK-------GSVTEAVDCYNKALRLCPNHADAMNNLGNIYREQGKIEEATRLYLKALEV  383 (966)
T ss_pred             HHHhcCCCchHHHhHHHHHHHhc-------cchHHHHHHHHHHHHhCCccHHHHHHHHHHHHHhccchHHHHHHHHHHhh
Confidence            99999999999999888888775       59999999999999999999999999999999999999999999999999


Q ss_pred             CCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHH
Q 002438          330 NPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLG  409 (921)
Q Consensus       330 ~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~l~~al~~~p~~~~~~~~la  409 (921)
                      .|..+.+..+||.+|.++|++++|+.+|++++.+.|..++++.++|..|..+|+.+.|+.+|.+++..+|..++++.+||
T Consensus       384 ~p~~aaa~nNLa~i~kqqgnl~~Ai~~YkealrI~P~fAda~~NmGnt~ke~g~v~~A~q~y~rAI~~nPt~AeAhsNLa  463 (966)
T KOG4626|consen  384 FPEFAAAHNNLASIYKQQGNLDDAIMCYKEALRIKPTFADALSNMGNTYKEMGDVSAAIQCYTRAIQINPTFAEAHSNLA  463 (966)
T ss_pred             ChhhhhhhhhHHHHHHhcccHHHHHHHHHHHHhcCchHHHHHHhcchHHHHhhhHHHHHHHHHHHHhcCcHHHHHHhhHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHcCCHHHHHHHHHHHhhcCCCChhhHhhHHHHhhhccCCCh-----HHHHHHHHHHH--HHHHhh-----------
Q 002438          410 VLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHD-----DKLFEAHRDWG--KRFMRL-----------  471 (921)
Q Consensus       410 ~~~~~~g~~~~A~~~~~~al~l~P~~~~a~~~~l~a~~~~~~~~~-----~~~~~~~~~~~--~~~~~~-----------  471 (921)
                      .+|...|+..+|++.|+++|+++||.++|..|++.++.++.+|.+     +++.+.+++|.  .++...           
T Consensus       464 si~kDsGni~~AI~sY~~aLklkPDfpdA~cNllh~lq~vcdw~D~d~~~~kl~sivrdql~~~rlpsvhP~hsm~ypl~  543 (966)
T KOG4626|consen  464 SIYKDSGNIPEAIQSYRTALKLKPDFPDAYCNLLHCLQIVCDWTDYDKRMKKLVSIVRDQLEKNRLPSVHPHHSMLYPLS  543 (966)
T ss_pred             HHhhccCCcHHHHHHHHHHHccCCCCchhhhHHHHHHHHHhcccchHHHHHHHHHHHHHHHhhhcCCccCcccccccccc
Confidence            999999999999999999999999999999999999999999987     78888899988  333321           


Q ss_pred             -----------------------ccCCCCCCCCCCCCCCceeeccCCCcccchhhhhhhcccccccCCceEEEEEecccC
Q 002438          472 -----------------------YSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVK  528 (921)
Q Consensus       472 -----------------------~~~~~~~~~~~~~~r~lriGyvS~d~~~H~v~~~~~~~l~~hd~~~fev~~Y~~~~~  528 (921)
                                             .+|+..|++-+.+++||||||||+||.+||+++||++++.+|||++||||||+.++.
T Consensus       544 ~~~~~aia~k~a~~c~~~~~~~~k~pyth~~~l~~~~~rlrIGYvSsDFgnHp~Shlmqsv~gmHdr~kveVfcYals~~  623 (966)
T KOG4626|consen  544 HILRKAIAAKHANLCLDKVHVLGKPPYTHPDNLKVKEGRLRIGYVSSDFGNHPTSHLMQSVPGMHDRSKVEVFCYALSVN  623 (966)
T ss_pred             hHHHHHHHHHHhhhhHHHHHhccCCCCCChhhCCCCcCceEEEeecccccCCchHHHhccCcCcCCccceEEEEEEeecC
Confidence                                   235778888888999999999999999999999999999999999999999999886


Q ss_pred             CChhhHHHHHHHhhhCCeeEEccCCCHHHHHHHHHhCCccEEEecCCCCCCCchhhhhcCCCceEEeeccCCCCCCCCCc
Q 002438          529 ADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTI  608 (921)
Q Consensus       529 ~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~i~~d~idiLvdl~g~t~~~r~~~~a~r~APvQ~~~~G~p~ttG~~~~  608 (921)
                      ++.   .||.++.++++||+|+++++...+|++|++|+|||||+|+|||.|+|.++||+|||||||+|+|||+|||+++|
T Consensus       624 d~t---~fR~kv~~e~ehf~Dls~i~~~kiA~~I~qD~I~ILvnlnGyTkgarneifAlrPAPIQv~wlGyPgTtGa~~m  700 (966)
T KOG4626|consen  624 DGT---NFRDKVMKEAEHFVDLSQIPCNKIADKIRQDKIHILVNLNGYTKGARNEIFALRPAPIQVMWLGYPGTTGATFM  700 (966)
T ss_pred             CCc---hHHHHHHhhccceeehhcCChHHHHHHHhhcCceEEEeccccccccccceeeccCCceeEEeecCCCCCCCcee
Confidence            553   28999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cEEEecCCCCCCCcccCcccceEEcCCCccccCCCC--------CCCCCCCCCCCCCCCeEEEecCCCCcCCHHHHHHHH
Q 002438          609 DYRITDSLADPPETKQKHVEELIRLPECFLCYTPSP--------EAGPVCPTPALTNGFITFGSFNNLAKITPKVLQVWA  680 (921)
Q Consensus       609 Dy~i~d~~~~p~~~~~~~~e~~~~lp~~~~~~~~~~--------~~~~~~~~~~~~~~~~~f~~~~~~~K~~~~~~~~~~  680 (921)
                      ||+|||.++.|++....|+|||++||+||+++++.+        ...|+++.++|++|.|||||||+++||+|.++++|+
T Consensus       701 DYiITDs~tsPl~~a~~ysEkLv~lPh~ffi~d~~qk~~~~~dpn~kP~r~~y~Lp~d~vvf~~FNqLyKidP~~l~~W~  780 (966)
T KOG4626|consen  701 DYIITDSVTSPLELAQQYSEKLVYLPHCFFIGDHKQKNQDVLDPNNKPTRSQYGLPEDAVVFCNFNQLYKIDPSTLQMWA  780 (966)
T ss_pred             eEEeecccCChHHHHHHHHHHHhhCCceEEecCcccccccccCCCCCCCCCCCCCCCCeEEEeechhhhcCCHHHHHHHH
Confidence            999999999999999999999999999999999876        566889999999999999999999999999999999


