Query         002489
Match_columns 916
No_of_seqs    257 out of 523
Neff          3.2 
Searched_HMMs 46136
Date          Fri Mar 29 00:57:43 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/002489.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/002489hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02362 B3:  B3 DNA binding do  99.6 1.2E-15 2.5E-20  134.3  10.5   99  367-468     1-100 (100)
  2 PF07496 zf-CW:  CW-type Zinc F  99.6 3.7E-16 7.9E-21  127.6   2.0   45  599-644     1-50  (50)
  3 PF03754 DUF313:  Domain of unk  97.8 4.1E-05 8.8E-10   73.1   6.4   79  361-440    18-114 (114)
  4 PF09217 EcoRII-N:  Restriction  97.7 8.6E-05 1.9E-09   74.2   6.8   89  364-452     7-110 (156)
  5 smart00249 PHD PHD zinc finger  79.4     1.8   4E-05   32.8   2.7   30  597-626    10-45  (47)
  6 PF10844 DUF2577:  Protein of u  57.6      36 0.00078   32.0   6.7   78  364-463    18-97  (100)
  7 smart00249 PHD PHD zinc finger  55.4     5.7 0.00012   30.1   0.9   25   77-101    10-34  (47)
  8 PF04014 Antitoxin-MazE:  Antid  50.0      26 0.00057   28.4   3.9   30  435-465    13-42  (47)
  9 PF00628 PHD:  PHD-finger;  Int  40.4      20 0.00043   28.9   1.9   16  595-610     8-23  (51)
 10 PF15396 FAM60A:  Protein Famil  30.8      91   0.002   33.8   5.4   15  732-746    51-65  (213)
 11 TIGR01439 lp_hng_hel_AbrB loop  27.2   1E+02  0.0022   23.8   3.8   28  435-463    13-40  (43)
 12 PF02643 DUF192:  Uncharacteriz  23.3 1.3E+02  0.0029   28.5   4.6   52  401-452    49-107 (108)
 13 KOG4718 Non-SMC (structural ma  22.9      30 0.00065   37.5   0.2   19   82-100   195-213 (235)
 14 COG2947 Uncharacterized conser  22.2      87  0.0019   32.4   3.2   30  435-466    36-65  (156)
 15 COG2002 AbrB Regulators of sta  20.7 1.3E+02  0.0028   27.7   3.8   30  436-467    21-50  (89)
 16 PHA02610 uvsY.-2 hypothetical   20.2      55  0.0012   28.6   1.2   21  712-732     3-30  (53)

No 1  
>PF02362 B3:  B3 DNA binding domain;  InterPro: IPR003340 Two DNA binding proteins, RAV1 and RAV2 from Arabidopsis thaliana contain two distinct amino acid sequence domains found only in higher plant species. The N-terminal regions of RAV1 and RAV2 are homologous to the AP2 DNA-binding domain (see IPR001471 from INTERPRO) present in a family of transcription factors, while the C-terminal region exhibits homology to the highly conserved C-terminal domain, designated B3, of VP1/ABI3 transcription factors []. The AP2 and B3-like domains of RAV1 bind autonomously to the CAACA and CACCTG motifs, respectively, and together achieve a high affinity and specificity of binding. It has been suggested that the AP2 and B3-like domains of RAV1 are connected by a highly flexible structure enabling the two domains to bind to the CAACA and CACCTG motifs in various spacings and orientations [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1WID_A 1YEL_A.
Probab=99.64  E-value=1.2e-15  Score=134.34  Aligned_cols=99  Identities=23%  Similarity=0.424  Sum_probs=70.1

