Citrus Sinensis ID: 002512

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910----
MGNFSFVEGDWVLKILKTGFVVHFLMLSNLLRLVNGLGSMSSIAISYGENGPVFCGLKSDRSHLVTCYGSNSAIIYGTPAHFPFIGLTAGDGFVCGLLLDSNQPYCWGSSGYIQMGVPQPIIKGAQYVEISAGDYHLCGLRKPLTGKWRNYSYVDCWGYNMTKNYVFDGQIESISAGSEFNCGLFSQNRTVFCWGDESSSRVISLIPKEMKFQKVAAGGYHVCGILEGLDSRTRCWGRSLDLEEEVSVAYSRQGNVDLPPSDPMLSIVGGKFHACGIKSYDRGVICWGFIIKPSTPVPTGIKVYEIAAGNYFTCGVLAEKSMLPVCWGTGFPTSLPLAVSPGLCKMTPCAPGYYEASQENAPCKSPNAHVCITCSNGCPVEMYQTAECTLKSDRVCEYNCSSCFSAECYKNCSSQFSDGLTTKKNEKFWSMQLPVIIAEITIAVFLITVVTLISILYVRYRLRNCQCSGKASKSQKTNGAGSPYQKDNGKIRPDFDDLKIRRAQMFTYEELERATGGFKEEVGKGSFSCVYKGVLKDGTVVAVKKAIATSDRQKNSKEFHTELDLLSRLNHAHLLNLLGYCEEGRERLLVYEFMAHGSLHQHLHGKSKALKEQLDWVRRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVADFGLSLLGPADSSSPLAELPAGTLGYLDPEYYRLHYLTTKSDVYSFGVLLLEILSGRKAIDMQFEEGNIVEWAVPLIKSGDITAILDPVLKLPSDLDALKRIANVACKCVRMRGKERPSMDKVTTALERALAQLMGSPCSEQPILPTEVVLGSNRMHKKSSQRSSNRSTSETDVAEAEDQRFEFRAPSWITFPSVTSSQRRKSSVSDADVDGKNLEARNMGNAGSIGDGLRSLEEEIGPASPQENLYLQHNF
cccccCCccEEEEEEEHHHHHHHHHHHHHHHHHHcccccccEEEEEECccccEEEEEEccccEEEEEECcccccccccccccccEEEEccccEEEcccccccccccccccccccccccccccccccccEEcccccEEEEEEccccccccccccEEEccccccccccccccEEEEEccccCEEEEEccccEEEEEccccccccccccccccEEEEEEEcccEEEEEECcccccEEEECccccccHHHHccccccccccccccccEEEEECcccCEEEEEEcccCEEEcccccccccccccccEEEEEEEccccEEEECcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEHHHHHHHHHHHHHHHHHHHHHEcccccccccccccccccccccccccccccccccccccccccccEEEcHHHHHHHHcccccccccccccEEEEEEEccccEEEEEEccccccccccHHHHHHHHHHHHcccccccccEEEEEccccEEEEEEEEcccccHHHccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEccccccccccccccccccccccccccccccHHHHcccccccccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccHHHHHcccccccccccccccc
******VEGDWVLKILKTGFVVHFLMLSNLLRLVNGLGSMSSIAISYGENGPVFCGLKSDRSHLVTCYGSNSAIIYGTPAHFPFIGLTAGDGFVCGLLLDSNQPYCWGSSGYIQMGVPQPIIKGAQYVEISAGDYHLCGLRKPLTGKWRNYSYVDCWGYNMTKNYVFDGQIESISAGSEFNCGLFSQNRTVFCWGDESSSRVISLIPKEMKFQKVAAGGYHVCGILEGLDSRTRCWGRSLDLEEEVSVAYSRQGNVDLPPSDPMLSIVGGKFHACGIKSYDRGVICWGFIIKPSTPVPTGIKVYEIAAGNYFTCGVLAEKSMLPVCWGTGFPTSLPLAVSPGLCKMTPCAPGYYEASQENAPCKSPNAHVCITCSNGCPVEMYQTAECTLKSDRVCEYNCSSCFSAECYKNCSSQFSDGLTTKKNEKFWSMQLPVIIAEITIAVFLITVVTLISILYVRYRLRNC***********************************RRAQMFTYEELERATGGFKEEVGKGSFSCVYKGVLKDGTVVAVKKAIAT*********FHTELDLLSRLNHAHLLNLLGYCEEGRERLLVYEFMAHGSLHQHLHGKSKALKEQLDWVRRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVADFGLSLLGPADSSSPLAELPAGTLGYLDPEYYRLHYLTTKSDVYSFGVLLLEILSGRKAIDMQFEEGNIVEWAVPLIKSGDITAILDPVLKLPSDLDALKRIANVACKCVRMRGKERPSMDKVTTALERAL******************************************************************************************************************LYLQHN*
xxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNFSFVEGDWVLKILKTGFVVHFLMLSNLLRLVNGLGSMSSIAISYGENGPVFCGLKSDRSHLVTCYGSNSAIIYGTPAHFPFIGLTAGDGFVCGLLLDSNQPYCWGSSGYIQMGVPQPIIKGAQYVEISAGDYHLCGLRKPLTGKWRNYSYVDCWGYNMTKNYVFDGQIESISAGSEFNCGLFSQNRTVFCWGDESSSRVISLIPKEMKFQKVAAGGYHVCGILEGLDSRTRCWGRSLDLEEEVSVAYSRQGNVDLPPSDPMLSIVGGKFHACGIKSYDRGVICWGFIIKPSTPVPTGIKVYEIAAGNYFTCGVLAEKSMLPVCWGTGFPTSLPLAVSPGLCKMTPCAPGYYEASQENAPCKSPNAHVCITCSNGCPVEMYQTAECTLKSDRVCEYNCSSCFSAECYKNCSSQFSDGLTTKKNEKFWSMQLPVIIAEITIAVFLITVVTLISILYVRYRLRNCQCSGKASKSQKTNGAGSPYQKDNGKIRPDFDDLKIRRAQMFTYEELERATGGFKEEVGKGSFSCVYKGVLKDGTVVAVKKAIATSDRQKNSKEFHTELDLLSRLNHAHLLNLLGYCEEGRERLLVYEFMAHGSLHQHLHGKSKALKEQLDWVRRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVADFGLSLLGPADSSSPLAELPAGTLGYLDPEYYRLHYLTTKSDVYSFGVLLLEILSGRKAIDMQFEEGNIVEWAVPLIKSGDITAILDPVLKLPSDLDALKRIANVACKCVRMRGKERPSMDKVTTALERALAQLMGSPCSEQPILPTEVVLGSNRMHKKSSQRSSNRSTSETDVAEAEDQRFEFRAPSWITFPSVTSSQRRKSSVSDADVDGKNLEARNMGNAGSIGDGLRSLEEEIGPASPQENLYLQHNF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein kinase-like protein ACR4 Controls formative cell division in meristems, including root tips and lateral root initiation zones of the pericycle, in response to CLE40 signal. Acts with CLE40p peptide as a ligand-receptor pair in a signal transduction pathway, coordinating movement of the root tip and organization of cell divisions in the root meristem. Required during embryogenesis and development, probably for the differentiation of protoderm and epidermal cells. Involved in the regulation of cellular organization during the development of sepal margins and ovule integument outgrowth. Can phosphorylate ALE2.probableQ9LX29
Putative receptor protein kinase CRINKLY4 Putative receptor protein kinase. Could play a role in a differentiation signal. The CRINKLY4 (CR4) mutation affects leaf epidermis differentiation such that cell size and morphology are altered, and surface functions are compromised, allowing graft-like fusions between organs.probableO24585

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QKW, chain B
Confidence level:very confident
Coverage over the Query: 507-794
View the alignment between query and template
View the model in PyMOL
Template: 3P86, chain A
Confidence level:very confident
Coverage over the Query: 498-664,684-794
View the alignment between query and template
View the model in PyMOL
Template: 4APC, chain A
Confidence level:confident
Coverage over the Query: 529-820
View the alignment between query and template
View the model in PyMOL
Template: 2PZI, chain A
Confidence level:probable
Coverage over the Query: 520-737,748-808,822-898
View the alignment between query and template
View the model in PyMOL
Template: 4D9S, chain A
Confidence level:probable
Coverage over the Query: 32-321
View the alignment between query and template
View the model in PyMOL
Template: 3QHY, chain B
Confidence level:probable
Coverage over the Query: 54-239,250-316
View the alignment between query and template
View the model in PyMOL
Template: 3U3P, chain A
Confidence level:probable
Coverage over the Query: 340-400
View the alignment between query and template
View the model in PyMOL