Q ss_pred             HHHhHcCCcEEEEecCCCCCHHHHHHHHHHHHHcCCCCCCEEEccCcCCcHHHHHhcccccEEecCCCCCCcccHHHHhh
Q 002438          681 RILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLY  760 (921)
Q Consensus       681 ~il~~~p~~~l~~~~~~~~~~~~~~~~~~~~~~~gi~~~rv~~~~~~~~~~~~~~~~~~~D~~Ld~~~~~g~~t~~eal~  760 (921)
                      +||++||||+||+++.|+.++   ++++..++++|++++||+|.+... .++|++++.++||+|||++|+||||++|.||
T Consensus       781 ~ILk~VPnS~LwllrfPa~ge---~rf~ty~~~~Gl~p~riifs~va~-k~eHvrr~~LaDv~LDTplcnGhTTg~dvLw  856 (966)
T KOG4626|consen  781 NILKRVPNSVLWLLRFPAVGE---QRFRTYAEQLGLEPDRIIFSPVAA-KEEHVRRGQLADVCLDTPLCNGHTTGMDVLW  856 (966)
T ss_pred             HHHHhCCcceeEEEeccccch---HHHHHHHHHhCCCccceeeccccc-hHHHHHhhhhhhhcccCcCcCCcccchhhhc
Confidence            999999999999999998766   899999999999999999999877 5999999999999999999999999999999


Q ss_pred             cCCcEEecCCCcccccchhHHHhhcCCcccccCCHHHHHHHHHHHhcCHHHHHHHHHHHHHHhhcCCCCChHHHHHHHHH
Q 002438          761 MGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLES  840 (921)
Q Consensus       761 ~GvPvvt~~g~~~~~r~~~~~l~~~gl~~~ia~~~~~y~~~a~~l~~d~~~~~~~r~~~~~~~~~~~l~~~~~~~~~~e~  840 (921)
                      +|||+|||||+++++||++|+|..+|++++||++.+||+++||+|++|.+.|+.+|.++|..+..|||||..+|+..||+
T Consensus       857 ~GvPmVTmpge~lAsrVa~Sll~~~Gl~hliak~~eEY~~iaV~Latd~~~L~~lr~~l~~~r~~splfd~~q~~~~LE~  936 (966)
T KOG4626|consen  857 AGVPMVTMPGETLASRVAASLLTALGLGHLIAKNREEYVQIAVRLATDKEYLKKLRAKLRKARASSPLFDTKQYAKGLER  936 (966)
T ss_pred             cCCceeecccHHHHHHHHHHHHHHcccHHHHhhhHHHHHHHHHHhhcCHHHHHHHHHHHHHHhcCCCccCchHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhcCCCCCchhhhhhhhcccc
Q 002438          841 TYRNMWHRYCKGDVPSLKRMEMLQQQVVS  869 (921)
Q Consensus       841 ~~~~~~~~~~~~~~p~~~~~~~~~~~~~~  869 (921)
                      .|.+||.+||.|.+|.++|++.+|+...+
T Consensus       937 ~y~~MW~~y~~G~~p~h~~me~~~e~~hd  965 (966)
T KOG4626|consen  937 LYLQMWKKYCSGEVPDHRRMENLQEEPHD  965 (966)
T ss_pred             HHHHHHHHhccCCCCchHHHhccccCcCC
Confidence            99999999999999999999998876543