Q ss_pred             EEEecccccCCCCCcEEeehhhhhhcCCCCCCCCCceEEEEeCCCCeEEEEEEEcCCCCCccccccCchhhhhccCCCCC
Q 002489          367 FEKMLSASDAGRIGRLVLPKKCAEAYFPPISQPEGLPLKVQDSKGKEWIFQFRFWPNNNSRMYVLEGVTPCIQNMQLQAG  446 (916)
Q Consensus       367 FeKvLT~SDVgslGRLVIPK~~AEs~FPpLd~~eG~~L~v~D~~GK~WtFRfsyw~NN~SR~YVLeGWs~FVRsK~LqaG  446 (916)
                      |.|+|+++|+.+.++|+||++.++.|.  +....++.|.++|..|+.|.+++.++. +..+.|+..||..||++++|++|
T Consensus         1 F~K~l~~s~~~~~~~l~iP~~f~~~~~--~~~~~~~~v~l~~~~g~~W~v~~~~~~-~~~~~~l~~GW~~Fv~~n~L~~G   77 (100)
T PF02362_consen    1 FFKVLKPSDVSSSCRLIIPKEFAKKHG--GNKRKSREVTLKDPDGRSWPVKLKYRK-NSGRYYLTGGWKKFVRDNGLKEG   77 (100)
T ss_dssp             EEEE--TTCCCCTT-EEE-HHHHTTTS----SS--CEEEEEETTTEEEEEEEEEEC-CTTEEEEETTHHHHHHHCT--TT
T ss_pred             CEEEEEccCcCCCCEEEeCHHHHHHhC--CCcCCCeEEEEEeCCCCEEEEEEEEEc-cCCeEEECCCHHHHHHHcCCCCC
Confidence            899999999998889999999999982  122357899999999999999999883 33443444699999999999999


Q ss_pred             CEEEEEEec-CCCeEEEEEEeCC
Q 002489          447 DIVTFSRLE-PEGKLVMGFRKAS  468 (916)
Q Consensus       447 DtVVF~R~e-~~GkL~IGVRRas  468 (916)
                      |.|+|+... ...++.|.+.|++
T Consensus        78 D~~~F~~~~~~~~~~~v~i~~~~  100 (100)
T PF02362_consen   78 DVCVFELIGNSNFTLKVHIFRKS  100 (100)
T ss_dssp             -EEEEEE-SSSCE-EEEEEE---
T ss_pred             CEEEEEEecCCCceEEEEEEECc
Confidence            999999975 3456799988863


No 2  
>PF07496 zf-CW:  CW-type Zinc Finger;  InterPro: IPR011124 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a CW-type zinc finger motif, named for its conserved cysteine and tryptophan residues. It is predicted to be a highly specialised mononuclear four-cysteine (C4) zinc finger that plays a role in DNA binding and/or promoting protein-protein interactions in complicated eukaryotic processes including chromatin methylation status and early embryonic development. Weak homology to members of IPR001965 from INTERPRO further evidences these predictions. The domain is found exclusively in vertebrates, vertebrate-infecting parasites and higher plants [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2RR4_A 2E61_A 2L7P_A.
Probab=99.59  E-value=3.7e-16  Score=127.57  Aligned_cols=45  Identities=42%  Similarity=1.032  Sum_probs=30.3

Q ss_pred             CceEecCCCccccccCCCC-----CCCCCcEeecCCCCCCCCCCCccccCC
Q 002489          599 IQWVQCEDCSKWRKVPANA-----RLPSKWTCSGNLWDPERSVCSVAQELR  644 (916)
Q Consensus       599 ~~WVQCD~C~KWRrLP~~~-----~lPdkW~CsmN~WDp~~~SCsaPEE~~  644 (916)
                      +.|||||.|+|||+||.++     .+|+.|+|+||+ |+.+++|++|||.+
T Consensus         1 ~~WVQCd~C~KWR~lp~~~~~~~~~~~d~W~C~~n~-~~~~~sC~~pee~e   50 (50)
T PF07496_consen    1 DYWVQCDSCLKWRRLPEEVDPIREELPDPWYCSMNP-DPPFNSCDAPEEIE   50 (50)
T ss_dssp             -EEEE-TTT--EEEE-CCHHCTSCCSSTT--GGGSS--CCC-STTS--SS-
T ss_pred             CeEEECCCCCceeeCChhhCcccccCCCeEEcCCCC-CCCCCCCCCcccCC
Confidence            4799999999999999984     468999999999 89999999999963


No 3  
>PF03754 DUF313:  Domain of unknown function (DUF313) ;  InterPro: IPR005508 This is a family of proteins from Arabidopsis thaliana (Mouse-ear cress) with uncharacterised function.
Probab=97.80  E-value=4.1e-05  Score=73.13  Aligned_cols=79  Identities=20%  Similarity=0.368  Sum_probs=64.2

