BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 002605
         (901 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|P41234|ABCA2_MOUSE ATP-binding cassette sub-family A member 2 OS=Mus musculus GN=Abca2
           PE=1 SV=4
          Length = 2434

 Score = 35.0 bits (79), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 31/73 (42%), Gaps = 5/73 (6%)

Query: 188 CGNRAVLRHRPLERRNSSWFSLWKKEERNTWLAKFLRMNELKDQVCSSWFAPVGSASDYP 247
           CGN   +    L R N S      KE+RN  L   L  +  K       +APVGS +D  
Sbjct: 417 CGNNRTIEPEALRRGNMSSLGFTSKEQRNLGLLVHLMTSNPK-----ILYAPVGSEADRV 471

Query: 248 LLSKWVIYGELGN 260
           +L     +  +GN
Sbjct: 472 ILKANETFAFVGN 484


>sp|Q9ESR9|ABCA2_RAT ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus
           GN=Abca2 PE=1 SV=1
          Length = 2434

 Score = 34.7 bits (78), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 31/73 (42%), Gaps = 5/73 (6%)

Query: 188 CGNRAVLRHRPLERRNSSWFSLWKKEERNTWLAKFLRMNELKDQVCSSWFAPVGSASDYP 247
           CGN   +    L R N S      KE+RN  L   L  +  K       +AP GS +D+ 
Sbjct: 417 CGNNRTIEPEALRRGNMSSLGFTSKEQRNLGLLVHLMTSNPK-----ILYAPAGSEADHV 471

Query: 248 LLSKWVIYGELGN 260
           +L     +  +GN
Sbjct: 472 ILKANETFAFVGN 484


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.327    0.141    0.462 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 357,887,376
Number of Sequences: 539616
Number of extensions: 15982094
Number of successful extensions: 40583
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 40576
Number of HSP's gapped (non-prelim): 11
length of query: 901
length of database: 191,569,459
effective HSP length: 127
effective length of query: 774
effective length of database: 123,038,227
effective search space: 95231587698
effective search space used: 95231587698
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 66 (30.0 bits)