>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13844 Glyco_transf_41: Glycosyl transferase family 41; PDB: 3PE4_C 3PE3_D 3TAX_C 2XGO_A 2JLB_B 2XGM_A 2VSY_B 2XGS_B 2VSN_A Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15490 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PLN02949 transferase, transferring glycosyl groups Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>cd03796 GT1_PIG-A_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03088 stp2 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PLN02871 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase Back     alignment and domain information
>PRK15427 colanic acid biosynthesis glycosyltransferase WcaL; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>cd03801 GT1_YqgM_like This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>cd03820 GT1_amsD_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03822 GT1_ecORF704_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>cd03792 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd05844 GT1_like_7 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase Back     alignment and domain information
>cd03807 GT1_WbnK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>cd03813 GT1_like_3 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK15484 lipopolysaccharide 1,2-N-acetylglucosaminetransferase; Provisional Back     alignment and domain information
>cd03811 GT1_WabH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>cd03806 GT1_ALG11_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03818 GT1_ExpC_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03812 GT1_CapH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03799 GT1_amsK_like This is a family of GT1 glycosyltransferases found specifically in certain bacteria Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli Back     alignment and domain information
>cd03798 GT1_wlbH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK09922 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase; Provisional Back     alignment and domain information
>PRK10307 putative glycosyl transferase; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>TIGR02149 glgA_Coryne glycogen synthase, Corynebacterium family Back     alignment and domain information
>cd03795 GT1_like_4 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02918 accessory Sec system glycosylation protein GtfA Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PLN02939 transferase, transferring glycosyl groups Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>cd03825 GT1_wcfI_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04949 GT1_gtfA_like This family is most closely related to the GT1 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding Back     alignment and domain information
>TIGR03087 stp1 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03819 GT1_WavL_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04955 GT1_like_6 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04946 GT1_AmsK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02846 digalactosyldiacylglycerol synthase Back     alignment and domain information
>TIGR02470 sucr_synth sucrose synthase Back     alignment and domain information
>cd03809 GT1_mtfB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN00142 sucrose synthase Back     alignment and domain information
>cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN02316 synthase/transferase Back     alignment and domain information
>cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02472 sucr_P_syn_N sucrose-phosphate synthase, putative, glycosyltransferase domain Back     alignment and domain information
>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PLN02501 digalactosyldiacylglycerol synthase Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1111 consensus N-acetylglucosaminyltransferase complex, subunit PIG-A/SPT14, required for phosphatidylinositol biosynthesis/Sulfolipid synthase [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Lipid transport and metabolism] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF00534 Glycos_transf_1: Glycosyl transferases group 1; InterPro: IPR001296 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK00654 glgA glycogen synthase; Provisional Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK14098 glycogen synthase; Provisional Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14099 glycogen synthase; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02095 glgA glycogen/starch synthases, ADP-glucose type Back     alignment and domain information
>cd03804 GT1_wbaZ_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK05749 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed Back     alignment and domain information
>PRK13609 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PLN02605 monogalactosyldiacylglycerol synthase Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PHA01633 putative glycosyl transferase group 1 Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK13608 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PHA01630 putative group 1 glycosyl transferase Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PRK10125 putative glycosyl transferase; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13692 Glyco_trans_1_4: Glycosyl transferases group 1; PDB: 3OY2_A 3OY7_B 2Q6V_A 2HY7_A 3CV3_A 3CUY_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd03791 GT1_Glycogen_synthase_DULL1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PRK00726 murG undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02400 trehalose_OtsA alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis Back     alignment and domain information
>TIGR00236 wecB UDP-N-acetylglucosamine 2-epimerase Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd03788 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc) Back     alignment and domain information
>PRK00025 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG1387 consensus Glycosyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PLN02275 transferase, transferring glycosyl groups Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>TIGR00215 lpxB lipid-A-disaccharide synthase Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>cd04950 GT1_like_1 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>cd01635 Glycosyltransferase_GTB_type Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG0853 consensus Glycosyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>TIGR03713 acc_sec_asp1 accessory Sec system protein Asp1 Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>COG0438 RfaG Glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR01426 MGT glycosyltransferase, MGT family Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd03793 GT1_Glycogen_synthase_GSY2_like Glycogen synthase, which is most closely related to the GT1 family of glycosyltransferases, catalyzes the transfer of a glucose molecule from UDP-glucose to a terminal branch of a glycogen molecule, a rate-limit step of glycogen biosynthesis Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>TIGR02919 accessory Sec system glycosyltransferase GtfB Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03492 conserved hypothetical protein Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1819 Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>PLN02670 transferase, transferring glycosyl groups Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF13524 Glyco_trans_1_2: Glycosyl transferases group 1 Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PLN03004 UDP-glycosyltransferase Back     alignment and domain information
>PLN02992 coniferyl-alcohol glucosyltransferase Back     alignment and domain information
>PHA03392 egt ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02398 gluc_glyc_Psyn glucosylglycerol-phosphate synthase Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG0707 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PLN02863 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PLN02410 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN02167 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN03064 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>PLN03007 UDP-glucosyltransferase family protein Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02764 glycosyltransferase family protein Back     alignment and domain information