Q ss_pred             CcccceEEEecccccCCC-CCcEEeehhhhhhcCCCCC---------------CCCCceEEEEeCCCCeEEEEEEEcCC-
Q 002489          361 SVITPLFEKMLSASDAGR-IGRLVLPKKCAEAYFPPIS---------------QPEGLPLKVQDSKGKEWIFQFRFWPN-  423 (916)
Q Consensus       361 s~~~~LFeKvLT~SDVgs-lGRLVIPK~~AEs~FPpLd---------------~~eG~~L~v~D~~GK~WtFRfsyw~N-  423 (916)
                      .....+|+|.|++|||.. ..||.||...... ..+|.               ...|+.+.+.|..++.|..+++.|.- 
T Consensus        18 ~d~kli~~K~L~~tDv~~~qsRLsmP~~qi~~-~dFLt~eE~~~i~~~~~~~~~~~Gv~V~lvdp~~~~~~m~lkkW~mg   96 (114)
T PF03754_consen   18 EDPKLIIEKTLFKTDVDPHQSRLSMPFNQIID-NDFLTEEEKRIIKEEKKNNDKKKGVEVILVDPSLRKWTMRLKKWNMG   96 (114)
T ss_pred             CCCeEEEeeeecccCCCCCCceeeccHHHhcc-cccCCHHHHHHHHHhhccCcccCCceEEEECCcCcEEEEEEEEeccc
Confidence            566899999999999995 6899999987643 23332               35789999999999999999999964 


Q ss_pred             CCCccccc-cCchhhhhc
Q 002489          424 NNSRMYVL-EGVTPCIQN  440 (916)
Q Consensus       424 N~SR~YVL-eGWs~FVRs  440 (916)
                      +..-.|+| .||.+.|.+
T Consensus        97 ~~~~~YvL~~gWn~VV~~  114 (114)
T PF03754_consen   97 NGTSNYVLNSGWNKVVED  114 (114)
T ss_pred             CCceEEEEEcChHhhccC
Confidence            44668999 599998863


No 4  
>PF09217 EcoRII-N:  Restriction endonuclease EcoRII, N-terminal;  InterPro: IPR023372 There are four classes of restriction endonucleases: types I, II,III and IV. All types of enzymes recognise specific short DNA sequences and carry out the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. They differ in their recognition sequence, subunit composition, cleavage position, and cofactor requirements [, ], as summarised below:   Type I enzymes (3.1.21.3 from EC) cleave at sites remote from recognition site; require both ATP and S-adenosyl-L-methionine to function; multifunctional protein with both restriction and methylase (2.1.1.72 from EC) activities. Type II enzymes (3.1.21.4 from EC) cleave within or at short specific distances from recognition site; most require magnesium; single function (restriction) enzymes independent of methylase. Type III enzymes (3.1.21.5 from EC) cleave at sites a short distance from recognition site; require ATP (but doesn't hydrolyse it); S-adenosyl-L-methionine stimulates reaction but is not required; exists as part of a complex with a modification methylase methylase (2.1.1.72 from EC). Type IV enzymes target methylated DNA.   Type II restriction endonucleases (3.1.21.4 from EC) are components of prokaryotic DNA restriction-modification mechanisms that protect the organism against invading foreign DNA. These site-specific deoxyribonucleases catalyse the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. Of the 3000 restriction endonucleases that have been characterised, most are homodimeric or tetrameric enzymes that cleave target DNA at sequence-specific sites close to the recognition site. For homodimeric enzymes, the recognition site is usually a palindromic sequence 4-8 bp in length. Most enzymes require magnesium ions as a cofactor for catalysis. Although they can vary in their mode of recognition, many restriction endonucleases share a similar structural core comprising four beta-strands and one alpha-helix, as well as a similar mechanism of cleavage, suggesting a common ancestral origin []. However, there is still considerable diversity amongst restriction endonucleases [, ]. The target site recognition process triggers large conformational changes of the enzyme and the target DNA, leading to the activation of the catalytic centres. Like other DNA binding proteins, restriction enzymes are capable of non-specific DNA binding as well, which is the prerequisite for efficient target site location by facilitated diffusion. Non-specific binding usually does not involve interactions with the bases but only with the DNA backbone [].  This entry represents the N-terminal effector-binding domain of the type II restriction endonuclease EcoRII, which has a DNA recognition fold, allowing for binding to 5'-CCWGG sequences. It assumes a structure composed of an eight-stranded beta-sheet with the strands in the order of b2, b5, b4, b3, b7, b6, b1 and b8. They are mostly antiparallel to each other except that b3 is parallel to b7. Alternatively, it may also be viewed as consisting of two mini beta-sheets of four antiparallel beta-strands, sheet I from beta-strands b2, b5, b4, b3 and sheet II from strands b7, b6, b1, b8, folded into an open mixed beta-barrel with a novel topology. Sheet I has a simple Greek key motif while sheet II does not [].  The domain represented by this entry is only found in bacterial proteins.; PDB: 3HQF_A 1NA6_A.
Probab=97.68  E-value=8.6e-05  Score=74.22  Aligned_cols=89  Identities=21%  Similarity=0.347  Sum_probs=58.5