>PLN02554 UDP-glycosyltransferase family protein Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>PLN02210 UDP-glucosyl transferase Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00414 glycosyltransferase family protein Back     alignment and domain information
>PF00201 UDPGT: UDP-glucoronosyl and UDP-glucosyl transferase; InterPro: IPR002213 UDP glycosyltransferases (UGT) are a superfamily of enzymes that catalyzes the addition of the glycosyl group from a UTP-sugar to a small hydrophobic molecule Back     alignment and domain information
>PLN02207 UDP-glycosyltransferase Back     alignment and domain information
>PLN02448 UDP-glycosyltransferase family protein Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13528 Glyco_trans_1_3: Glycosyl transferase family 1 Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN02562 UDP-glycosyltransferase Back     alignment and domain information
>PLN02173 UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN00164 glucosyltransferase; Provisional Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN02555 limonoid glucosyltransferase Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PLN02208 glycosyltransferase family protein Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>COG0297 GlgA Glycogen synthase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PLN03015 UDP-glucosyl transferase Back     alignment and domain information
>PLN02152 indole-3-acetate beta-glucosyltransferase Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF02350 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; InterPro: IPR003331 UDP-N-acetylglucosamine 2-epimerase 5 Back     alignment and domain information
>PRK12446 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed Back     alignment and domain information
>PLN02534 UDP-glycosyltransferase Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK02797 4-alpha-L-fucosyltransferase; Provisional Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PRK09814 beta-1,6-galactofuranosyltransferase; Provisional Back     alignment and domain information
>PF02684 LpxB: Lipid-A-disaccharide synthetase; InterPro: IPR003835 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00661 MJ1255 conserved hypothetical protein Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06258 Mito_fiss_Elm1: Mitochondrial fission ELM1; InterPro: IPR009367 This family consists of several hypothetical eukaryotic and prokaryotic proteins Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>TIGR02094 more_P_ylases alpha-glucan phosphorylases Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF05693 Glycogen_syn: Glycogen synthase; InterPro: IPR008631 This family consists of the eukaryotic glycogen synthase proteins GYS1, GYS2 and GYS3 Back     alignment and domain information
>COG1519 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03568 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, UDP-hydrolysing Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>cd04299 GT1_Glycogen_Phosphorylase_like This family is most closely related to the oligosaccharide phosphorylase domain family and other unidentified sequences Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG1192 consensus UDP-glucuronosyl and UDP-glucosyl transferase [Carbohydrate transport and metabolism; Energy production and conversion] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG2941 consensus Beta-1,4-mannosyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF04007 DUF354: Protein of unknown function (DUF354); InterPro: IPR007152 Members of this family are around 350 amino acids in length Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF07429 Glyco_transf_56: 4-alpha-L-fucosyltransferase glycosyl transferase group 56; InterPro: IPR009993 This family contains the bacterial enzyme 4-alpha-L-fucosyltransferase (Fuc4NAc transferase) (approximately 360 residues long) Back     alignment and domain information
>cd03789 GT1_LPS_heptosyltransferase Lipopolysaccharide heptosyltransferase is involved in the biosynthesis of lipooligosaccharide (LOS) Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF05159 Capsule_synth: Capsule polysaccharide biosynthesis protein; InterPro: IPR007833 This family includes export proteins involved in capsule polysaccharide biosynthesis, such as KpsS P42218 from SWISSPROT and LipB P57038 from SWISSPROT Back     alignment and domain information
>COG4370 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF04101 Glyco_tran_28_C: Glycosyltransferase family 28 C-terminal domain; InterPro: IPR007235 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF01075 Glyco_transf_9: Glycosyltransferase family 9 (heptosyltransferase); InterPro: IPR002201 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PRK01021 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PRK10916 ADP-heptose:LPS heptosyltransferase II; Provisional Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02201 heptsyl_trn_III lipopolysaccharide heptosyltransferase III, putative Back     alignment and domain information
>COG0763 LpxB Lipid A disaccharide synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02195 heptsyl_trn_II lipopolysaccharide heptosyltransferase II Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query921
1w3b_A388 The Superhelical Tpr Domain Of O-Linked Glcnac Tran 2e-32
1w3b_A388 The Superhelical Tpr Domain Of O-Linked Glcnac Tran 2e-14
2vsn_A568 Structure And Topological Arrangement Of An O-Glcna 2e-28
2vsy_A568 Xanthomonas Campestris Putative Ogt (Xcc0866), Apos 2e-28
3pe3_A723 Structure Of Human O-Glcnac Transferase And Its Com 4e-28
3pe3_A723 Structure Of Human O-Glcnac Transferase And Its Com 4e-23
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 7e-19
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 1e-18
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 1e-11
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 4e-16
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 1e-13
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 4e-12
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 1e-14
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 7e-11
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 8e-13
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 6e-10
1na3_A91 Design Of Stable Alpha-Helical Arrays From An Ideal 2e-11
3vtx_A184 Crystal Structure Of Mama Protein Length = 184 4e-10
3vtx_A184 Crystal Structure Of Mama Protein Length = 184 1e-09
3vtx_A184 Crystal Structure Of Mama Protein Length = 184 5e-04
2avp_A70 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 1e-08
3r9a_B328 Human Alanine-Glyoxylate Aminotransferase In Comple 4e-08
3r9a_B328 Human Alanine-Glyoxylate Aminotransferase In Comple 3e-06
4eqf_A365 Trip8b-1a#206-567 Interacting With The Carboxy-Term 7e-08
2j9q_A328 A Novel Conformation For The Tpr Domain Of Pex5p Le 1e-07
2j9q_A328 A Novel Conformation For The Tpr Domain Of Pex5p Le 2e-06
2c0l_A305 Tpr Domain Of Human Pex5p In Complex With Human Msc 1e-07
2c0l_A305 Tpr Domain Of Human Pex5p In Complex With Human Msc 2e-06
2c0m_A319 Apo Form Of The Tpr Domain Of The Pex5p Receptor Le 1e-07
2c0m_A319 Apo Form Of The Tpr Domain Of The Pex5p Receptor Le 3e-06
1fch_A368 Crystal Structure Of The Pts1 Complexed To The Tpr 2e-07
1fch_A368 Crystal Structure Of The Pts1 Complexed To The Tpr 4e-06
3cv0_A327 Structure Of Peroxisomal Targeting Signal 1 (Pts1) 2e-06
3cvq_A327 Structure Of Peroxisomal Targeting Signal 1 (pts1) 2e-06
3q3e_A631 Crystal Structure Of The Actinobacillus Pleuropneum 2e-05
2q7f_A243 Crystal Structure Of Yrrb: A Tpr Protein With An Un 5e-05
2q7f_A243 Crystal Structure Of Yrrb: A Tpr Protein With An Un 6e-04
2vyi_A131 Crystal Structure Of The Tpr Domain Of Human Sgt Le 7e-05
2xpi_A597 Crystal Structure Of ApcC HETERO-Tetramer Cut9-Hcn1 2e-04
>pdb|1W3B|A Chain A, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha. Length = 388 Back     alignment and structure