Q ss_pred             cceEEEecccccCCCC----CcEEeehhhhhhcCCCCCC----CCCceEEEEeCCC--CeEEEEEEEcCC----CCCccc
Q 002489          364 TPLFEKMLSASDAGRI----GRLVLPKKCAEAYFPPISQ----PEGLPLKVQDSKG--KEWIFQFRFWPN----NNSRMY  429 (916)
Q Consensus       364 ~~LFeKvLT~SDVgsl----GRLVIPK~~AEs~FPpLd~----~eG~~L~v~D~~G--K~WtFRfsyw~N----N~SR~Y  429 (916)
                      ...|.|.||+.|++.+    .++.|||..++.+||.+..    .+.++|.+++..+  ..|+|||+|+-|    ..+..|
T Consensus         7 ~~~~~K~LSaNDtGaTGgHQaGiyIpk~~~~~lFp~~~~~~~~Np~~~~~~~~~s~~~~~~~~r~iYYnn~~~~gTRNE~   86 (156)
T PF09217_consen    7 WAIYCKRLSANDTGATGGHQAGIYIPKSAAELLFPSINHTKEENPDIWLKARWQSHFVTDSQVRFIYYNNRLFGGTRNEY   86 (156)
T ss_dssp             EEEEEEE--CCCCTTTSSS--EEEE-HHHHHHH-GGG-SSSSSS-EEEEEEEETTTT---EEEEEEEE-CCCTTSS--EE
T ss_pred             eEEEEEEccCCCCCCcCcccceeEecccHHHHhCCCCCcccccCCceeEEEEECCCCccceeEEEEEEcccccCCCcCce
Confidence            4689999999999964    4899999999999998764    3558999999877  678899999932    236789


Q ss_pred             cccCchhhhhccC-CCCCCEEEEE
Q 002489          430 VLEGVTPCIQNMQ-LQAGDIVTFS  452 (916)
Q Consensus       430 VLeGWs~FVRsK~-LqaGDtVVF~  452 (916)
                      .+++|+.+..--+ =.+||.++|-
T Consensus        87 RIT~~G~~~~~~~~~~tGaL~vla  110 (156)
T PF09217_consen   87 RITRFGRGFPLQNPENTGALLVLA  110 (156)
T ss_dssp             EEE---TTSGGG-GGGTT-EEEEE
T ss_pred             EEeeecCCCccCCccccccEEEEE
Confidence            9999987766443 3689988876


No 5  
>smart00249 PHD PHD zinc finger. The plant homeodomain (PHD) finger is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in epigenetics and chromatin-mediated transcriptional regulation. The PHD finger binds two zinc ions using the so-called 'cross-brace' motif and is thus structurally related to the PF10844 DUF2577:  Protein of unknown function (DUF2577);  InterPro: IPR022555 This family of proteins has no known function
Probab=57.62  E-value=36  Score=31.99  Aligned_cols=78  Identities=14%  Similarity=0.141  Sum_probs=44.6