Iteration: 1

Score = 137 bits (346), Expect = 2e-32, Method: Compositional matrix adjust. Identities = 101/353 (28%), Positives = 168/353 (47%), Gaps = 15/353 (4%) Query: 89 GICLQMQNMGRLAFDSFSEAVKLDPQNACAHTHCGILYKDEGRLVEAAESYHKALSADPS 148 I Q + + R A S + A+K +P A A+++ G +YK+ G+L EA E Y AL P Sbjct: 41 SIHFQCRRLDRSAHFS-TLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPD 99 Query: 149 YKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYD 208 + +L +L AG+ + +Q Y AL+ +P +LG + L + + Sbjct: 100 FIDG-------YINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLE 152 Query: 209 TALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIA 268 A CY KA +P +A A+ N+G ++ +G++ AI +E+ + + PNF A Sbjct: 153 EAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNF-------LDA 205 Query: 269 LTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFH 328 +LG +K ++ VA Y +AL + ++A NL Y E D+AI Y A Sbjct: 206 YINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIE 265 Query: 329 FNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGXXXXXX 388 PH +A NL K++ ++ +A +CY AL + P + SLNNL + QG Sbjct: 266 LQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAV 325 Query: 389 XXXXXXXXXNPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQN 441 P +A A++NL + + G + A+ Y++ ++I P +A N Sbjct: 326 RLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSN 378
>pdb|1W3B|A Chain A, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha. Length = 388 Back     alignment and structure
>pdb|2VSN|A Chain A, Structure And Topological Arrangement Of An O-Glcnac Transferase Homolog: Insight Into Molecular Control Of Intracellular Glycosylation Length = 568 Back     alignment and structure
>pdb|2VSY|A Chain A, Xanthomonas Campestris Putative Ogt (Xcc0866), Apostructure Length = 568 Back     alignment and structure
>pdb|3PE3|A Chain A, Structure Of Human O-Glcnac Transferase And Its Complex With A Peptide Substrate Length = 723 Back     alignment and structure
>pdb|3PE3|A Chain A, Structure Of Human O-Glcnac Transferase And Its Complex With A Peptide Substrate Length = 723 Back     alignment and structure
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 91 Back     alignment and structure
>pdb|3VTX|A Chain A, Crystal Structure Of Mama Protein Length = 184 Back     alignment and structure
>pdb|3VTX|A Chain A, Crystal Structure Of Mama Protein Length = 184 Back     alignment and structure
>pdb|3VTX|A Chain A, Crystal Structure Of Mama Protein Length = 184 Back     alignment and structure
>pdb|2AVP|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix Length = 70 Back     alignment and structure
>pdb|3R9A|B Chain B, Human Alanine-Glyoxylate Aminotransferase In Complex With The Tpr Domain Of Human Pex5p Length = 328 Back     alignment and structure
>pdb|3R9A|B Chain B, Human Alanine-Glyoxylate Aminotransferase In Complex With The Tpr Domain Of Human Pex5p Length = 328 Back     alignment and structure
>pdb|4EQF|A Chain A, Trip8b-1a#206-567 Interacting With The Carboxy-Terminal Seven Residues Of Hcn2 Length = 365 Back     alignment and structure
>pdb|2J9Q|A Chain A, A Novel Conformation For The Tpr Domain Of Pex5p Length = 328 Back     alignment and structure
>pdb|2J9Q|A Chain A, A Novel Conformation For The Tpr Domain Of Pex5p Length = 328 Back     alignment and structure
>pdb|2C0L|A Chain A, Tpr Domain Of Human Pex5p In Complex With Human Mscp2 Length = 305 Back     alignment and structure
>pdb|2C0L|A Chain A, Tpr Domain Of Human Pex5p In Complex With Human Mscp2 Length = 305 Back     alignment and structure
>pdb|2C0M|A Chain A, Apo Form Of The Tpr Domain Of The Pex5p Receptor Length = 319 Back     alignment and structure
>pdb|2C0M|A Chain A, Apo Form Of The Tpr Domain Of The Pex5p Receptor Length = 319 Back     alignment and structure
>pdb|1FCH|A Chain A, Crystal Structure Of The Pts1 Complexed To The Tpr Region Of Human Pex5 Length = 368 Back     alignment and structure
>pdb|1FCH|A Chain A, Crystal Structure Of The Pts1 Complexed To The Tpr Region Of Human Pex5 Length = 368 Back     alignment and structure
>pdb|3CV0|A Chain A, Structure Of Peroxisomal Targeting Signal 1 (Pts1) Binding Domain Of Trypanosoma Brucei Peroxin 5 (Tbpex5)complexed To T. Brucei Phosphoglucoisomerase (Pgi) Pts1 Peptide Length = 327 Back     alignment and structure
>pdb|3CVQ|A Chain A, Structure Of Peroxisomal Targeting Signal 1 (pts1) Binding Domain Of Trypanosoma Brucei Peroxin 5 (tbpex5)complexed To Pts1 Peptide (7- Skl) Length = 327 Back     alignment and structure
>pdb|3Q3E|A Chain A, Crystal Structure Of The Actinobacillus Pleuropneumoniae Hmw1c Glycosyltransferase Length = 631 Back     alignment and structure
>pdb|2Q7F|A Chain A, Crystal Structure Of Yrrb: A Tpr Protein With An Unusual Peptide- Binding Site Length = 243 Back     alignment and structure
>pdb|2Q7F|A Chain A, Crystal Structure Of Yrrb: A Tpr Protein With An Unusual Peptide- Binding Site Length = 243 Back     alignment and structure
>pdb|2VYI|A Chain A, Crystal Structure Of The Tpr Domain Of Human Sgt Length = 131 Back     alignment and structure
>pdb|2XPI|A Chain A, Crystal Structure Of ApcC HETERO-Tetramer Cut9-Hcn1 Length = 597 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query921
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 0.0
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 7e-31
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-28
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-26
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 7e-20
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-15
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 8e-05
3tax_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-136
3tax_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 2e-91
3tax_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-21
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-134
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-102
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-84
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 5e-72
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-67
3q3e_A631 HMW1C-like glycosyltransferase; N-glycosylation; 2 1e-122
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-85
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 7e-76
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-74
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-68
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-29
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-84
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 6e-81
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 9e-80
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-74
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 5e-65
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-61
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-40
4eqf_A365 PEX5-related protein; accessory protein, tetratric 4e-79
4eqf_A365 PEX5-related protein; accessory protein, tetratric 3e-76
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-60
4eqf_A365 PEX5-related protein; accessory protein, tetratric 7e-47
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-42
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 4e-75
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-63
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-28
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-26
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 1e-74
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 3e-69
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-66
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 1e-32
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-73
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 5e-73
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-72
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-62
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-27
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-25
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-07
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-72
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 9e-70
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-47
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 7e-29
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-26
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-18
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 8e-72
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 7e-71
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-70
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 5e-60
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-54
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 5e-51
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 7e-45
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 6e-71
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-62
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-52
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 6e-49
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 9e-49
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-47
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-36
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 9e-28
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-70
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-69
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-68
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-65
2gw1_A514 Mitochondrial precursor proteins import receptor; 3e-60
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-54
2gw1_A514 Mitochondrial precursor proteins import receptor; 4e-26
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 3e-67
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 3e-65
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 7e-60
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-52
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-52
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-39
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 6e-28
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-65
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-57
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 6e-45
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 7e-41
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-09
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 4e-65
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-60
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-57
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 2e-49
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 9e-44
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-38
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-09
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 7e-65
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 5e-58
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 3e-49
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 6e-44
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 7e-31
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 6e-15
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 8e-64
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-62
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-62
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-62
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 6e-61
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-58
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-54
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 9e-50
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-49
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-46
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-38
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-36
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-63
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-60
3u4t_A272 TPR repeat-containing protein; structural genomics 3e-57
3u4t_A272 TPR repeat-containing protein; structural genomics 6e-54
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-41
3u4t_A272 TPR repeat-containing protein; structural genomics 7e-23
4g1t_A472 Interferon-induced protein with tetratricopeptide 4e-62
4g1t_A472 Interferon-induced protein with tetratricopeptide 4e-55
4g1t_A472 Interferon-induced protein with tetratricopeptide 7e-54
4g1t_A472 Interferon-induced protein with tetratricopeptide 3e-46
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-61
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-51
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 3e-39
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-29
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 7e-18
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 8e-59
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 2e-52
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 7e-20
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 3e-55
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 2e-40
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 2e-38
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 9e-24
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 1e-54
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-52
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 1e-48
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 1e-43
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 4e-43
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-32
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 1e-17
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 4e-07
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 3e-51
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-50
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 3e-40
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 1e-35
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 6e-51
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 8e-30
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 1e-49
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 8e-42
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 1e-35
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 5e-35
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 6e-22
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 4e-18
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 7e-07
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 2e-04
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 6e-49
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-46
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 1e-43
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 6e-09
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 1e-44
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 6e-38
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 9e-33
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 7e-30
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 3e-40
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 3e-35
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 2e-31
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 4e-40
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 5e-36
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 3e-35
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 6e-35
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 3e-34
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 2e-25
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 2e-20
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 3e-16
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 7e-35
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 3e-34
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 1e-28
3q15_A378 PSP28, response regulator aspartate phosphatase H; 3e-34
3q15_A378 PSP28, response regulator aspartate phosphatase H; 7e-34
3q15_A378 PSP28, response regulator aspartate phosphatase H; 4e-32
3q15_A378 PSP28, response regulator aspartate phosphatase H; 2e-23
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 1e-33
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 3e-30
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 2e-28
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 5e-23
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 1e-22
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 2e-29
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 4e-28
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 3e-26
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 1e-23
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 4e-21
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 5e-21
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 2e-12
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 3e-06
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 2e-28
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 3e-24
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 3e-21
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 5e-21
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 4e-14
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 1e-11
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 2e-27
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 2e-26
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 1e-25
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 1e-19
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 3e-27
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 5e-23
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 5e-20
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 8e-17
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 3e-27
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 3e-23
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 1e-22
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 9e-22
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 1e-21
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 7e-20
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 1e-18
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 4e-18
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 7e-15
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 1e-26
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 1e-16
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 5e-14
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 2e-12
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 6e-11
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 3e-26
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 2e-20
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 2e-18
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 9e-26
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 1e-25
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 6e-23
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 8e-23
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 3e-22
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 3e-17
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 6e-16
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 4e-14
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 2e-06
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 3e-05
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 3e-24
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-23
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-23
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 1e-18
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 3e-16
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 3e-15
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 3e-05
2kat_A115 Uncharacterized protein; NESG, structure, structur 7e-24
2kat_A115 Uncharacterized protein; NESG, structure, structur 6e-23
2kat_A115 Uncharacterized protein; NESG, structure, structur 2e-21
2kat_A115 Uncharacterized protein; NESG, structure, structur 2e-18
2kat_A115 Uncharacterized protein; NESG, structure, structur 2e-18
2kat_A115 Uncharacterized protein; NESG, structure, structur 3e-14
2kat_A115 Uncharacterized protein; NESG, structure, structur 3e-14
2kat_A115 Uncharacterized protein; NESG, structure, structur 1e-12
2kat_A115 Uncharacterized protein; NESG, structure, structur 2e-04
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 4e-23
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 5e-21
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 2e-18
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 1e-17
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 8e-13
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 3e-09
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 2e-08
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 1e-22
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 6e-21
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 5e-13
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 2e-22
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 2e-21
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 3e-19
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 6e-19
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 8e-17
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 3e-16
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 1e-10
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 3e-08
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 1e-05
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-21
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 3e-21
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 4e-20
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-18
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 3e-14
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 1e-12
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-04
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 2e-21
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 4e-20
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 3e-14
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 2e-10
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 3e-21
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 5e-21
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 1e-18
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 4e-18
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 5e-16
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 4e-15
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 5e-10
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 5e-10
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 3e-21
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 1e-17
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 5e-16
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 5e-16
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 9e-15
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 2e-13
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 4e-10
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 9e-10
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 1e-20
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 9e-20
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 5e-19
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 1e-17
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 1e-15
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 1e-14
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-13
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 2e-12
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 1e-04
3k9i_A117 BH0479 protein; putative protein binding protein, 8e-19
3k9i_A117 BH0479 protein; putative protein binding protein, 7e-18
3k9i_A117 BH0479 protein; putative protein binding protein, 2e-16
3k9i_A117 BH0479 protein; putative protein binding protein, 5e-15
3k9i_A117 BH0479 protein; putative protein binding protein, 1e-13
3k9i_A117 BH0479 protein; putative protein binding protein, 8e-13
3k9i_A117 BH0479 protein; putative protein binding protein, 2e-12
3k9i_A117 BH0479 protein; putative protein binding protein, 1e-09
3k9i_A117 BH0479 protein; putative protein binding protein, 1e-08
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 1e-18
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 1e-16
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 6e-13
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 5e-09
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 1e-18
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 4e-14
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 2e-13
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 1e-10
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 4e-18
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 2e-16
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 9e-13
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 3e-10
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 8e-08
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 4e-07
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 6e-07
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 3e-17
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 8e-17
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 2e-12
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 4e-07
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 7e-17
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 2e-16
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 3e-16
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 5e-12
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 2e-16
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 3e-13
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 4e-11
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 3e-16
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 9e-16
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 2e-12
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 3e-11
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 1e-06
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 2e-06
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 9e-16
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 1e-14
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 2e-10
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 4e-08
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 4e-08
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 7e-07
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 2e-14
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 1e-11
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 5e-08
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 7e-06
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 1e-05
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 7e-04
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 3e-14
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 6e-14
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 2e-08
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 4e-08
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 2e-07
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 1e-06
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 4e-05
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 4e-13
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 2e-12
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 1e-11
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 5e-11
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 2e-10
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 8e-07
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 9e-07
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 2e-06
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 4e-06
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 6e-13
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 2e-12
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 8e-08
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 4e-07
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 5e-06
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 7e-13
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 3e-12
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 6e-07
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 3e-05
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 4e-05
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 8e-04
3q49_B137 STIP1 homology and U box-containing protein 1; E3 3e-11
3q49_B137 STIP1 homology and U box-containing protein 1; E3 1e-10
3q49_B137 STIP1 homology and U box-containing protein 1; E3 3e-06
3q49_B137 STIP1 homology and U box-containing protein 1; E3 6e-06
3q49_B137 STIP1 homology and U box-containing protein 1; E3 8e-06
3q49_B137 STIP1 homology and U box-containing protein 1; E3 1e-05
3q49_B137 STIP1 homology and U box-containing protein 1; E3 2e-04
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 3e-11
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 8e-09
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 3e-08
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 2e-06
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 5e-04
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 1e-10
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 6e-09
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 8e-06
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 6e-05
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 9e-05
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 2e-04
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 3e-04
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 1e-10
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 2e-09
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 8e-07
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 3e-06
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
2l6j_A111 TPR repeat-containing protein associated with HSP; 2e-10
2l6j_A111 TPR repeat-containing protein associated with HSP; 1e-08
2l6j_A111 TPR repeat-containing protein associated with HSP; 3e-08
2l6j_A111 TPR repeat-containing protein associated with HSP; 2e-06
2l6j_A111 TPR repeat-containing protein associated with HSP; 1e-05
2l6j_A111 TPR repeat-containing protein associated with HSP; 2e-05
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 1e-09
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 3e-09
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 2e-08
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 3e-08
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 4e-09
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 5e-07
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 9e-05
1klx_A138 Cysteine rich protein B; structural genomics, heli 3e-08
1klx_A138 Cysteine rich protein B; structural genomics, heli 2e-06
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 4e-08
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 5e-08
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 4e-05
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 1e-07
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 2e-06
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 5e-06
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 3e-07
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 9e-05
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 7e-07
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 5e-05
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 9e-06
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 3e-05
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 9e-06
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 2e-04
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 3e-04
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 1e-05
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 1e-05
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 2e-05
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 3e-05
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 2e-05
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 2e-04
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 8e-04
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 1e-04
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 2e-04
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 6e-04
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
 Score =  558 bits (1439), Expect = 0.0
 Identities = 125/571 (21%), Positives = 207/571 (36%), Gaps = 43/571 (7%)