Q ss_pred             cceEEEecccccCC--CCCcEEeehhhhhhcCCCCCCCCCceEEEEeCCCCeEEEEEEEcCCCCCccccccCchhhhhcc
Q 002489          364 TPLFEKMLSASDAG--RIGRLVLPKKCAEAYFPPISQPEGLPLKVQDSKGKEWIFQFRFWPNNNSRMYVLEGVTPCIQNM  441 (916)
Q Consensus       364 ~~LFeKvLT~SDVg--slGRLVIPK~~AEs~FPpLd~~eG~~L~v~D~~GK~WtFRfsyw~NN~SR~YVLeGWs~FVRsK  441 (916)
                      ...|-++++.+-+.  -.++|+||++.  -++|.+-......+.+....+.                +-    ..|.-..
T Consensus        18 ~i~~G~V~s~~PL~I~i~~~liL~~~~--L~i~~~l~~~~~~~~~~~~~~~----------------~~----~~i~~~~   75 (100)
T PF10844_consen   18 DIVIGTVVSVPPLKIKIDQKLILDKDF--LIIPELLKDYTRDITIEHNSET----------------DN----ITITFTD   75 (100)
T ss_pred             eeEEEEEEecccEEEEECCeEEEchHH--EEeehhccceEEEEEEeccccc----------------cc----eeEEEec
Confidence            44799999999733  23458888764  2344321112222222222110                00    0055667


Q ss_pred             CCCCCCEEEEEEecCCCeEEEE
Q 002489          442 QLQAGDIVTFSRLEPEGKLVMG  463 (916)
Q Consensus       442 ~LqaGDtVVF~R~e~~GkL~IG  463 (916)
                      .|++||.|...+.+.+.+|+|=
T Consensus        76 ~Lk~GD~V~ll~~~~gQ~yiVl   97 (100)
T PF10844_consen   76 GLKVGDKVLLLRVQGGQKYIVL   97 (100)
T ss_pred             CCcCCCEEEEEEecCCCEEEEE
Confidence            8999999999998644466653


No 7  
>smart00249 PHD PHD zinc finger. The plant homeodomain (PHD) finger is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in epigenetics and chromatin-mediated transcriptional regulation. The PHD finger binds two zinc ions using the so-called 'cross-brace' motif and is thus structurally related to the PF04014 Antitoxin-MazE:  Antidote-toxin recognition MazE;  InterPro: IPR007159 This domain is found in AbrB from Bacillus subtilis. The product of the abrB gene is an ambiactive repressor and activator of the transcription of genes expressed during the transition state between vegetative growth and the onset of stationary phase and sporulation []. AbrB is thought to interact directly with the transcription initiation regions of genes under its control []. AbrB contains a helix-turn-helix structure, but this domain ends before the helix-turn-helix begins []. The product of the B. subtilis gene spoVT is another member of this family and is also a transcriptional regulator []. DNA-binding activity in this AbrB homologue requires hexamerisation []. Another family member has been isolated from the Sulfolobus solfataricus and has been identified as a homologue of bacterial repressor-like proteins. The Escherichia coli family member SohA or Prl1F appears to be bifunctional and is able to regulate its own expression as well as relieve the export block imposed by high-level synthesis of beta-galactosidase hybrid proteins [].; PDB: 2L66_A 2GLW_A 3TND_D 2W1T_B 2RO5_B 2FY9_A 2RO3_B 1UB4_C 3ZVK_G 1YFB_B ....
Probab=49.98  E-value=26  Score=28.44  Aligned_cols=30  Identities=23%  Similarity=0.314  Sum_probs=23.6

Q ss_pred             hhhhhccCCCCCCEEEEEEecCCCeEEEEEE
Q 002489          435 TPCIQNMQLQAGDIVTFSRLEPEGKLVMGFR  465 (916)
Q Consensus       435 s~FVRsK~LqaGDtVVF~R~e~~GkL~IGVR  465 (916)
                      .+|.+..+|++||.|.|.-.+ +|++.|--.
T Consensus        13 k~~~~~l~l~~Gd~v~i~~~~-~g~i~i~p~   42 (47)
T PF04014_consen   13 KEIREKLGLKPGDEVEIEVEG-DGKIVIRPV   42 (47)
T ss_dssp             HHHHHHTTSSTTTEEEEEEET-TSEEEEEES
T ss_pred             HHHHHHcCCCCCCEEEEEEeC-CCEEEEEEC
Confidence            367888899999999999864 667776543


No 9  
>PF00628 PHD:  PHD-finger;  InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the PHD (homeodomain) zinc finger domain [,], which is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in chromatin-mediated transcriptional regulation. The PHD finger motif is reminiscent of, but distinct from the C3HC4 type RING finger. The function of this domain is not yet known but in analogy with the LIM domain it could be involved in protein-protein interaction and be important for the assembly or activity of multicomponent complexes involved in transcriptional activation or repression. Alternatively, the interactions could be intra-molecular and be important in maintaining the structural integrity of the protein. In similarity to the RING finger and the LIM domain, the PHD finger is thought to bind two zinc ions. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0005515 protein binding; PDB: 3ZVY_A 2LGG_A 3SOW_A 3SOU_B 3ASL_A 3ASK_A 3ZVZ_B 3T6R_A 2LGK_A 3SOX_B ....
Probab=40.41  E-value=20  Score=28.89  Aligned_cols=16  Identities=25%  Similarity=0.989  Sum_probs=0.0

Q ss_pred             CCCcCceEecCCCccc
Q 002489          595 VGEKIQWVQCEDCSKW  610 (916)
Q Consensus       595 ~ge~~~WVQCD~C~KW  610 (916)
                      ......|||||.|..|
T Consensus         8 ~~~~~~~i~C~~C~~~   23 (51)
T PF00628_consen    8 SDDDGDMIQCDSCNRW   23 (51)
T ss_dssp             SCTTSSEEEBSTTSCE
T ss_pred             cCCCCCeEEcCCCChh


No 10 
>PF15396 FAM60A:  Protein Family FAM60A
Probab=30.84  E-value=91  Score=33.80  Aligned_cols=15  Identities=33%  Similarity=0.946  Sum_probs=11.2

Q ss_pred             ccchhhhhhhhhhhh
Q 002489          732 TCNVCLTVKRRFHTL  746 (916)
Q Consensus       732 tcnvc~tvkrrfktl  746 (916)
                      .||.|.-.=.|||.|
T Consensus        51 ICNACVLLVKRwKKL   65 (213)
T PF15396_consen   51 ICNACVLLVKRWKKL   65 (213)
T ss_pred             hhHHHHHHHHHHhhC
Confidence            699998776777654


No 11 
>TIGR01439 lp_hng_hel_AbrB looped-hinge helix DNA binding domain, AbrB family. This DNA-binding domain family includes AbrB, a transition state regulator in Bacillus subtilis, whose DNA-binding domain structure in solution was determined by NMR. The domain binds DNA as a dimer in what is termed a looped-hinge helix fold. Some members of the family have two copies of the domain in tandem. The domain is found usually at the N-terminus of a small protein. This model excludes members of family TIGR02609.
Probab=27.15  E-value=1e+02  Score=23.83  Aligned_cols=28  Identities=21%  Similarity=0.514  Sum_probs=22.8

Q ss_pred             hhhhhccCCCCCCEEEEEEecCCCeEEEE
Q 002489          435 TPCIQNMQLQAGDIVTFSRLEPEGKLVMG  463 (916)
Q Consensus       435 s~FVRsK~LqaGDtVVF~R~e~~GkL~IG  463 (916)
                      .+|.+..++..||.|.|.... +|.+.|-
T Consensus        13 ~~~r~~l~~~~gd~~~i~~~~-~~~l~l~   40 (43)
T TIGR01439        13 KEIREKLGLKEGDRLEVIRVE-DGEIILR   40 (43)
T ss_pred             HHHHHHcCcCCCCEEEEEEeC-CCEEEEE
Confidence            478999999999999999764 6777653


No 12 
>PF02643 DUF192:  Uncharacterized ACR, COG1430;  InterPro: IPR003795 This entry describes proteins of unknown function.; PDB: 3M7A_B 3PJY_B.
Probab=23.25  E-value=1.3e+02  Score=28.47  Aligned_cols=52  Identities=23%  Similarity=0.273  Sum_probs=29.9

Q ss_pred             CceEEEEeCCCCeEEEEEEEcCCC-------CCccccccCchhhhhccCCCCCCEEEEE
Q 002489          401 GLPLKVQDSKGKEWIFQFRFWPNN-------NSRMYVLEGVTPCIQNMQLQAGDIVTFS  452 (916)
Q Consensus       401 G~~L~v~D~~GK~WtFRfsyw~NN-------~SR~YVLeGWs~FVRsK~LqaGDtVVF~  452 (916)
                      -+.|.+.|..|++=....-..|..       ..-.|||+-=..++..++|++||.|.|-
T Consensus        49 pLDi~fld~~g~Vv~i~~~~~P~~~~~~~~~~~a~~vLE~~aG~~~~~~i~~Gd~v~~~  107 (108)
T PF02643_consen   49 PLDIAFLDSDGRVVKIERMVPPWRTYPCPSYKPARYVLELPAGWFEKLGIKVGDRVRIE  107 (108)
T ss_dssp             -EEEEEE-TTSBEEEEEEEE-TT--S-EEECCEECEEEEEETTHHHHHT--TT-EEE--
T ss_pred             eEEEEEECCCCeEEEEEccCCCCccCCCCCCCccCEEEEcCCCchhhcCCCCCCEEEec
Confidence            367777777777655554432211       1236899866777899999999999873