Query: 316 FDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLG 375
               ++    A    P    A   L        +        Q  L++ P   +++  LG
Sbjct: 5   GPRELLQLRAAVRHRPQDFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLG 64

Query: 376 VVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDS 435
            V   Q +   AA ++++A  A P +      LG    DAG    A  AY +  ++ P+ 
Sbjct: 65  RVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEE 124

Query: 436 RNAGQNRLLAMNYINEGH-------------------------------DDKLFEAHRDW 464
                  L     + +                                   +     R  
Sbjct: 125 PYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTR 184

Query: 465 GKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYS 524
            +      S           + PL +G+VS  +  H       A       +   + ++ 
Sbjct: 185 AQAIAA--SVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHL 242

Query: 525 -AVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLG 583
            A    D  T+R R   + +     D+  +     A  +R   ID+L +L G     +  
Sbjct: 243 FATSGDDGSTLRTR---LAQASTLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPE 299

Query: 584 MMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPS 643
           + A +PAPVQV W+ YP T+G P +DY + D+ A PP  +  + E ++RL   F     S
Sbjct: 300 VFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTS 359

Query: 644 PEAG--PVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCD 701
                 P      L    +    FNN  K+ P+ +     +L  VP+S L +   P    
Sbjct: 360 RVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGP---G 416

Query: 702 SVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYM 761
               R  +     G+++ R+  +P  L +  ++  Y   D+ LDT PY   TT  ++L+ 
Sbjct: 417 EADARLRAFAHAQGVDAQRLVFMP-KLPHPQYLARYRHADLFLDTHPYNAHTTASDALWT 475

Query: 762 GVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRD 821
           G P +T  G   A  V  SL   +GL  +   ++  +V  A+ LASD  AL  L   +  
Sbjct: 476 GCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDV 535

Query: 822 LMSKSPVCDGQNFALGLESTYRNMWHRYCKG 852
           L   S V     FA    +  + +  R+   
Sbjct: 536 LRRASGVFHMDGFADDFGALLQALARRHGWL 566


>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>3q3e_A HMW1C-like glycosyltransferase; N-glycosylation; 2.10A {Actinobacillus pleuropneumoniae serovaorganism_taxid} PDB: 3q3h_A* 3q3i_A Length = 631 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Length = 212 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Length = 212 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Length = 212 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Length = 212 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Length = 497 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Length = 497 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Length = 497 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Length = 497 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Length = 497 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Length = 158 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Length = 158 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Length = 158 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Length = 158 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Length = 138 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Length = 138 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Length = 176 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Length = 176 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Length = 282 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Length = 273 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 921
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 6e-54
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-37
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 9e-36
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-29
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-11
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 4e-39
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 2e-36
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 3e-35
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 1e-29
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 2e-29
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 2e-26
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 9e-07
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 7e-06
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 6e-27
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 5e-18
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 1e-11
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 3e-11
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 6e-07
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 2e-26
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 7e-25
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 1e-19
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 2e-17
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 2e-10
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 2e-26
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 6e-25
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 1e-12
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 3e-11
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 1e-08
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 3e-05
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 4e-05
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 6e-21
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 3e-19
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 2e-15
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 3e-14
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 5e-06
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 8e-19
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 3e-15
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 2e-10
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 4e-18
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 7e-09
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 4e-08
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 4e-17
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 6e-17
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 1e-16
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 5e-16
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 3e-15
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 7e-12
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 7e-15
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 2e-13
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 2e-13
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 4e-12
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 7e-12
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 1e-11
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 2e-11
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 2e-14
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 4e-12
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 1e-11
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 3e-11
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 5e-11
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 3e-10
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 2e-08
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 1e-07
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 4e-07
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 4e-06
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 1e-13
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 6e-11
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 1e-10
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 8e-10
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 2e-06
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 4e-06
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 6e-05
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 1e-12
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 2e-11
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 1e-10
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 9e-10
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 6e-09
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 4e-05
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 7e-04
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 3e-11
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 4e-07
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 1e-05
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 0.003
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 6e-11
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 5e-10
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 9e-09
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 0.002
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 8e-11
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 4e-09
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 7e-09
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 4e-08
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 1e-04
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 2e-10
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 3e-09
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 2e-07
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 4e-07
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 5e-05
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 2e-04
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 4e-10
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 5e-10
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 7e-09
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 2e-07
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 1e-05
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 9e-04
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 5e-10
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 4e-09
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 2e-07
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 4e-07
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 5e-07
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 1e-05
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 5e-05
d1ouva_265 a.118.18.1 (A:) Cysteine rich protein C (HcpC) {He 3e-08
d1ouva_265 a.118.18.1 (A:) Cysteine rich protein C (HcpC) {He 1e-04
d2hr2a1156 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C 7e-07
d2hr2a1156 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C 2e-06
d2hr2a1156 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C 9e-04
d2ff4a2179 a.118.8.3 (A:105-283) Probable regulatory protein 9e-07
d2ff4a2179 a.118.8.3 (A:105-283) Probable regulatory protein 3e-04
d2ff4a2179 a.118.8.3 (A:105-283) Probable regulatory protein 0.001
d2onda1308 a.118.8.7 (A:242-549) Cleavage stimulation factor 3e-04
d2pqrb1124 a.118.8.1 (B:5-128) Mitochondria fission protein F 6e-04
d2pqrb1124 a.118.8.1 (B:5-128) Mitochondria fission protein F 0.001
d2pqrb1124 a.118.8.1 (B:5-128) Mitochondria fission protein F 0.002
d2pqrb1124 a.118.8.1 (B:5-128) Mitochondria fission protein F 0.004
d1zu2a1145 a.118.8.1 (A:1-145) Mitochondrial import receptor 0.001
d1zu2a1145 a.118.8.1 (A:1-145) Mitochondrial import receptor 0.001
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  190 bits (483), Expect = 6e-54
 Identities = 98/392 (25%), Positives = 166/392 (42%), Gaps = 34/392 (8%)

Query: 52  LSYANILRSRNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKL 111
           +  A+       F  A      +  ++  N    +              +    + A+K 
Sbjct: 3   MELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQ 62

Query: 112 DPQNACAHTHCGILYKDEGRLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAG 171
           +P  A A+++ G +YK+ G+L EA E Y  AL   P +      LA  L   G       
Sbjct: 63  NPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQ 122

Query: 172 NTQDG---------------------------IQKYYEALKIDPHYAPAYYNLGVVYSEL 204
                                              Y +A++  P++A A+ NLG V++  
Sbjct: 123 AYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQ 182

Query: 205 MQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNN 264
            +   A+  +EKA    P + +AY N+G + K     + A+A Y R L++SPN  +   N
Sbjct: 183 GEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGN 242

Query: 265 MAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYE 324
           +A    + G        I+  +  Y++A+    H+ DA  NL  A  E      A   Y 
Sbjct: 243 LACVYYEQG-------LIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYN 295