No 13 
>KOG4718 consensus Non-SMC (structural maintenance of chromosomes) element 1 protein (NSE1) [Chromatin structure and dynamics]
Probab=22.88  E-value=30  Score=37.51  Aligned_cols=19  Identities=37%  Similarity=0.752  Sum_probs=15.9

Q ss_pred             ccccccCCceeechhhhhh
Q 002489           82 RCCESCGKRVHCGCITSVH  100 (916)
Q Consensus        82 R~C~~CgKrlHCGCI~S~~  100 (916)
                      +.|.+||-|.|||||.--.
T Consensus       195 ~rCg~c~i~~h~~c~qty~  213 (235)
T KOG4718|consen  195 IRCGSCNIQYHRGCIQTYL  213 (235)
T ss_pred             eccCcccchhhhHHHHHHh
Confidence            4688999999999998543


No 14 
>COG2947 Uncharacterized conserved protein [Function unknown]
Probab=22.19  E-value=87  Score=32.45  Aligned_cols=30  Identities=13%  Similarity=0.294  Sum_probs=21.6

Q ss_pred             hhhhhccCCCCCCEEEEEEecCCCeEEEEEEe
Q 002489          435 TPCIQNMQLQAGDIVTFSRLEPEGKLVMGFRK  466 (916)
Q Consensus       435 s~FVRsK~LqaGDtVVF~R~e~~GkL~IGVRR  466 (916)
                      ..|+|+  .+.||.+.||-..-.+-=++|+-+
T Consensus        36 RNfmR~--M~iGD~~fFYHSNc~~pgIvGl~~   65 (156)
T COG2947          36 RNFMRD--MKIGDLGFFYHSNCKPPGIVGLAE   65 (156)
T ss_pred             HHHHHh--cccCceEEEEecCCCCCCceehhh
Confidence            368888  789999999997545544555544


No 15 
>COG2002 AbrB Regulators of stationary/sporulation gene expression [Transcription]
Probab=20.66  E-value=1.3e+02  Score=27.71  Aligned_cols=30  Identities=13%  Similarity=0.279  Sum_probs=22.6

Q ss_pred             hhhhccCCCCCCEEEEEEecCCCeEEEEEEeC
Q 002489          436 PCIQNMQLQAGDIVTFSRLEPEGKLVMGFRKA  467 (916)
Q Consensus       436 ~FVRsK~LqaGDtVVF~R~e~~GkL~IGVRRa  467 (916)
                      ..-+..+|++||.|.|+.....|++  -++|.
T Consensus        21 eiR~~lgi~~Gd~lei~~~~~~~~i--vl~k~   50 (89)
T COG2002          21 EIREALGIKEGDVLEIIVDGDGGRI--VLKKY   50 (89)
T ss_pred             HHHHHhCCCCCCEEEEEEeCCCCEE--EEEEC
Confidence            4567789999999999998756773  34444


No 16 
>PHA02610 uvsY.-2 hypothetical protein; Provisional
Probab=20.24  E-value=55  Score=28.64  Aligned_cols=21  Identities=48%  Similarity=0.991  Sum_probs=17.2

Q ss_pred             ceeeecCCCC-------CCCCCCCCccc
Q 002489          712 SCIVCIQPPS-------GKGPKHKQTCT  732 (916)
Q Consensus       712 scivCiqPps-------Gkgpkhk~tct  732 (916)
                      -|+||-||=.       .+||-|-.-|-
T Consensus         3 iCvvCK~Pi~~al~v~T~~Gpvh~g~C~   30 (53)
T PHA02610          3 ICVVCKQPIEKALVVETEKGPVHPGPCY   30 (53)
T ss_pred             eeeeeCCchhhceEEecCCCCCCChhHH
Confidence            4999999954       68999998874


Done!