Query: 325 LAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKM 384
            A    P  A++ NNL  I +++ N+++AV  Y+ AL + P F+ + +NL  V   QGK+
Sbjct: 296 TALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKL 355

Query: 385 DAAAEMIEKAIAANPTYAEAYNNLGVLYRDAG 416
             A    ++AI  +PT+A+AY+N+G   ++  
Sbjct: 356 QEALMHYKEAIRISPTFADAYSNMGNTLKEMQ 387


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Length = 265 Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Length = 265 Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 179 Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 179 Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 179 Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308 Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 124 Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 124 Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 124 Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 124 Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 145 Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 145 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query921
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.97
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.97
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.92
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.92
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.91
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.9
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.9
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.88
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.85
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.85
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.76
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.74
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.7
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.7
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.69
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.68
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.62
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.57
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.55
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.54
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.53
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.53
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1rzua_477 Glycogen synthase 1, GlgA {Agrobacterium tumefacie 99.5
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.5
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.5
d2iw1a1370 Lipopolysaccharide core biosynthesis protein RfaG 99.49
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.49
d2bisa1437 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 99.36
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.36
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.35
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.31
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.29
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.29
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.28
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.26
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.24
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.21
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.19
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.16
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.15
d1uqta_456 Trehalose-6-phosphate synthase, OtsA {Escherichia 99.14
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.09
d2bfwa1196 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 98.97
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.95
d2f9fa1166 First mannosyl transferase WbaZ {Archaeoglobus ful 98.91
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.9
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.88
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.87
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.71
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.67
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.61
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.55
d2pq6a1473 (Iso)flavonoid glycosyltransferase {Medicago trunc 98.12
d2c1xa1450 UDP glucose:flavonoid 3-o-glucosyltransferase {Gra 97.94
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.93
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.85
d1iira_401 UDP-glucosyltransferase GtfB {Amycolatopsis orient 97.82
d1pn3a_391 TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi 97.79
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.7
d1rrva_401 TDP-vancosaminyltransferase GftD {Amycolatopsis or 97.7
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.65
d2vcha1471 Hydroquinone glucosyltransferase {Thale cress (Ara 97.37
d2acva1461 Triterpene UDP-glucosyl transferase UGT71G1 {Medic 97.3
d1f0ka_351 Peptidoglycan biosynthesis glycosyltransferase Mur 97.0
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 96.66
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 95.9
d1v4va_373 UDP-N-acetylglucosamine 2-epimerase {Thermus therm 95.58
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 94.69
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 94.08
d1o6ca_377 UDP-N-acetylglucosamine 2-epimerase {Bacillus subt 93.1
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.2e-41  Score=292.96  Aligned_cols=382  Identities=27%  Similarity=0.374  Sum_probs=357.4

Q ss_pred             HHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCC
Q ss_conf             99999999968999999999999998099988999998999998179999999999999809997889999999999839
Q 002438           51 ALSYANILRSRNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKLDPQNACAHTHCGILYKDEG  130 (921)
Q Consensus        51 ~l~~A~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g  130 (921)
                      ++.+|..+++.|+|++|+..|+++++.+|+++.++..+|.++...|++++|+..|+++++.+|+++.++..+|.++...|
T Consensus         2 ll~la~~~~~~G~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g   81 (388)
T d1w3ba_           2 PMELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERG   81 (388)
T ss_dssp             CCTHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHC
T ss_conf             69999999986999999999999998689989999999999998699999999999999859998999999999964200


Q ss_pred             CHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHH
Q ss_conf             97999999999996399995768899999998899999709929999999999941999999999999999981999999
Q 002438          131 RLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTA  210 (921)
Q Consensus       131 ~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A  210 (921)
                      ++++|+..+.++....+.....       ................+...........+................+....+
T Consensus        82 ~~~~A~~~~~~~~~~~~~~~~~-------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  154 (388)
T d1w3ba_          82 QLQEAIEHYRHALRLKPDFIDG-------YINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEA  154 (388)
T ss_dssp             CHHHHHHHHHHHHHHCTTCHHH-------HHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHH
T ss_pred             CCCCCCCCCCCCCCCCCCCCCC-------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHH
T ss_conf             0222222222121122222222-------222222222222222222221112222222222222222222110001356


Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHH
Q ss_conf             99999999839997999999999999879999999999999972999099999899999963356641499999999999
Q 002438          211 LGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYK  290 (921)
Q Consensus       211 ~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~lg~~~~~~~~~~~A~~~~~  290 (921)
                      ...+.+.+...|.....+..+|..+...+++++|...++++++.+|++...+..++.+       +...+++++|+..++
T Consensus       155 ~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~-------~~~~~~~~~A~~~~~  227 (388)
T d1w3ba_         155 KACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNV-------LKEARIFDRAVAAYL  227 (388)
T ss_dssp             HHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHH-------HHTTTCTTHHHHHHH
T ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHH-------HHCCCCHHHHHHHHH
T ss_conf             7888874025861068998636301024719999999999998494649999997155-------220052999999999


Q ss_pred             HHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHH
Q ss_conf             99985899999999999999973996999999999986099999999999999998699899999999999609999999
Q 002438          291 KALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQS  370 (921)
Q Consensus       291 ~al~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~  370 (921)
                      ++....+.....+..+|.++...|++++|+..++++++.+|++..++..+|.++...|++++|+..+++++...|.....
T Consensus       228 ~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~  307 (388)
T d1w3ba_         228 RALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADS  307 (388)
T ss_dssp             HHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCHH
T ss_conf             85777554799999999999987899999999999998499989999999999997487999999998654048730010


Q ss_pred             HHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHH
Q ss_conf             9999999999199999999999999929997999999999999909999999999998620999820576599995
Q 002438          371 LNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAM  446 (921)
Q Consensus       371 ~~~la~~~~~~g~~~~A~~~l~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~~~~a~~~~~~a~  446 (921)
                      +..++.++...|++++|+..++++++.+|+++.++..+|.+|..+|++++|+.+|+++++++|++..++.++..++
T Consensus       308 ~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~~~~a~~~lg~~~  383 (388)
T d1w3ba_         308 LNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTL  383 (388)
T ss_dssp             HHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHH
T ss_conf             1579999998789999999999999868898999999999999859999999999999970999899999999999



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uqta_ c.87.1.6 (A:) Trehalose-6-phosphate synthase, OtsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bfwa1 c.87.1.8 (A:218-413) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2f9fa1 c.87.1.8 (A:2-167) First mannosyl transferase WbaZ {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v4va_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1o6ca_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure