Citrus Sinensis ID: 002632


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------90
MGLLFAFMVMALCATPSALSLRGSAVTVALPPRRLPQNLPNIQPVSPGHPPSILPDHTYSPIRSPHGSGRKSHGEVLPPPNKPHHISSTKHYSPTKGAHSHDAMRPSSITPAPSSLSSFRGPTKKWVHGPASSPFIPFHRHHHVRNKSRNSGSGPAYPTPAPSNSQQGPSVPSFQSPLPSSSSWSSHAPAPSPKATSGNLNLPSLRPTISPTSSSLKKMKTPPPSSVMTLPPPPPNEDCGSVTCTEPLTYTPPGSPCGCVWPIQVKLALDVPIYTFFPLVSQLTEEIAASVGLNHSQVRVMGANAASQQLQKSTALINLVPLGVQFDDTVAFLIFKKFWQRQVFIKPSLFGAYEVLYVHYPGLPPSPPSQSSISTEDDGPYAGRDNKRQALKPLGVEVPMRKKGGLRGSMIAAIVLSSFTALVLCFGIAVFLLKRGAFRQPEQTPHDVICAPAKLSAGATTTLRYGSMLSSSSVSIDSCAVTYTGTAKTFTLNDIEKATNGFHTSRIIGEGGFGVVYRGILDDGREVAVKVLKRANQHGGREFLAELEMLSRLHHRNLVKLFGVCIEDNNRCLVYELIHNGSLESHLHGDDKVNGPLDWDARMKIALGAARGLAYLHEDSSPRVIHRDFKSSNILLEHDFTPKVSDFGLARTALDEGNKHISTHVMGTFGYLAPEYAMTGHLLVKSDVYSYGVVLLELLTGRKPVDLSQPPGQENLVAWARPLLTTKEGLKTIIDPVIESNISYDTLVKVAAIASMCVQPEVSHRPFMGEVVQALKLVCNEFDETKETIESRDLSEDCSISVDSKVNRLSGEFVEALEVCHTRSGYGVGHDNSMAISASEMITPMGLEGQESGSFRRHSSSGPLRSEGRRQFWQILKSSSRGSMREHGFSSKFWPESH
ccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcEEEEEEEEccccccccHHHHHHHHHHHHcccccccEEEEEEEEcccccccEEEEEEEccccccccHHHHHHHHHHHccccEEcccccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccEEEHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccEEEEEEEccccEEEEEEcccccccccHHHHHHHHHHHcccccccccEEEEEEcccEEEEEEEEcccccHHHHccccccccccccHHHHHHHHHHHHHHHHHHcccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccHHHHHHHHHHcccccccccccccccHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccc
cccHEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcEEEEEEcccccccccccHHHHHHcccccEEEEEcEEEEEccccccccccEEEEEEEccccccccccccHHHHHcccccccEEcccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccEEcHHHHHHHHccccHHHEEccccccEEEEEEcccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHEEEEEcccccEEEEEEEcccccHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHcccHccEEcccccHHHEEEcccccEEEccccccEEcccccccEEEEEEEcccccccHHHHHccccEEcccHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHccccHHHHccccHcccccHHHHHHHHHHHHHHHcccHcccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccc
MGLLFAFMVMALCAtpsalslrgsavtvalpprrlpqnlpniqpvspghppsilpdhtyspirsphgsgrkshgevlpppnkphhisstkhysptkgahshdamrpssitpapsslssfrgptkkwvhgpasspfipfhrhhhvrnksrnsgsgpayptpapsnsqqgpsvpsfqsplpsssswsshapapspkatsgnlnlpslrptisptssslkkmktpppssvmtlpppppnedcgsvtctepltytppgspcgcvwpiQVKLaldvpiytffpLVSQLTEEIAASVGLNHSQVRVMGANAASQQLqkstalinlvplgvqfdDTVAFLIFKKFWqrqvfikpslfGAYEVLYvhypglppsppsqssisteddgpyagrdnkrqalkplgvevpmrkkgglrGSMIAAIVLSSFTALVLCFGIAVFLLkrgafrqpeqtphdvicapaklsagatttlrygsmlssssvsidscavtytgtaktftlndiekatngfhtsriigegGFGVVYRGILDDGREVAVKVLKRANQHGGREFLAELEMLSRLHHRNLVKLFGvciednnrCLVYELIHNgsleshlhgddkvngpldWDARMKIALGAARGLaylhedssprvihrdfkssnillehdftpkvsdfglartaldegnkhisthvmgtfgylapeyamtgHLLVKSDVYSYGVVLLELLtgrkpvdlsqppgqenLVAWARPLLTTKEGLKTIidpviesnisyDTLVKVAAIASMcvqpevshrpfMGEVVQALKLVCNEFdetketiesrdlsedcsisvDSKVNRLSGEFVEALEVChtrsgygvghdnsmaISASemitpmglegqesgsfrrhsssgplrsegRRQFWQILKSssrgsmrehgfsskfwpesh
MGLLFAFMVMALCATPSALSLRGSAVTVALPPRRLPQNLPNIQPVSPGHPPSILPDHTYSPIRSPHGSGRKSHGEVLPPPNKPHHISSTKHYSPTKGAHSHDAMRPSSITPAPSSLSSFRGPTKKWVHGPASSPFIPFHRHHHVRNKSRNSGSGPAYPTPAPSNSQQGPSVPSFQSPLPSSSSWSSHAPAPSPkatsgnlnlpslrptisptssslkkmktpppssVMTLPPPPPNEDCGSVTCTEPLTYTPPGSPCGCVWPIQVKLALDVPIYTFFPLVSQLTEEIAASVGLNHSQVRVMGANAASQQLQKSTALINLVPLGVQFDDTVAFLIFKKFWQRQVFIKPSLFGAYEVLYVHYPGLPPSPPSQSSISTEDDGPYAGRdnkrqalkplgvevpmrkKGGLRGSMIAAIVLSSFTALVLCFGIAVFLLKRGAFRQPEQTPHDVICAPAKLSAGATTTLRYGSMLSSSSVSIDSCAVTYTGtaktftlndiEKATNGFHTSRIIGEGGFGVVYRGILDDGREVAVKVLKRANQHGGREFLAELEMLSRLHHRNLVKLFGVCIEDNNRCLVYELIHNGSLESHLHGDDKVNGPLDWDARMKIALGAARGLAYlhedssprvIHRDFKSSNILLEHDFTPKVSDFGLARTALDEGNKHISTHVMGTFGYLAPEYAMTGHLLVKSDVYSYGVVLLELLTGrkpvdlsqppgqeNLVAWARPLLTTKEGLKTiidpviesnISYDTLVKVAAIASMCVQPEVSHRPFMGEVVQALKLVCNEFDETketiesrdlsedcsiSVDSKVNRLSGEFVEALEVCHTRSGYGVGHDNSMAISASEMITPMGLEGQESGSFRRHsssgplrsegrrQFWQILksssrgsmrehgfsskfwpesh
MGLLFAFMVMALCATPSALSLRGSAVTVAlpprrlpqnlpnIQPVSPGHPPSILPDHTYSPIRSPHGSGRKSHGEVLPPPNKPHHISSTKHYSPTKGAHSHDAMRpssitpapsslssFRGPTKKWVHGPASSPFIPFHRHHHVRNKSRNSGSGPAYPTPAPSNSQQGpsvpsfqsplpsssswsshapapspkatsGNLNLPSLRPTISPTSSSLKKMKtpppssvmtlpppppNEDCGSVTCTEPLTYTPPGSPCGCVWPIQVKLALDVPIYTFFPLVSQLTEEIAASVGLNHSQVRVMGANAASQQLQKSTALINLVPLGVQFDDTVAFLIFKKFWQRQVFIKPSLFGAYEVLYVHYpglppsppsqssisTEDDGPYAGRDNKRQALKPLGVEVPMRKKGGLRGSMIAAIVLSSFTALVLCFGIAVFLLKRGAFRQPEQTPHDVICAPAKLSAGATTTLRYGsmlssssvsidsCAVTYTGTAKTFTLNDIEKATNGFHTSRIIGEGGFGVVYRGILDDGREVAVKVLKRANQHGGREFLAELEMLSRLHHRNLVKLFGVCIEDNNRCLVYELIHNGSLESHLHGDDKVNGPLDWDARMKIALGAARGLAYLHEDSSPRVIHRDFKSSNILLEHDFTPKVSDFGLARTALDEGNKHISTHVMGTFGYLAPEYAMTGHLLVKSDVYSYGVVLLELLTGRKPVDLSQPPGQENLVAWARPLLTTKEGLKTIIDPVIESNISYDTLVKVAAIASMCVQPEVSHRPFMGEVVQALKLVCNEFDETKETIESRDLSEDCSISVDSKVNRLSGEFVEALEVCHTRSGYGVGHDNSMAISASEMITPMGLEGQESGSFRRHSSSGPLRSEGRRQFWQILKSSSRGSMREHGFSSKFWPESH
**LLFAFMVMALCATPSALSLRGSAVTVA********************************************************************************************************************************************************************************************************************VTCTEPLTYTPPGSPCGCVWPIQVKLALDVPIYTFFPLVSQLTEEIAASVGLNHSQVRVMGANAASQQLQKSTALINLVPLGVQFDDTVAFLIFKKFWQRQVFIKPSLFGAYEVLYVHYPG******************************************GLRGSMIAAIVLSSFTALVLCFGIAVFLLKRGAFRQPEQTPHDVICAPAKLSAGATTTLRYGSMLSSSSVSIDSCAVTYTGTAKTFTLNDIEKATNGFHTSRIIGEGGFGVVYRGILDDGREVAVKVLKRANQHGGREFLAELEMLSRLHHRNLVKLFGVCIEDNNRCLVYELIHNGSLESHLHGDDKVNGPLDWDARMKIALGAARGLAYLHEDSSPRVIHRDFKSSNILLEHDFTPKVSDFGLARTALDEGNKHISTHVMGTFGYLAPEYAMTGHLLVKSDVYSYGVVLLELLTGRKPVDL*****QENLVAWARPLLTTKEGLKTIIDPVIESNISYDTLVKVAAIASMCVQPEVSHRPFMGEVVQALKLVCNEFDET************CSISVDSKVNRLSGEFVEALEVCHTRSGYGVGH********************************************************************
**LLFAFMVMALCATPSAL*******************************************************************************************************************************************************************************************************************************TCTEPLTYTPPGSPCGCVWPIQVKLALDVPIYTFFPLVSQLTEEIAASVGLNHSQVRVMGANAASQQLQKSTALINLVPLGVQFDDTVAFLIFKKFWQRQVFIKPSLFGAYEVLYVHY**************************************************IAAIVLSSFTALVLCFGIAVFLL*******************************************************TFTLNDIEKATNGFHTSRIIGEGGFGVVYRGILDDGREVAVKVLKRANQHGGREFLAELEMLSRLHHRNLVKLFGVCIEDNNRCLVYELIHNGSLESHLHGDDKVNGPLDWDARMKIALGAARGLAYLHEDSSPRVIHRDFKSSNILLEHDFTPKVSDFGLARTALDEGNKHISTHVMGTFGYLAPEYAMTGHLLVKSDVYSYGVVLLELLTGRKPVDLSQPPGQENLVAWARPLLTTKEGLKTIIDPVIESNISYDTLVKVAAIASMCVQPEVSHRPFMGEVVQALKL*************************************************************************************************************************
MGLLFAFMVMALCATPSALSLRGSAVTVALPPRRLPQNLPNIQPVSPGHPPSILPDHTYSPIR*************LPPPNK************************SSITPAPSSLSSFRGPTKKWVHGPASSPFIPFHRHHH*****************************************************SGNLNLPSLRPTIS*******************LPPPPPNEDCGSVTCTEPLTYTPPGSPCGCVWPIQVKLALDVPIYTFFPLVSQLTEEIAASVGLNHSQVRVMGANAASQQLQKSTALINLVPLGVQFDDTVAFLIFKKFWQRQVFIKPSLFGAYEVLYVHYPGLPP***************YAGRDNKRQALKPLGVEVPMRKKGGLRGSMIAAIVLSSFTALVLCFGIAVFLLKRGAFRQPEQTPHDVICAPAKLSAGATTTLRYGSMLSSSSVSIDSCAVTYTGTAKTFTLNDIEKATNGFHTSRIIGEGGFGVVYRGILDDGREVAVKVLKRANQHGGREFLAELEMLSRLHHRNLVKLFGVCIEDNNRCLVYELIHNGSLESHLHGDDKVNGPLDWDARMKIALGAARGLAYLHEDSSPRVIHRDFKSSNILLEHDFTPKVSDFGLARTALDEGNKHISTHVMGTFGYLAPEYAMTGHLLVKSDVYSYGVVLLELLTGRKPVDLSQPPGQENLVAWARPLLTTKEGLKTIIDPVIESNISYDTLVKVAAIASMCVQPEVSHRPFMGEVVQALKLVCNEFDETKETIESRDLSEDCSISVDSKVNRLSGEFVEALEVCHTRSGYGVGHDNSMAISASEMITPMGLEG*****************EGRRQFWQILKS********************
*GLLFAFMVMALCATPSALSLR******************NIQP*S*GHP***********************************************************************************************************PTPAP*****GPSVPSFQSPLPSSSSWSSHAPAPSPKATSGNLNLPSLRPTISPTSSSLKKMKTPPPSSVMTLPPPPPNEDCGSVTCTEPLTYTPPGSPCGCVWPIQVKLALDVPIYTFFPLVSQLTEEIAASVGLNHSQVRVMGANAASQQLQKSTALINLVPLGVQFDDTVAFLIFKKFWQRQVFIKPSLFGAYEVLYVHYPGLPPSPPSQSSISTEDDGPYAG***********************RGSMIAAIVLSSFTALVLCFGIAVFLLKRGAF********************************************YTGTAKTFTLNDIEKATNGFHTSRIIGEGGFGVVYRGILDDGREVAVKVLKRANQHGGREFLAELEMLSRLHHRNLVKLFGVCIEDNNRCLVYELIHNGSLESHLHGDDKVNGPLDWDARMKIALGAARGLAYLHEDSSPRVIHRDFKSSNILLEHDFTPKVSDFGLARTALDEGNKHISTHVMGTFGYLAPEYAMTGHLLVKSDVYSYGVVLLELLTGRKPVDLSQPPGQENLVAWARPLLTTKEGLKTIIDPVIESNISYDTLVKVAAIASMCVQPEVSHRPFMGEVVQALKLVCNEFD*******************************************************************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLLFAFMVMALCATPSALSLRGSAVTVALPPRRLPQNLPNIQPVSPGHPPSILPDHTYSPIRSPHGSGRKSHGEVLPPPNKPHHISSTKHYSPTKGAHSHDAMRPSSITPAPSSLSSFRGPTKKWVHGPASSPFIPFHRHHHVRNKSRNSGSGPAYPTPAPSNSQQGPSVPSFQSPLPSSSSWSSHAPAPSPKATSGNLNLPSLRPTISPTSSSLKKMKTPPPSSVMTLPPPPPNEDCGSVTCTEPLTYTPPGSPCGCVWPIQVKLALDVPIYTFFPLVSQLTEEIAASVGLNHSQVRVMGANAASQQLQKSTALINLVPLGVQFDDTVAFLIFKKFWQRQVFIKPSLFGAYEVLYVHYPGLPPSPPSQSSISTEDDGPYAGRDNKRQALKPLGVEVPMRKKGGLRGSMIAAIVLSSFTALVLCFGIAVFLLKRGAFRQPEQTPHDVICAPAKLSAGATTTLRYGSMLSSSSVSIDSCAVTYTGTAKTFTLNDIEKATNGFHTSRIIGEGGFGVVYRGILDDGREVAVKVLKRANQHGGREFLAELEMLSRLHHRNLVKLFGVCIEDNNRCLVYELIHNGSLESHLHGDDKVNGPLDWDARMKIALGAARGLAYLHEDSSPRVIHRDFKSSNILLEHDFTPKVSDFGLARTALDEGNKHISTHVMGTFGYLAPEYAMTGHLLVKSDVYSYGVVLLELLTGRKPVDLSQPPGQENLVAWARPLLTTKEGLKTIIDPVIESNISYDTLVKVAAIASMCVQPEVSHRPFMGEVVQALKLVCNEFDETKETIESRDLSEDCSISVDSKVNRLSGEFVEALEVCHTRSGYGVGHDNSMAISASEMITPMGLEGQESGSFRRHSSSGPLRSEGRRQFWQILKSSSRGSMREHGFSSKFWPESH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query898 2.2.26 [Sep-21-2011]
Q8RWW0744 Receptor-like serine/thre no no 0.683 0.825 0.493 1e-167
Q9SX31708 Proline-rich receptor-lik no no 0.405 0.514 0.484 2e-90
Q9C660762 Proline-rich receptor-lik no no 0.321 0.379 0.528 1e-83
Q9FFW5681 Proline-rich receptor-lik no no 0.328 0.433 0.504 2e-83
Q9FE20456 Serine/threonine-protein no no 0.335 0.660 0.518 4e-83
Q9SGY7718 Putative proline-rich rec no no 0.389 0.487 0.454 5e-83
Q9CAL8710 Proline-rich receptor-lik no no 0.410 0.519 0.418 1e-81
Q9LFP7493 Probable receptor-like pr no no 0.338 0.616 0.492 8e-81
Q9LV48652 Proline-rich receptor-lik no no 0.317 0.437 0.505 2e-80
Q9ZUE0720 Proline-rich receptor-lik no no 0.320 0.4 0.515 2e-80
>sp|Q8RWW0|ALE2_ARATH Receptor-like serine/threonine-protein kinase ALE2 OS=Arabidopsis thaliana GN=ALE2 PE=1 SV=1 Back     alignment and function desciption
 Score =  588 bits (1516), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 334/677 (49%), Positives = 426/677 (62%), Gaps = 63/677 (9%)

Query: 234 PPNEDCGSVTCTEPLTYTPPGSPCGCVWPIQVKLALDVPIYTFFPLVSQLTEEIAASVGL 293
           P + DC   TC EPLT TP GSPCGCV+P++V+L L V  ++ FP+ ++L  E+AA   L
Sbjct: 93  PSSHDCQQ-TCVEPLTSTPFGSPCGCVFPMKVQLLLSVAPFSIFPVTNELEIEVAAGTYL 151

Query: 294 NHSQVRVMGANAASQQLQKSTALINLVPLGVQFDDTVAFLIFKKFWQRQVFIKPSLFGAY 353
             SQV++MGA+A S+   K+   INLVPLG +FD+T A LI+++F  ++V +  ++FG Y
Sbjct: 152 EQSQVKIMGASADSENQGKTVVDINLVPLGEKFDNTTATLIYQRFRHKKVPLNETVFGDY 211

Query: 354 EVLYVHYPGLPPSPPSQSSISTEDDGPYAGRDNKRQALKPLGVEVPMR------KKGGLR 407
           EV ++ YPG+P S P         +G   G         P G+ +P+       K  G+ 
Sbjct: 212 EVTHISYPGIPSSSP---------NGDVTGD-------APGGLPIPINATTFANKSQGIG 255

Query: 408 GSMIAAIVLSSFTALVLCFGIAVFLLKRGAFRQPEQTPHDVICAPAKLSAGA---TTTLR 464
              IA I LS F  +++  G    ++K     +        +        GA    ++  
Sbjct: 256 FRTIAIIALSGFVLILVLVGAISIIVKWKKIGKSSNAVGPALAPSINKRPGAGSMFSSSA 315

Query: 465 YGSMLSSSSVSIDSCAVTYTGTAKTFTLNDIEKATNGFHTSRIIGEGGFGVVYRGILDDG 524
             S   S   S+ +CA++     KTFTL+++EKAT+ F   R++GEGGFG VY+G ++DG
Sbjct: 316 RSSGSDSLMSSMATCALS----VKTFTLSELEKATDRFSAKRVLGEGGFGRVYQGSMEDG 371

Query: 525 REVAVKVLKRANQHGGREFLAELEMLSRLHHRNLVKLFGVCIEDNNRCLVYELIHNGSLE 584
            EVAVK+L R NQ+  REF+AE+EMLSRLHHRNLVKL G+CIE   RCL+YEL+HNGS+E
Sbjct: 372 TEVAVKLLTRDNQNRDREFIAEVEMLSRLHHRNLVKLIGICIEGRTRCLIYELVHNGSVE 431

Query: 585 SHLHGDDKVNGPLDWDARMKIALGAARGLAYLHEDSSPRVIHRDFKSSNILLEHDFTPKV 644
           SHLH      G LDWDAR+KIALGAARGLAYLHEDS+PRVIHRDFK+SN+LLE DFTPKV
Sbjct: 432 SHLH-----EGTLDWDARLKIALGAARGLAYLHEDSNPRVIHRDFKASNVLLEDDFTPKV 486

Query: 645 SDFGLARTALDEGNKHISTHVMGTFGYLAPEYAMTGHLLVKSDVYSYGVVLLELLTGRKP 704
           SDFGLAR A  EG++HIST VMGTFGY+APEYAMTGHLLVKSDVYSYGVVLLELLTGR+P
Sbjct: 487 SDFGLAREA-TEGSQHISTRVMGTFGYVAPEYAMTGHLLVKSDVYSYGVVLLELLTGRRP 545

Query: 705 VDLSQPPGQENLVAWARPLLTTKEGLKTIIDPVIESNISYDTLVKVAAIASMCVQPEVSH 764
           VD+SQP G+ENLV WARPLL  +EGL+ ++DP +    ++D + KVAAIASMCV  EVSH
Sbjct: 546 VDMSQPSGEENLVTWARPLLANREGLEQLVDPALAGTYNFDDMAKVAAIASMCVHQEVSH 605

Query: 765 RPFMGEVVQALKLVCNEFDET---------KETIESRDLSEDCSISVDSKVNRLSGEFVE 815
           RPFMGEVVQALKL+ N+ DET             +S D   D + S DS    L+     
Sbjct: 606 RPFMGEVVQALKLIYNDADETCGDYCSQKDSSVPDSADFKGDLAPS-DSSWWNLTPRLRY 664

Query: 816 ALEVCHTRSGYGVGHDNSMAI---SASEMITPMGLEGQESGSFRRHSSSGPLR-SEGRRQ 871
                     Y  G    M     SAS +           G     + SGPLR    RR 
Sbjct: 665 GQASSFITMDYSSGPLEDMENRPHSASSI--------PRVGGLILPNRSGPLRPMRSRRN 716

Query: 872 FWQILKSSSRGSMREHG 888
           F+++     RGSM EHG
Sbjct: 717 FFRL-----RGSMSEHG 728




Required during the differentiation of the protoderm into shoots epidermis and cuticle.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9SX31|PERK9_ARATH Proline-rich receptor-like protein kinase PERK9 OS=Arabidopsis thaliana GN=PERK9 PE=2 SV=1 Back     alignment and function description
>sp|Q9C660|PEK10_ARATH Proline-rich receptor-like protein kinase PERK10 OS=Arabidopsis thaliana GN=PERK10 PE=1 SV=2 Back     alignment and function description
>sp|Q9FFW5|PERK8_ARATH Proline-rich receptor-like protein kinase PERK8 OS=Arabidopsis thaliana GN=PERK8 PE=1 SV=1 Back     alignment and function description
>sp|Q9FE20|PBS1_ARATH Serine/threonine-protein kinase PBS1 OS=Arabidopsis thaliana GN=PBS1 PE=1 SV=1 Back     alignment and function description
>sp|Q9SGY7|PEK11_ARATH Putative proline-rich receptor-like protein kinase PERK11 OS=Arabidopsis thaliana GN=PERK11 PE=2 SV=2 Back     alignment and function description
>sp|Q9CAL8|PEK13_ARATH Proline-rich receptor-like protein kinase PERK13 OS=Arabidopsis thaliana GN=PERK13 PE=2 SV=1 Back     alignment and function description
>sp|Q9LFP7|Y5158_ARATH Probable receptor-like protein kinase At5g15080 OS=Arabidopsis thaliana GN=At5g15080 PE=1 SV=1 Back     alignment and function description
>sp|Q9LV48|PERK1_ARATH Proline-rich receptor-like protein kinase PERK1 OS=Arabidopsis thaliana GN=PERK1 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZUE0|PEK12_ARATH Proline-rich receptor-like protein kinase PERK12 OS=Arabidopsis thaliana GN=PERK12 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query898
359482516873 PREDICTED: receptor-like serine/threonin 0.858 0.883 0.673 0.0
449480567899 PREDICTED: LOW QUALITY PROTEIN: receptor 0.966 0.965 0.588 0.0
449447857899 PREDICTED: receptor-like serine/threonin 0.966 0.965 0.588 0.0
356522430848 PREDICTED: receptor-like serine/threonin 0.914 0.968 0.616 0.0
307136283902 protein kinase [Cucumis melo subsp. melo 0.968 0.964 0.588 0.0
255572945846 ATP binding protein, putative [Ricinus c 0.908 0.964 0.643 0.0
297743085815 unnamed protein product [Vitis vinifera] 0.903 0.995 0.596 0.0
351725445886 protein kinase family protein [Glycine m 0.869 0.881 0.616 0.0
147856502772 hypothetical protein VITISV_031742 [Viti 0.854 0.993 0.541 0.0
359484309992 PREDICTED: receptor-like serine/threonin 0.947 0.857 0.539 0.0
>gi|359482516|ref|XP_002275886.2| PREDICTED: receptor-like serine/threonine-protein kinase ALE2-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1009 bits (2609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/793 (67%), Positives = 613/793 (77%), Gaps = 22/793 (2%)

Query: 124 KKWVHGPASSPFIPFHRHHHVRNKSRNSGSGPAYPTPAPSNSQQGPSVPSFQSPLPSSSS 183
           KK VHG ASSP   F+RHHH RNK RNS   P++       SQQGPSV SF SP+PSS+S
Sbjct: 83  KKHVHGSASSPTTSFYRHHHARNKFRNSAPAPSHLLSPHPYSQQGPSVSSFHSPVPSSTS 142

Query: 184 WSSHAPAPSPKATSGNLNLPSLR----------------PTISPTSSSLKKMKTPPPSSV 227
           W S +PAPSP   S  +N+   +                P ++P  SSLK MKTPPP  V
Sbjct: 143 WGSPSPAPSPAPLSRQINMIINKYHAVIMFCVCKVHFHPPAVAPLGSSLKNMKTPPPPLV 202

Query: 228 MTLPPPPPNEDCGSVTCTEPLTYTPPGSPCGCVWPIQVKLALDVPIYTFFPLVSQLTEEI 287
            TLPPPPPNEDC S+TCTEPLTYTPPGSPCGCVWPIQVKL L V +YTFFPLVS+L +EI
Sbjct: 203 WTLPPPPPNEDCASLTCTEPLTYTPPGSPCGCVWPIQVKLRLSVALYTFFPLVSELADEI 262

Query: 288 AASVGLNHSQVRVMGANAASQQLQKSTALINLVPLGVQFDDTVAFLIFKKFWQRQVFIKP 347
           AA V LNHSQVR+MGANAA+QQL K+  LI+LVPLG +F+ T AF I++KFW ++ FIK 
Sbjct: 263 AAGVSLNHSQVRIMGANAANQQLDKTIILIDLVPLGEKFNHTTAFSIYEKFWLKKFFIKT 322

Query: 348 SLFGAYEVLYVHYPGLPPSPPSQSSISTEDDGPYAGRDNKRQALKPLGVEVPMRKKGGLR 407
           SL+G YE LYV YPGLPPS    SSIS  DDG Y+G  N  + +KPLGV+VP ++K GL 
Sbjct: 323 SLYGGYEALYVRYPGLPPS--PPSSISNIDDGSYSGHGNNGRVMKPLGVDVPQKQKHGLG 380

Query: 408 GSMIAAIVLSSFTALVLCFGIA-VFLLK-RGAFRQPEQTPHDVICAPAKLSAGATTTLRY 465
           GSMI  IVLSS T  V+C  +A V +LK RG   Q E  PH +I + AK S GA  ++  
Sbjct: 381 GSMITVIVLSSVTGFVICIAVAWVLVLKCRGHVHQAEDIPHSLISSFAKPS-GAAGSMML 439

Query: 466 GSMLSSSSVSIDSCAVTYTGTAKTFTLNDIEKATNGFHTSRIIGEGGFGVVYRGILDDGR 525
           GS  SS+SVS  S  VTYTG+AKTF+LNDIE+AT+ F  SR++GEGGFG+VYRGILDDG 
Sbjct: 440 GSRTSSTSVSFSSGVVTYTGSAKTFSLNDIERATDNFDASRVLGEGGFGLVYRGILDDGV 499

Query: 526 EVAVKVLKRANQHGGREFLAELEMLSRLHHRNLVKLFGVCIEDNNRCLVYELIHNGSLES 585
           EVAVKVLKR +Q GGREFLAE+EMLSRLHHRNLVKL G+C E++ RCLVYEL+ NGS+ES
Sbjct: 500 EVAVKVLKRDDQQGGREFLAEVEMLSRLHHRNLVKLIGICTEEHTRCLVYELVPNGSVES 559

Query: 586 HLHGDDKVNGPLDWDARMKIALGAARGLAYLHEDSSPRVIHRDFKSSNILLEHDFTPKVS 645
           HLHG DK   PLDW ARMKIALGAARGLAYLHEDSSPRVIHRDFKSSNILLEHDFTPKVS
Sbjct: 560 HLHGVDKEASPLDWGARMKIALGAARGLAYLHEDSSPRVIHRDFKSSNILLEHDFTPKVS 619

Query: 646 DFGLARTALDEGNKHISTHVMGTFGYLAPEYAMTGHLLVKSDVYSYGVVLLELLTGRKPV 705
           DFGLARTALDEGNKHIST VMGTFGYLAPEYAMTGHLLVKSDVYSYGVVLLELLTGRKPV
Sbjct: 620 DFGLARTALDEGNKHISTRVMGTFGYLAPEYAMTGHLLVKSDVYSYGVVLLELLTGRKPV 679

Query: 706 DLSQPPGQENLVAWARPLLTTKEGLKTIIDPVIESNISYDTLVKVAAIASMCVQPEVSHR 765
           DLSQPPGQENLVAWARPLLTTKEGL+TIIDP ++S+  +D+  KVAAIASMCVQPEVSHR
Sbjct: 680 DLSQPPGQENLVAWARPLLTTKEGLETIIDPALKSSSPFDSAAKVAAIASMCVQPEVSHR 739

Query: 766 PFMGEVVQALKLVCNEFDETKETIESRDLSEDCSISVDSKVNRLSGEFVEALEVCHTRSG 825
           PFMGEVVQALKLVC+E+DETK+        E+ SI V  K +R+ GE +E  +V H  +G
Sbjct: 740 PFMGEVVQALKLVCSEYDETKDLASKSFSQENLSIDVIRKSSRVLGELLEVSQVHHPVAG 799

Query: 826 YGVGHDNSMAISASEMI-TPMGLEGQESGSFRRHSSSGPLRSEGRRQFWQILKSSSRGSM 884
           +    D  MA+S S+++ T MG EGQ+SGSFRR+SSSGPL +  RR+FWQ L+ SS GS 
Sbjct: 800 HDSSFDTKMALSVSDLVSTSMGFEGQDSGSFRRYSSSGPLSTGRRREFWQRLRRSSGGSA 859

Query: 885 REHGFSSKFWPES 897
            EHGFS K WP S
Sbjct: 860 SEHGFSFKLWPRS 872




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449480567|ref|XP_004155932.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like serine/threonine-protein kinase ALE2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449447857|ref|XP_004141683.1| PREDICTED: receptor-like serine/threonine-protein kinase ALE2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356522430|ref|XP_003529849.1| PREDICTED: receptor-like serine/threonine-protein kinase ALE2-like [Glycine max] Back     alignment and taxonomy information
>gi|307136283|gb|ADN34110.1| protein kinase [Cucumis melo subsp. melo] Back     alignment and taxonomy information
>gi|255572945|ref|XP_002527403.1| ATP binding protein, putative [Ricinus communis] gi|223533213|gb|EEF34969.1| ATP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297743085|emb|CBI35952.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|351725445|ref|NP_001235301.1| protein kinase family protein [Glycine max] gi|223452462|gb|ACM89558.1| protein kinase family protein [Glycine max] Back     alignment and taxonomy information
>gi|147856502|emb|CAN78643.1| hypothetical protein VITISV_031742 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359484309|ref|XP_003633096.1| PREDICTED: receptor-like serine/threonine-protein kinase ALE2-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query898
TAIR|locus:5049548861113 AT5G56890 [Arabidopsis thalian 0.713 0.575 0.583 5.2e-199
TAIR|locus:2038992744 ALE2 "Abnormal Leaf Shape 2" [ 0.695 0.840 0.487 1e-148
TAIR|locus:2132168725 AT4G02010 [Arabidopsis thalian 0.387 0.48 0.528 1.4e-99
TAIR|locus:2026846710 PERK13 "proline-rich extensin- 0.320 0.405 0.515 2.7e-85
TAIR|locus:2026925708 PERK9 "proline-rich extensin-l 0.405 0.514 0.473 5e-85
TAIR|locus:2019938718 PERK11 "proline-rich extensin- 0.319 0.399 0.530 5.1e-83
TAIR|locus:2099009400 AT3G58690 [Arabidopsis thalian 0.339 0.762 0.522 1.8e-80
TAIR|locus:2028756762 PERK10 "proline-rich extensin- 0.321 0.379 0.528 5.8e-80
TAIR|locus:2159873681 PERK8 "proline-rich extensin-l 0.316 0.417 0.517 9.5e-80
UNIPROTKB|Q9ARH1647 Q9ARH1 "Receptor protein kinas 0.321 0.446 0.5 1.4e-78
TAIR|locus:504954886 AT5G56890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1849 (655.9 bits), Expect = 5.2e-199, Sum P(2) = 5.2e-199
 Identities = 385/660 (58%), Positives = 459/660 (69%)

Query:   236 NEDCGSVTCTEPLTYTPPGSPCGCVWPIQVKLALDVPIYTFFPLVSQLTEEIAASVGLNH 295
             N DC S  C EP T TPPGSPCGCVWPIQV+L L + +Y FFP+VS+   EI+A V +  
Sbjct:   455 NSDCSSTICLEPYTNTPPGSPCGCVWPIQVELRLSMALYDFFPMVSEFAREISAGVFMKQ 514

Query:   296 SQVRVMGANAASQQLQKSTALINLVPLGVQFDDTVAFLIFKKFWQRQVFIKPSLFGAYEV 355
             SQVR+MGANAAS+Q +KS  LI+LVPLG +FD+  A L +++FW ++V+I   +FG Y+V
Sbjct:   515 SQVRIMGANAASEQPEKSIVLIDLVPLGDKFDNMTAMLTYQRFWSKKVYIDEPIFGGYDV 574

Query:   356 LYVHYXXXXXXXXXXXXXXTEDDGPYAGRDNKRQALKPLGVEVPMR-KKGGLRGSMIAAI 414
             +YV Y                D GPY+G +N R A+KPLGV+VP + +K  L G  IA I
Sbjct:   575 IYVRYPGLPASPPTSGMTII-DQGPYSGNNNGR-AVKPLGVDVPRKPRKKELNGGSIAVI 632

Query:   415 VLSSFTALVLCFGIAVFLL---KRGAFRQPEQTPHDVICAPAKLS--AGATTTLRYGXXX 469
             VLS+   + LCF I  FL+   +R   R  ++TP      P+ LS  +G+  +L  G   
Sbjct:   633 VLSAAAFIGLCFVIVWFLVFRRQRDRRRLSKRTPLARPSLPS-LSKPSGSARSLT-GSRF 690

Query:   470 XXXXXXXXXCAVTYTGTAKTFTLNDIEKATNGFHTSRIIGEGGFGVVYRGILDDGREVAV 529
                          +T +AKTFT ++I KATN F  SR++GEGGFG VY G+ DDG +VAV
Sbjct:   691 SSTSLSFESSIAPFTLSAKTFTASEIMKATNNFDESRVLGEGGFGRVYEGVFDDGTKVAV 750

Query:   530 KVLKRANQHGGREFLAELEMLSRLHHRNLVKLFGVCIEDNNRCLVYELIHNGSLESHLHG 589
             KVLKR +Q G REFLAE+EMLSRLHHRNLV L G+CIED NR LVYELI NGS+ESHLHG
Sbjct:   751 KVLKRDDQQGSREFLAEVEMLSRLHHRNLVNLIGICIEDRNRSLVYELIPNGSVESHLHG 810

Query:   590 DDKVNGPLDWDARMKIALGAARGLAYLHEDSSPRVIHRDFKSSNILLEHDFTPKVSDFGL 649
              DK + PLDWDAR+KIALGAARGLAYLHEDSSPRVIHRDFKSSNILLE+DFTPKVSDFGL
Sbjct:   811 IDKASSPLDWDARLKIALGAARGLAYLHEDSSPRVIHRDFKSSNILLENDFTPKVSDFGL 870

Query:   650 ARTALD-EGNKHISTHVMGTFGYLAPEYAMTGHLLVKSDVYSYGVVLLELLTGRKPVDLS 708
             AR ALD E N+HIST VMGTFGY+APEYAMTGHLLVKSDVYSYGVVLLELLTGRKPVD+S
Sbjct:   871 ARNALDDEDNRHISTRVMGTFGYVAPEYAMTGHLLVKSDVYSYGVVLLELLTGRKPVDMS 930

Query:   709 QPPGQENLVAWARPLLTTKEGLKTIIDPVIESNISYDTLVKVAAIASMCVQPEVSHRPFM 768
             QPPGQENLV+W RP LT+ EGL  IID  +   IS+D++ KVAAIASMCVQPEVSHRPFM
Sbjct:   931 QPPGQENLVSWTRPFLTSAEGLAAIIDQSLGPEISFDSIAKVAAIASMCVQPEVSHRPFM 990

Query:   769 GEVVQALKLVCNEFDETKETIESRDLSEDCSISVDSKVNRLSGEFVEALEVCHTRSGYGV 828
             GEVVQALKLV NE DE KE      +S+D     D++     G+    +        Y  
Sbjct:   991 GEVVQALKLVSNECDEAKELNSLTSISKD-DFRDDTQAESSCGDSSARMARYPLLPNYDS 1049

Query:   829 GHDNSMAISASEMITPMGLEGQESGSFRRHSSSGPLRSEGRRQFWQILKSSSRGSMREHG 888
               D    +S SEM T  G     SG F R S+SGPL S   + FWQ ++  S GS+ EHG
Sbjct:  1050 EPDTERGLSTSEMYT--G-----SGRFERQSNSGPLTSGRGKSFWQKMRRLSTGSLSEHG 1102


GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
TAIR|locus:2038992 ALE2 "Abnormal Leaf Shape 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132168 AT4G02010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026846 PERK13 "proline-rich extensin-like receptor kinase 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026925 PERK9 "proline-rich extensin-like receptor kinase 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019938 PERK11 "proline-rich extensin-like receptor kinase 11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2099009 AT3G58690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2028756 PERK10 "proline-rich extensin-like receptor kinase 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2159873 PERK8 "proline-rich extensin-like receptor kinase 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9ARH1 Q9ARH1 "Receptor protein kinase PERK1" [Brassica napus (taxid:3708)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.7.11.10.824
3rd Layer2.7.110.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00034175001
SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (765 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query898
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 2e-55
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 8e-55
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 6e-54
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 4e-53
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 1e-52
pfam00069260 pfam00069, Pkinase, Protein kinase domain 2e-52
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 1e-49
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 2e-40
cd05148261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 4e-35
cd05049280 cd05049, PTKc_Trk, Catalytic domain of the Protein 3e-34
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 1e-33
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 3e-33
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 4e-32
cd05038284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 4e-32
cd05039256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 4e-32
cd05068261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 3e-31
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 7e-31
cd05034261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 3e-30
cd05112256 cd05112, PTKc_Itk, Catalytic domain of the Protein 7e-30
cd05032277 cd05032, PTKc_InsR_like, Catalytic domain of Insul 3e-29
cd05060257 cd05060, PTKc_Syk_like, Catalytic domain of Spleen 7e-29
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 1e-28
cd05040257 cd05040, PTKc_Ack_like, Catalytic domain of the Pr 1e-28
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 3e-28
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 3e-28
cd05059256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 1e-27
cd07829282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 2e-27
cd05041251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 3e-27
cd05048283 cd05048, PTKc_Ror, Catalytic Domain of the Protein 5e-27
cd05092280 cd05092, PTKc_TrkA, Catalytic domain of the Protei 1e-26
cd05093288 cd05093, PTKc_TrkB, Catalytic domain of the Protei 1e-26
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 2e-26
cd05094291 cd05094, PTKc_TrkC, Catalytic domain of the Protei 2e-26
cd05057279 cd05057, PTKc_EGFR_like, Catalytic domain of Epide 3e-26
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-26
cd05033266 cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec 1e-25
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 2e-25
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 2e-25
cd05067260 cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro 2e-25
cd05044269 cd05044, PTKc_c-ros, Catalytic domain of the Prote 3e-25
cd05083254 cd05083, PTKc_Chk, Catalytic domain of the Protein 7e-25
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 1e-24
cd05058262 cd05058, PTKc_Met_Ron, Catalytic domain of the Pro 2e-24
cd06608275 cd06608, STKc_myosinIII_like, Catalytic domain of 3e-24
cd05080283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 3e-24
cd05046275 cd05046, PTK_CCK4, Pseudokinase domain of the Prot 8e-24
cd05082256 cd05082, PTKc_Csk, Catalytic domain of the Protein 1e-23
cd05070260 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro 1e-23
cd05118283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 1e-23
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 2e-23
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 2e-23
cd05113256 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro 2e-23
cd07834330 cd07834, STKc_MAPK, Catalytic domain of the Serine 2e-23
cd05085250 cd05085, PTKc_Fer, Catalytic domain of the Protein 3e-23
cd05071262 cd05071, PTKc_Src, Catalytic domain of the Protein 7e-23
cd07841298 cd07841, STKc_CDK7, Catalytic domain of the Serine 1e-22
cd05052263 cd05052, PTKc_Abl, Catalytic domain of the Protein 1e-22
cd05065269 cd05065, PTKc_EphR_B, Catalytic domain of the Prot 1e-22
cd05072261 cd05072, PTKc_Lyn, Catalytic domain of the Protein 2e-22
cd07833288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 3e-22
cd06631265 cd06631, STKc_YSK4, Catalytic domain of the Protei 4e-22
cd05090283 cd05090, PTKc_Ror1, Catalytic domain of the Protei 5e-22
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 6e-22
cd06621287 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of 7e-22
cd05096304 cd05096, PTKc_DDR1, Catalytic domain of the Protei 7e-22
cd05079284 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) doma 1e-21
cd05063268 cd05063, PTKc_EphR_A2, Catalytic domain of the Pro 1e-21
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 1e-21
cd05095296 cd05095, PTKc_DDR2, Catalytic domain of the Protei 1e-21
cd05069260 cd05069, PTKc_Yes, Catalytic domain of the Protein 2e-21
cd05053293 cd05053, PTKc_FGFR, Catalytic domain of the Protei 2e-21
cd05035273 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-li 3e-21
cd08224267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 4e-21
cd08221256 cd08221, STKc_Nek9, Catalytic domain of the Protei 4e-21
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 5e-21
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 6e-21
cd05097295 cd05097, PTKc_DDR_like, Catalytic domain of Discoi 6e-21
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 6e-21
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 8e-21
cd05050288 cd05050, PTKc_Musk, Catalytic domain of the Protei 9e-21
cd05055302 cd05055, PTKc_PDGFR, Catalytic domain of the Prote 1e-20
cd06620284 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of 1e-20
cd05081284 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) 1e-20
cd05114256 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro 3e-20
cd05045290 cd05045, PTKc_RET, Catalytic domain of the Protein 3e-20
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 3e-20
cd05036277 cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro 4e-20
cd05056270 cd05056, PTKc_FAK, Catalytic domain of the Protein 6e-20
cd05062277 cd05062, PTKc_IGF-1R, Catalytic domain of the Prot 6e-20
cd06611280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 2e-19
cd05066267 cd05066, PTKc_EphR_A, Catalytic domain of the Prot 2e-19
cd05051296 cd05051, PTKc_DDR, Catalytic domain of the Protein 2e-19
cd05110303 cd05110, PTKc_HER4, Catalytic domain of the Protei 3e-19
cd05577277 cd05577, STKc_GRK, Catalytic domain of the Protein 4e-19
cd07852337 cd07852, STKc_MAPK15, Catalytic domain of the Seri 4e-19
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 5e-19
cd07858337 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of 8e-19
cd05073260 cd05073, PTKc_Hck, Catalytic domain of the Protein 9e-19
cd05088303 cd05088, PTKc_Tie2, Catalytic domain of the Protei 9e-19
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 1e-18
cd05061288 cd05061, PTKc_InsR, Catalytic domain of the Protei 1e-18
cd06917277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 1e-18
cd07832286 cd07832, STKc_CCRK, Catalytic domain of the Serine 2e-18
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 3e-18
cd07846286 cd07846, STKc_CDKL2_3, Catalytic domain of the Ser 4e-18
cd05109279 cd05109, PTKc_HER2, Catalytic domain of the Protei 4e-18
cd05111279 cd05111, PTK_HER3, Pseudokinase domain of the Prot 7e-18
cd05099314 cd05099, PTKc_FGFR4, Catalytic domain of the Prote 1e-17
cd05089297 cd05089, PTKc_Tie1, Catalytic domain of the Protei 1e-17
cd06619279 cd06619, PKc_MKK5, Catalytic domain of the dual-sp 1e-17
cd05047270 cd05047, PTKc_Tie, Catalytic domain of Tie Protein 1e-17
cd07845309 cd07845, STKc_CDK10, Catalytic domain of the Serin 1e-17
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 2e-17
cd07835283 cd07835, STKc_CDK1_like, Catalytic domain of Cycli 2e-17
cd05084252 cd05084, PTKc_Fes, Catalytic domain of the Protein 2e-17
cd06613262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 3e-17
cd08220256 cd08220, STKc_Nek8, Catalytic domain of the Protei 3e-17
cd05091283 cd05091, PTKc_Ror2, Catalytic domain of the Protei 5e-17
cd07838287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 6e-17
cd06624268 cd06624, STKc_ASK, Catalytic domain of the Protein 6e-17
cd06607307 cd06607, STKc_TAO, Catalytic domain of the Protein 8e-17
cd07842316 cd07842, STKc_CDK8_like, Catalytic domain of Cycli 9e-17
cd07839284 cd07839, STKc_CDK5, Catalytic domain of the Serine 1e-16
cd05116257 cd05116, PTKc_Syk, Catalytic domain of the Protein 1e-16
cd06648285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 1e-16
cd07853372 cd07853, STKc_NLK, Catalytic domain of the Serine/ 1e-16
cd07849336 cd07849, STKc_ERK1_2_like, Catalytic domain of Ext 1e-16
cd05108316 cd05108, PTKc_EGFR, Catalytic domain of the Protei 2e-16
cd05608280 cd05608, STKc_GRK1, Catalytic domain of the Protei 2e-16
cd05115257 cd05115, PTKc_Zap-70, Catalytic domain of the Prot 2e-16
cd06616288 cd06616, PKc_MKK4, Catalytic domain of the dual-sp 2e-16
cd05098307 cd05098, PTKc_FGFR1, Catalytic domain of the Prote 4e-16
cd07864302 cd07864, STKc_CDK12, Catalytic domain of the Serin 4e-16
cd06644292 cd06644, STKc_STK10_LOK, Catalytic domain of the P 5e-16
cd07866311 cd07866, STKc_BUR1, Catalytic domain of the Serine 6e-16
cd05580290 cd05580, STKc_PKA, Catalytic domain of the Protein 6e-16
cd06649331 cd06649, PKc_MEK2, Catalytic domain of the dual-sp 6e-16
cd05075272 cd05075, PTKc_Axl, Catalytic domain of the Protein 6e-16
cd07861285 cd07861, STKc_CDK1_euk, Catalytic domain of the Se 8e-16
cd06641277 cd06641, STKc_MST3, Catalytic domain of the Protei 9e-16
cd07847286 cd07847, STKc_CDKL1_4, Catalytic domain of the Ser 1e-15
cd07877345 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of 1e-15
cd05064266 cd05064, PTKc_EphR_A10, Catalytic domain of the Pr 1e-15
cd07859338 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of 1e-15
cd07830283 cd07830, STKc_MAK_like, Catalytic domain of Male g 2e-15
cd06642277 cd06642, STKc_STK25-YSK1, Catalytic domain of the 2e-15
cd07851343 cd07851, STKc_p38, Catalytic domain of the Serine/ 2e-15
cd05043280 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Rece 2e-15
cd07860284 cd07860, STKc_CDK2_3, Catalytic domain of the Seri 2e-15
cd08228267 cd08228, STKc_Nek6, Catalytic domain of the Protei 3e-15
cd05074273 cd05074, PTKc_Tyro3, Catalytic domain of the Prote 3e-15
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 3e-15
cd05630285 cd05630, STKc_GRK6, Catalytic domain of the Protei 4e-15
cd08225257 cd08225, STKc_Nek5, Catalytic domain of the Protei 4e-15
cd06658292 cd06658, STKc_PAK5, Catalytic domain of the Protei 5e-15
cd05572262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 5e-15
cd05042269 cd05042, PTKc_Aatyk, Catalytic domain of the Prote 5e-15
cd07855334 cd07855, STKc_ERK5, Catalytic domain of the Serine 5e-15
cd08229267 cd08229, STKc_Nek7, Catalytic domain of the Protei 8e-15
cd05101304 cd05101, PTKc_FGFR2, Catalytic domain of the Prote 8e-15
cd06615308 cd06615, PKc_MEK, Catalytic domain of the dual-spe 9e-15
cd07862290 cd07862, STKc_CDK6, Catalytic domain of the Serine 1e-14
cd05100334 cd05100, PTKc_FGFR3, Catalytic domain of the Prote 1e-14
cd06618296 cd06618, PKc_MKK7, Catalytic domain of the dual-sp 1e-14
cd07836284 cd07836, STKc_Pho85, Catalytic domain of the Serin 2e-14
cd05582318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 2e-14
cd05570318 cd05570, STKc_PKC, Catalytic domain of the Protein 2e-14
cd08218256 cd08218, STKc_Nek1, Catalytic domain of the Protei 2e-14
cd08222260 cd08222, STKc_Nek11, Catalytic domain of the Prote 3e-14
cd07843293 cd07843, STKc_CDC2L1, Catalytic domain of the Seri 3e-14
cd06635317 cd06635, STKc_TAO1, Catalytic domain of the Protei 3e-14
cd06633313 cd06633, STKc_TAO3, Catalytic domain of the Protei 3e-14
cd06657292 cd06657, STKc_PAK4, Catalytic domain of the Protei 3e-14
cd08528269 cd08528, STKc_Nek10, Catalytic domain of the Prote 4e-14
cd05590320 cd05590, STKc_nPKC_eta, Catalytic domain of the Pr 4e-14
cd06636282 cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr 6e-14
cd05632285 cd05632, STKc_GRK5, Catalytic domain of the Protei 8e-14
cd06634308 cd06634, STKc_TAO2, Catalytic domain of the Protei 9e-14
cd07857332 cd07857, STKc_MPK1, Catalytic domain of the Serine 9e-14
cd06647293 cd06647, STKc_PAK_I, Catalytic domain of the Prote 9e-14
cd06617283 cd06617, PKc_MKK3_6, Catalytic domain of the dual- 1e-13
cd05600333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 1e-13
TIGR03903 1266 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclas 1e-13
cd05605285 cd05605, STKc_GRK4_like, Catalytic domain of G pro 1e-13
cd06640277 cd06640, STKc_MST4, Catalytic domain of the Protei 1e-13
cd07848287 cd07848, STKc_CDKL5, Catalytic domain of the Serin 2e-13
cd06643282 cd06643, STKc_SLK, Catalytic domain of the Protein 2e-13
cd07863288 cd07863, STKc_CDK4, Catalytic domain of the Serine 2e-13
cd06637272 cd06637, STKc_TNIK, Catalytic domain of the Protei 2e-13
PLN00009294 PLN00009, PLN00009, cyclin-dependent kinase A; Pro 2e-13
cd07856328 cd07856, STKc_Sty1_Hog1, Catalytic domain of the S 3e-13
cd05631285 cd05631, STKc_GRK4, Catalytic domain of the Protei 4e-13
cd06650333 cd06650, PKc_MEK1, Catalytic domain of the dual-sp 4e-13
cd06654296 cd06654, STKc_PAK1, Catalytic domain of the Protei 4e-13
cd05078258 cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat 4e-13
cd06652265 cd06652, STKc_MEKK2, Catalytic domain of the Prote 5e-13
cd07878343 cd07878, STKc_p38beta_MAPK11, Catalytic domain of 6e-13
cd06656297 cd06656, STKc_PAK3, Catalytic domain of the Protei 8e-13
cd07854342 cd07854, STKc_MAPK4_6, Catalytic domain of the Ser 9e-13
cd06639291 cd06639, STKc_myosinIIIB, Catalytic domain of the 9e-13
cd07850353 cd07850, STKc_JNK, Catalytic domain of the Serine/ 1e-12
cd05607277 cd05607, STKc_GRK7, Catalytic domain of the Protei 1e-12
cd07876359 cd07876, STKc_JNK2, Catalytic domain of the Serine 1e-12
cd06638286 cd06638, STKc_myosinIIIA, Catalytic domain of the 1e-12
cd05583288 cd05583, STKc_MSK_N, N-terminal catalytic domain o 2e-12
cd06653264 cd06653, STKc_MEKK3_like_1, Catalytic domain of MA 2e-12
PHA02988283 PHA02988, PHA02988, hypothetical protein; Provisio 2e-12
cd07874355 cd07874, STKc_JNK3, Catalytic domain of the Serine 2e-12
cd06651266 cd06651, STKc_MEKK3, Catalytic domain of the Prote 2e-12
cd05106374 cd05106, PTKc_CSF-1R, Catalytic domain of the Prot 3e-12
cd05087269 cd05087, PTKc_Aatyk1_Aatyk3, Catalytic domain of t 3e-12
cd05584323 cd05584, STKc_p70S6K, Catalytic domain of the Prot 3e-12
cd06622286 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of 4e-12
cd07865310 cd07865, STKc_CDK9, Catalytic domain of the Serine 5e-12
PTZ00036440 PTZ00036, PTZ00036, glycogen synthase kinase; Prov 5e-12
cd05606278 cd05606, STKc_beta_ARK, Catalytic domain of the Pr 6e-12
cd06646267 cd06646, STKc_MAP4K5, Catalytic domain of the Prot 7e-12
cd06645267 cd06645, STKc_MAP4K3, Catalytic domain of the Prot 7e-12
cd07875364 cd07875, STKc_JNK1, Catalytic domain of the Serine 7e-12
cd05573350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 7e-12
PLN00034353 PLN00034, PLN00034, mitogen-activated protein kina 8e-12
cd06655296 cd06655, STKc_PAK2, Catalytic domain of the Protei 9e-12
cd06659297 cd06659, STKc_PAK6, Catalytic domain of the Protei 1e-11
cd05037259 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) dom 1e-11
cd07869303 cd07869, STKc_PFTAIRE1, Catalytic domain of the Se 2e-11
cd05589324 cd05589, STKc_PKN, Catalytic domain of the Protein 2e-11
cd05571323 cd05571, STKc_PKB, Catalytic domain of the Protein 2e-11
cd05086268 cd05086, PTKc_Aatyk2, Catalytic domain of the Prot 2e-11
cd07844291 cd07844, STKc_PCTAIRE_like, Catalytic domain of PC 2e-11
cd05633279 cd05633, STKc_GRK3, Catalytic domain of the Protei 2e-11
PTZ00024335 PTZ00024, PTZ00024, cyclin-dependent protein kinas 2e-11
PHA03209357 PHA03209, PHA03209, serine/threonine kinase US3; P 2e-11
cd07880343 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of 4e-11
cd05619316 cd05619, STKc_nPKC_theta, Catalytic domain of the 4e-11
cd07879342 cd07879, STKc_p38delta_MAPK13, Catalytic domain of 5e-11
cd05617327 cd05617, STKc_aPKC_zeta, Catalytic domain of the P 8e-11
cd05612291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 9e-11
cd08219255 cd08219, STKc_Nek3, Catalytic domain of the Protei 9e-11
cd05604325 cd05604, STKc_SGK3, Catalytic domain of the Protei 1e-10
cd05615323 cd05615, STKc_cPKC_alpha, Catalytic domain of the 1e-10
cd05575323 cd05575, STKc_SGK, Catalytic domain of the Protein 3e-10
PTZ00267478 PTZ00267, PTZ00267, NIMA-related protein kinase; P 3e-10
cd07831282 cd07831, STKc_MOK, Catalytic domain of the Serine/ 3e-10
cd07870291 cd07870, STKc_PFTAIRE2, Catalytic domain of the Se 3e-10
cd05609305 cd05609, STKc_MAST, Catalytic domain of the Protei 4e-10
PTZ00263329 PTZ00263, PTZ00263, protein kinase A catalytic sub 4e-10
PTZ00283496 PTZ00283, PTZ00283, serine/threonine protein kinas 5e-10
cd08223257 cd08223, STKc_Nek4, Catalytic domain of the Protei 6e-10
cd05585312 cd05585, STKc_YPK1_like, Catalytic domain of Yeast 6e-10
cd07837295 cd07837, STKc_CdkB_plant, Catalytic domain of the 7e-10
cd05618329 cd05618, STKc_aPKC_iota, Catalytic domain of the P 8e-10
cd05613290 cd05613, STKc_MSK1_N, N-terminal catalytic domain 1e-09
cd05594325 cd05594, STKc_PKB_alpha, Catalytic domain of the P 1e-09
cd05054337 cd05054, PTKc_VEGFR, Catalytic domain of the Prote 1e-09
cd07872309 cd07872, STKc_PCTAIRE2, Catalytic domain of the Se 1e-09
cd07873301 cd07873, STKc_PCTAIRE1, Catalytic domain of the Se 1e-09
cd05104375 cd05104, PTKc_Kit, Catalytic domain of the Protein 1e-09
PRK13184 932 PRK13184, pknD, serine/threonine-protein kinase; R 1e-09
cd05593328 cd05593, STKc_PKB_gamma, Catalytic domain of the P 1e-09
cd07871288 cd07871, STKc_PCTAIRE3, Catalytic domain of the Se 2e-09
cd05588329 cd05588, STKc_aPKC, Catalytic domain of the Protei 3e-09
cd05596370 cd05596, STKc_ROCK, Catalytic domain of the Protei 3e-09
PHA03212391 PHA03212, PHA03212, serine/threonine kinase US3; P 4e-09
cd05591321 cd05591, STKc_nPKC_epsilon, Catalytic domain of th 6e-09
cd05592316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 6e-09
cd05614332 cd05614, STKc_MSK2_N, N-terminal catalytic domain 6e-09
cd05623332 cd05623, STKc_MRCK_alpha, Catalytic domain of the 8e-09
cd05620316 cd05620, STKc_nPKC_delta, Catalytic domain of the 8e-09
cd05610 669 cd05610, STKc_MASTL, Catalytic domain of the Prote 9e-09
cd05587324 cd05587, STKc_cPKC, Catalytic domain of the Protei 1e-08
cd05077262 cd05077, PTK_Jak1_rpt1, Pseudokinase (repeat 1) do 1e-08
cd05076274 cd05076, PTK_Tyk2_rpt1, Pseudokinase (repeat 1) do 1e-08
cd05595323 cd05595, STKc_PKB_beta, Catalytic domain of the Pr 2e-08
cd05603321 cd05603, STKc_SGK2, Catalytic domain of the Protei 2e-08
PTZ00426340 PTZ00426, PTZ00426, cAMP-dependent protein kinase 2e-08
cd05586330 cd05586, STKc_Sck1_like, Catalytic domain of Suppr 2e-08
cd05103343 cd05103, PTKc_VEGFR2, Catalytic domain of the Prot 2e-08
cd05616323 cd05616, STKc_cPKC_beta, Catalytic domain of the P 6e-08
cd05622371 cd05622, STKc_ROCK1, Catalytic domain of the Prote 6e-08
PTZ00266 1021 PTZ00266, PTZ00266, NIMA-related protein kinase; P 6e-08
PHA03207392 PHA03207, PHA03207, serine/threonine kinase US3; P 7e-08
cd05599364 cd05599, STKc_NDR_like, Catalytic domain of Nuclea 8e-08
cd05102338 cd05102, PTKc_VEGFR3, Catalytic domain of the Prot 1e-07
cd05105400 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the 1e-07
cd05621370 cd05621, STKc_ROCK2, Catalytic domain of the Prote 2e-07
cd05597331 cd05597, STKc_DMPK_like, Catalytic domain of Myoto 3e-07
cd05602325 cd05602, STKc_SGK1, Catalytic domain of the Protei 4e-07
cd05601330 cd05601, STKc_CRIK, Catalytic domain of the Protei 8e-07
cd05624331 cd05624, STKc_MRCK_beta, Catalytic domain of the P 1e-06
cd05628363 cd05628, STKc_NDR1, Catalytic domain of the Protei 1e-06
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 1e-06
cd05627360 cd05627, STKc_NDR2, Catalytic domain of the Protei 1e-06
cd05574316 cd05574, STKc_phototropin_like, Catalytic domain o 2e-06
cd08216314 cd08216, PK_STRAD, Pseudokinase domain of STE20-re 2e-06
cd05107401 cd05107, PTKc_PDGFR_beta, Catalytic domain of the 4e-06
cd07867317 cd07867, STKc_CDC2L6, Catalytic domain of Serine/T 4e-06
cd08226328 cd08226, PK_STRAD_beta, Pseudokinase domain of STE 5e-06
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 1e-05
cd07868317 cd07868, STKc_CDK8, Catalytic domain of the Serine 1e-05
cd05598376 cd05598, STKc_LATS, Catalytic domain of the Protei 1e-05
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 3e-05
cd05576237 cd05576, STKc_RPK118_like, Catalytic domain of the 4e-05
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 6e-05
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 7e-05
PHA03210501 PHA03210, PHA03210, serine/threonine kinase US3; P 8e-05
cd05629377 cd05629, STKc_NDR_like_fungal, Catalytic domain of 8e-05
cd05120155 cd05120, APH_ChoK_like, Aminoglycoside 3'-phosphot 1e-04
cd05106374 cd05106, PTKc_CSF-1R, Catalytic domain of the Prot 3e-04
PHA03390267 PHA03390, pk1, serine/threonine-protein kinase 1; 4e-04
pfam03154979 pfam03154, Atrophin-1, Atrophin-1 family 6e-04
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 0.001
cd05625382 cd05625, STKc_LATS1, Catalytic domain of the Prote 0.001
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 0.002
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 0.002
COG0478304 COG0478, COG0478, RIO-like serine/threonine protei 0.002
PLN03225566 PLN03225, PLN03225, Serine/threonine-protein kinas 0.002
pfam05109830 pfam05109, Herpes_BLLF1, Herpes virus major outer 0.002
PHA03378991 PHA03378, PHA03378, EBNA-3B; Provisional 0.003
pfam03154979 pfam03154, Atrophin-1, Atrophin-1 family 0.004
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
 Score =  191 bits (489), Expect = 2e-55
 Identities = 89/278 (32%), Positives = 125/278 (44%), Gaps = 31/278 (11%)

Query: 505 SRIIGEGGFGVVYRGILDD-----GREVAVKVLKR-ANQHGGREFLAELEMLSRLHHRNL 558
            + +GEG FG VY+G L         EVAVK LK  A++    EFL E  ++ +L H N+
Sbjct: 4   GKKLGEGAFGEVYKGKLKGKGGKKKVEVAVKTLKEDASEQQIEEFLREARIMRKLDHPNV 63

Query: 559 VKLFGVCIEDNNRCLVYELIHNGSLESHLHGDDKVNGPLDWDARMKIALGAARGLAYLHE 618
           VKL GVC E+    +V E +  G L S+L    K    L     +  AL  ARG+ YL  
Sbjct: 64  VKLLGVCTEEEPLYIVMEYMEGGDLLSYLR---KNRPKLSLSDLLSFALQIARGMEYLE- 119

Query: 619 DSSPRVIHRDFKSSNILLEHDFTPKVSDFGLARTALDEGNKHISTHVMGTFGYLAPEYAM 678
             S   IHRD  + N L+  +   K+SDFGL+R  L + + +          ++APE   
Sbjct: 120 --SKNFIHRDLAARNCLVGENLVVKISDFGLSR-DLYDDDYYRKRGGKLPIRWMAPESLK 176

Query: 679 TGHLLVKSDVYSYGVVLLELLT-GRKPVDLSQPPGQENLVAWARPLLTTKEGLKTIIDPV 737
            G    KSDV+S+GV+L E+ T G +P      PG  N        L     L       
Sbjct: 177 EGKFTSKSDVWSFGVLLWEIFTLGEQP-----YPGMSNEEVLEY--LKNGYRLP------ 223

Query: 738 IESNISYDTLVKVAAIASMCVQPEVSHRPFMGEVVQAL 775
              N       ++  +   C   +   RP   E+V+ L
Sbjct: 224 QPPNCP----PELYDLMLQCWAEDPEDRPTFSELVEIL 257


Phosphotransferases. Tyrosine-specific kinase subfamily. Length = 257

>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|133221 cd05090, PTKc_Ror1, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|133227 cd05096, PTKc_DDR1, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>gnl|CDD|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|173651 cd05095, PTKc_DDR2, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|133167 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>gnl|CDD|133193 cd05062, PTKc_IGF-1R, Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>gnl|CDD|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>gnl|CDD|133219 cd05088, PTKc_Tie2, Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|133192 cd05061, PTKc_InsR, Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>gnl|CDD|133240 cd05109, PTKc_HER2, Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>gnl|CDD|173656 cd05111, PTK_HER3, Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>gnl|CDD|133220 cd05089, PTKc_Tie1, Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>gnl|CDD|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>gnl|CDD|88330 cd05047, PTKc_Tie, Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>gnl|CDD|173647 cd05091, PTKc_Ror2, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>gnl|CDD|133247 cd05116, PTKc_Syk, Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|173748 cd07853, STKc_NLK, Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173654 cd05108, PTKc_EGFR, Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>gnl|CDD|133246 cd05115, PTKc_Zap-70, Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|132980 cd06649, PKc_MEK2, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>gnl|CDD|173642 cd05075, PTKc_Axl, Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>gnl|CDD|143382 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|133195 cd05064, PTKc_EphR_A10, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>gnl|CDD|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|133175 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>gnl|CDD|133205 cd05074, PTKc_Tyro3, Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|133174 cd05042, PTKc_Aatyk, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>gnl|CDD|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|234389 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclase fusion protein Back     alignment and domain information
>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional Back     alignment and domain information
>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>gnl|CDD|132981 cd06650, PKc_MEK1, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>gnl|CDD|133209 cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>gnl|CDD|143383 cd07878, STKc_p38beta_MAPK11, Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>gnl|CDD|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>gnl|CDD|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>gnl|CDD|143381 cd07876, STKc_JNK2, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>gnl|CDD|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|165291 PHA02988, PHA02988, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|143379 cd07874, STKc_JNK3, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>gnl|CDD|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|173646 cd05087, PTKc_Aatyk1_Aatyk3, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>gnl|CDD|173333 PTZ00036, PTZ00036, glycogen synthase kinase; Provisional Back     alignment and domain information
>gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>gnl|CDD|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>gnl|CDD|173627 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|143374 cd07869, STKc_PFTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>gnl|CDD|133217 cd05086, PTKc_Aatyk2, Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|177557 PHA03209, PHA03209, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>gnl|CDD|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>gnl|CDD|143375 cd07870, STKc_PFTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|240344 PTZ00283, PTZ00283, serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>gnl|CDD|173635 cd05054, PTKc_VEGFR, Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|133235 cd05104, PTKc_Kit, Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>gnl|CDD|183880 PRK13184, pknD, serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>gnl|CDD|165478 PHA03212, PHA03212, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>gnl|CDD|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173643 cd05077, PTK_Jak1_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>gnl|CDD|133207 cd05076, PTK_Tyk2_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133234 cd05103, PTKc_VEGFR2, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|165473 PHA03207, PHA03207, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133233 cd05102, PTKc_VEGFR3, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|173653 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173756 cd08216, PK_STRAD, Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>gnl|CDD|133238 cd05107, PTKc_PDGFR_beta, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>gnl|CDD|143372 cd07867, STKc_CDC2L6, Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>gnl|CDD|173766 cd08226, PK_STRAD_beta, Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|143373 cd07868, STKc_CDK8, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|173667 cd05576, STKc_RPK118_like, Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|165476 PHA03210, PHA03210, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|240159 cd05120, APH_ChoK_like, Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>gnl|CDD|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|223069 PHA03390, pk1, serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223554 COG0478, COG0478, RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|215638 PLN03225, PLN03225, Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>gnl|CDD|218439 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1) Back     alignment and domain information
>gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 898
KOG1187361 consensus Serine/threonine protein kinase [Signal 100.0
KOG0192362 consensus Tyrosine kinase specific for activated ( 100.0
KOG0197468 consensus Tyrosine kinases [Signal transduction me 100.0
KOG0581364 consensus Mitogen-activated protein kinase kinase 100.0
KOG1026774 consensus Nerve growth factor receptor TRKA and re 100.0
KOG0575 592 consensus Polo-like serine/threonine protein kinas 100.0
KOG0595429 consensus Serine/threonine-protein kinase involved 100.0
KOG0591375 consensus NIMA (never in mitosis)-related G2-speci 100.0
KOG0615475 consensus Serine/threonine protein kinase Chk2 and 100.0
PLN00113968 leucine-rich repeat receptor-like protein kinase; 100.0
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 100.0
KOG0196996 consensus Tyrosine kinase, EPH (ephrin) receptor f 100.0
KOG0598357 consensus Ribosomal protein S6 kinase and related 100.0
PHA02988283 hypothetical protein; Provisional 100.0
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 100.0
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 100.0
KOG0593396 consensus Predicted protein kinase KKIAMRE [Genera 100.0
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 100.0
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 100.0
KOG0583370 consensus Serine/threonine protein kinase [Signal 100.0
KOG10951025 consensus Protein tyrosine kinase [Signal transduc 100.0
KOG0193678 consensus Serine/threonine protein kinase RAF [Sig 100.0
KOG0600560 consensus Cdc2-related protein kinase [Cell cycle 100.0
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 100.0
KOG0578550 consensus p21-activated serine/threonine protein k 100.0
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 100.0
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 100.0
KOG1094807 consensus Discoidin domain receptor DDR1 [Signal t 100.0
KOG4721 904 consensus Serine/threonine protein kinase, contain 100.0
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 100.0
KOG0582516 consensus Ste20-like serine/threonine protein kina 100.0
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 100.0
KOG0198313 consensus MEKK and related serine/threonine protei 100.0
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 100.0
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 100.0
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 100.0
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 100.0
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 100.0
KOG2052513 consensus Activin A type IB receptor, serine/threo 100.0
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 100.0
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 100.0
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 100.0
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 100.0
KOG0194474 consensus Protein tyrosine kinase [Signal transduc 100.0
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 100.0
KOG0592 604 consensus 3-phosphoinositide-dependent protein kin 100.0
KOG0661 538 consensus MAPK related serine/threonine protein ki 100.0
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 100.0
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 100.0
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 100.0
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 100.0
PTZ00267478 NIMA-related protein kinase; Provisional 100.0
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 100.0
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 100.0
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 100.0
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 100.0
PTZ00263329 protein kinase A catalytic subunit; Provisional 100.0
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 100.0
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 100.0
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 100.0
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 100.0
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 100.0
PLN00034353 mitogen-activated protein kinase kinase; Provision 100.0
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 100.0
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 100.0
KOG0659318 consensus Cdk activating kinase (CAK)/RNA polymera 100.0
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 100.0
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 100.0
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 100.0
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 100.0
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 100.0
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 100.0
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 100.0
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 100.0
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 100.0
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 100.0
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 100.0
PTZ00283496 serine/threonine protein kinase; Provisional 100.0
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 100.0
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 100.0
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 100.0
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 100.0
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 100.0
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 100.0
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 100.0
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 100.0
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 100.0
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 100.0
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 100.0
KOG0605550 consensus NDR and related serine/threonine kinases 100.0
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 100.0
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 100.0
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 100.0
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 100.0
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 100.0
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 100.0
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 100.0
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 100.0
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 100.0
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 100.0
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 100.0
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 100.0
KOG0201467 consensus Serine/threonine protein kinase [Signal 100.0
KOG0694694 consensus Serine/threonine protein kinase [Signal 100.0
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 100.0
KOG3653534 consensus Transforming growth factor beta/activin 100.0
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 100.0
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 100.0
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 100.0
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 100.0
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 100.0
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 100.0
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 100.0
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 100.0
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 100.0
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 100.0
KOG0585576 consensus Ca2+/calmodulin-dependent protein kinase 100.0
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 100.0
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 100.0
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 100.0
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 100.0
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 100.0
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 100.0
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 100.0
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 100.0
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 100.0
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 100.0
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 100.0
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 100.0
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 100.0
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 100.0
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 100.0
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 100.0
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 100.0
KOG0611 668 consensus Predicted serine/threonine protein kinas 100.0
KOG1989 738 consensus ARK protein kinase family [Signal transd 100.0
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 100.0
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 100.0
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 100.0
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 100.0
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 100.0
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 100.0
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 100.0
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 100.0
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 100.0
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 100.0
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 100.0
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 100.0
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 100.0
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 100.0
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 100.0
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 100.0
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 100.0
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 100.0
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 100.0
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 100.0
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 100.0
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 100.0
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 100.0
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 100.0
PHA03212391 serine/threonine kinase US3; Provisional 100.0
PTZ00284467 protein kinase; Provisional 100.0
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 100.0
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 100.0
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 100.0
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 100.0
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 100.0
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 100.0
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 100.0
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 100.0
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 100.0
PTZ00036440 glycogen synthase kinase; Provisional 100.0
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 100.0
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 100.0
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 100.0
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 100.0
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 100.0
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 100.0
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 100.0
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 100.0
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 100.0
KOG0616355 consensus cAMP-dependent protein kinase catalytic 100.0
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 100.0
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 100.0
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 100.0
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 100.0
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 100.0
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 100.0
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 100.0
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 100.0
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 100.0
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 100.0
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 100.0
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 100.0
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 100.0
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 100.0
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 100.0
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 100.0
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 100.0
KOG2345302 consensus Serine/threonine protein kinase/TGF-beta 100.0
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 100.0
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 100.0
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 100.0
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 100.0
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 100.0
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 100.0
PHA03207392 serine/threonine kinase US3; Provisional 100.0
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 100.0
KOG0589426 consensus Serine/threonine protein kinase [General 100.0
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 100.0
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 100.0
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 100.0
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 100.0
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 100.0
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 100.0
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 100.0
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 100.0
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 100.0
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 100.0
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 100.0
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 100.0
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 100.0
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 100.0
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 100.0
PHA03211461 serine/threonine kinase US3; Provisional 100.0
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 100.0
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 100.0
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 100.0
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 100.0
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 100.0
PHA03209357 serine/threonine kinase US3; Provisional 100.0
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 100.0
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 100.0
KOG10251177 consensus Epidermal growth factor receptor EGFR an 100.0
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 100.0
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 100.0
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 100.0
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 100.0
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 100.0
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 100.0
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 100.0
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 100.0
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 100.0
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 100.0
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 100.0
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 100.0
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 100.0
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 100.0
KOG0663419 consensus Protein kinase PITSLRE and related kinas 100.0
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 100.0
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 100.0
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 100.0
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 100.0
KOG0580281 consensus Serine/threonine protein kinase [Cell cy 100.0
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 100.0
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 100.0
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 100.0
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 100.0
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 100.0
KOG0658364 consensus Glycogen synthase kinase-3 [Carbohydrate 100.0
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 100.0
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 100.0
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 100.0
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 100.0
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 100.0
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 100.0
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 100.0
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 100.0
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 100.0
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 100.0
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 100.0
KOG0660359 consensus Mitogen-activated protein kinase [Signal 100.0
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 100.0
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 100.0
KOG0594323 consensus Protein kinase PCTAIRE and related kinas 100.0
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 100.0
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 100.0
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 100.0
KOG0032382 consensus Ca2+/calmodulin-dependent protein kinase 100.0
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 100.0
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 100.0
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 100.0
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 100.0
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 100.0
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 100.0
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 100.0
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 100.0
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 100.0
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 100.0
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 100.0
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 100.0
PTZ00266 1021 NIMA-related protein kinase; Provisional 100.0
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 100.0
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 100.0
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 100.0
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 100.0
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 100.0
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 100.0
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 100.0
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 100.0
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 100.0
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 100.0
KOG0577 948 consensus Serine/threonine protein kinase [Signal 100.0
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 100.0
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 100.0
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 100.0
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 100.0
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 100.0
KOG0667586 consensus Dual-specificity tyrosine-phosphorylatio 100.0
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 100.0
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 100.0
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 100.0
PLN00009294 cyclin-dependent kinase A; Provisional 100.0
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 100.0
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 100.0
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 100.0
KOG0610459 consensus Putative serine/threonine protein kinase 100.0
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 100.0
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 100.0
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 100.0
KOG0033355 consensus Ca2+/calmodulin-dependent protein kinase 100.0
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 100.0
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 100.0
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 100.0
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 100.0
KOG0599411 consensus Phosphorylase kinase gamma subunit [Carb 100.0
KOG0574502 consensus STE20-like serine/threonine kinase MST [ 100.0
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 100.0
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 100.0
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 100.0
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 100.0
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 100.0
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 100.0
PHA02882294 putative serine/threonine kinase; Provisional 100.0
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 100.0
PHA03210501 serine/threonine kinase US3; Provisional 100.0
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 100.0
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 100.0
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 100.0
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 100.0
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 100.0
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 100.0
KOG4717 864 consensus Serine/threonine protein kinase [Signal 100.0
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 100.0
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 100.0
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 100.0
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 100.0
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 100.0
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 100.0
PTZ00024335 cyclin-dependent protein kinase; Provisional 100.0
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 100.0
KOG0200609 consensus Fibroblast/platelet-derived growth facto 100.0
KOG0596677 consensus Dual specificity; serine/threonine and t 100.0
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 100.0
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 100.0
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 100.0
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 100.0
KOG0584 632 consensus Serine/threonine protein kinase [General 100.0
KOG0586 596 consensus Serine/threonine protein kinase [General 100.0
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 100.0
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 99.98
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 99.98
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.98
KOG0986591 consensus G protein-coupled receptor kinase [Signa 99.97
KOG46451509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 99.97
KOG1024563 consensus Receptor-like protein tyrosine kinase RY 99.97
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.97
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 99.97
KOG0690516 consensus Serine/threonine protein kinase [Signal 99.97
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.97
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.97
KOG0983391 consensus Mitogen-activated protein kinase (MAPK) 99.97
KOG0607463 consensus MAP kinase-interacting kinase and relate 99.97
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 99.97
KOG0666438 consensus Cyclin C-dependent kinase CDK8 [Transcri 99.97
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 99.97
KOG1006361 consensus Mitogen-activated protein kinase (MAPK) 99.96
KOG06081034 consensus Warts/lats-like serine threonine kinases 99.96
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 99.96
PLN03224507 probable serine/threonine protein kinase; Provisio 99.96
KOG0696683 consensus Serine/threonine protein kinase [Signal 99.96
KOG0603612 consensus Ribosomal protein S6 kinase [Signal tran 99.96
KOG1151775 consensus Tousled-like protein kinase [Signal tran 99.96
KOG0604400 consensus MAP kinase-activated protein kinase 2 [S 99.96
KOG0669376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 99.96
KOG4236888 consensus Serine/threonine protein kinase PKC mu/P 99.96
KOG0662292 consensus Cyclin-dependent kinase CDK5 [Intracellu 99.96
KOG0614732 consensus cGMP-dependent protein kinase [Signal tr 99.96
KOG0695593 consensus Serine/threonine protein kinase [Signal 99.95
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.95
KOG0671415 consensus LAMMER dual specificity kinases [Signal 99.95
KOG1027903 consensus Serine/threonine protein kinase and endo 99.95
KOG0984282 consensus Mitogen-activated protein kinase (MAPK) 99.95
KOG0664449 consensus Nemo-like MAPK-related serine/threonine 99.95
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.95
KOG1152772 consensus Signal transduction serine/threonine kin 99.93
KOG1290 590 consensus Serine/threonine protein kinase [Signal 99.93
KOG0668338 consensus Casein kinase II, alpha subunit [Signal 99.93
KOG0576 829 consensus Mitogen-activated protein kinase kinase 99.93
KOG1345378 consensus Serine/threonine kinase [Signal transduc 99.93
KOG0670752 consensus U4/U6-associated splicing factor PRP4 [R 99.91
KOG0665369 consensus Jun-N-terminal kinase (JNK) [Signal tran 99.91
PLN00181 793 protein SPA1-RELATED; Provisional 99.91
KOG1167418 consensus Serine/threonine protein kinase of the C 99.9
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.9
COG0515384 SPS1 Serine/threonine protein kinase [General func 99.89
KOG1164322 consensus Casein kinase (serine/threonine/tyrosine 99.88
PRK09188365 serine/threonine protein kinase; Provisional 99.87
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.86
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 99.83
KOG0590601 consensus Checkpoint kinase and related serine/thr 99.82
KOG1165449 consensus Casein kinase (serine/threonine/tyrosine 99.82
KOG1163341 consensus Casein kinase (serine/threonine/tyrosine 99.82
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.8
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.8
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.79
KOG1023 484 consensus Natriuretic peptide receptor, guanylate 99.76
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 99.75
PRK12274218 serine/threonine protein kinase; Provisional 99.74
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 99.74
KOG1166974 consensus Mitotic checkpoint serine/threonine prot 99.74
PRK10345210 hypothetical protein; Provisional 99.71
KOG4158598 consensus BRPK/PTEN-induced protein kinase [Signal 99.68
PRK14879211 serine/threonine protein kinase; Provisional 99.68
smart00090237 RIO RIO-like kinase. 99.68
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 99.67
PRK09605535 bifunctional UGMP family protein/serine/threonine 99.65
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 99.65
KOG1033516 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati 99.64
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 99.61
KOG0606 1205 consensus Microtubule-associated serine/threonine 99.6
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 99.58
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 99.51
KOG0590 601 consensus Checkpoint kinase and related serine/thr 99.5
TIGR01982437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 99.37
KOG1266458 consensus Protein kinase [Signal transduction mech 99.3
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 99.25
PRK04750537 ubiB putative ubiquinone biosynthesis protein UbiB 99.19
KOG0601524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 99.18
cd05154223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 99.15
KOG1243 690 consensus Protein kinase [General function predict 99.1
KOG0601524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 99.02
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 98.99
KOG3741655 consensus Poly(A) ribonuclease subunit [RNA proces 98.88
KOG06061205 consensus Microtubule-associated serine/threonine 98.78
KOG3087229 consensus Serine/threonine protein kinase [General 98.72
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 98.7
PF01163188 RIO1: RIO1 family; InterPro: IPR018934 Protein pho 98.65
PRK15123268 lipopolysaccharide core heptose(I) kinase RfaP; Pr 98.63
COG0478304 RIO-like serine/threonine protein kinase fused to 98.48
KOG2137 700 consensus Protein kinase [Signal transduction mech 98.35
PF06293206 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; 98.32
COG4248 637 Uncharacterized protein with protein kinase and he 98.28
TIGR02172226 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogou 98.21
PRK09902216 hypothetical protein; Provisional 98.19
PF01636239 APH: Phosphotransferase enzyme family This family 98.19
COG0661517 AarF Predicted unusual protein kinase [General fun 98.18
PF06176229 WaaY: Lipopolysaccharide core biosynthesis protein 98.02
cd05150244 APH Aminoglycoside 3'-phosphotransferase (APH). Th 97.98
KOG0576 829 consensus Mitogen-activated protein kinase kinase 97.98
COG1718268 RIO1 Serine/threonine protein kinase involved in c 97.91
PLN02876 822 acyl-CoA dehydrogenase 97.88
PF12260188 PIP49_C: Protein-kinase domain of FAM69; InterPro: 97.81
PRK10593297 hypothetical protein; Provisional 97.8
cd05155235 APH_ChoK_like_1 Uncharacterized bacterial proteins 97.75
KOG1235538 consensus Predicted unusual protein kinase [Genera 97.75
PF10707199 YrbL-PhoP_reg: PhoP regulatory network protein Yrb 97.57
cd05157235 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes. 97.52
TIGR02721256 ycfN_thiK thiamine kinase. Members of this family 97.46
cd05153296 HomoserineK_II Homoserine Kinase, type II. Homoser 97.45
PF13095207 FTA2: Kinetochore Sim4 complex subunit FTA2 97.39
COG2112201 Predicted Ser/Thr protein kinase [Signal transduct 97.34
PRK05231319 homoserine kinase; Provisional 97.27
TIGR00938307 thrB_alt homoserine kinase, Neisseria type. Homose 97.13
PRK09550401 mtnK methylthioribose kinase; Reviewed 97.09
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 96.98
PF03881288 Fructosamin_kin: Fructosamine kinase; InterPro: IP 96.91
cd05156302 ChoK_euk Choline Kinase (ChoK) in eukaryotes. The 96.87
KOG1826 2724 consensus Ras GTPase activating protein RasGAP/neu 96.51
COG3173321 Predicted aminoglycoside phosphotransferase [Gener 96.37
KOG2268465 consensus Serine/threonine protein kinase [Signal 96.29
cd05152276 MPH2' Macrolide 2'-Phosphotransferase (MPH2'). MPH 96.23
PLN02236344 choline kinase 95.95
KOG2270520 consensus Serine/threonine protein kinase involved 95.65
TIGR02906313 spore_CotS spore coat protein, CotS family. Member 95.59
PLN02756418 S-methyl-5-thioribose kinase 95.53
COG2334331 Putative homoserine kinase type II (protein kinase 95.51
TIGR02904309 spore_ysxE spore coat protein YsxE. Members of thi 94.87
PLN02421330 phosphotransferase, alcohol group as acceptor/kina 94.78
PF01633211 Choline_kinase: Choline/ethanolamine kinase; Inter 94.65
TIGR01767370 MTRK 5-methylthioribose kinase. This enzyme is inv 94.39
PRK11768325 serine/threonine protein kinase; Provisional 94.31
PRK06148 1013 hypothetical protein; Provisional 93.8
PTZ00384383 choline kinase; Provisional 93.73
PF01102122 Glycophorin_A: Glycophorin A; InterPro: IPR001195 93.63
COG3001286 Uncharacterized protein conserved in bacteria [Fun 92.85
PF07387308 Seadorna_VP7: Seadornavirus VP7; InterPro: IPR0099 92.61
PRK12396409 5-methylribose kinase; Reviewed 92.15
COG5072488 ALK1 Serine/threonine kinase of the haspin family 91.91
PTZ00296442 choline kinase; Provisional 90.31
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=9.1e-55  Score=488.21  Aligned_cols=290  Identities=56%  Similarity=0.947  Sum_probs=256.4

Q ss_pred             CcccccHHHHHHhhCCceeeeEeeecCCcceEEEEecCCCEEEEEEeecccccchHHHHHHHHHHhhccCCceeeEeeee
Q 002632          486 TAKTFTLNDIEKATNGFHTSRIIGEGGFGVVYRGILDDGREVAVKVLKRANQHGGREFLAELEMLSRLHHRNLVKLFGVC  565 (898)
Q Consensus       486 ~~~~f~l~el~~at~~y~~~~~LG~G~fG~Vyka~l~~g~~VAVK~l~~~~~~~~~~f~~EieiL~~L~HpNIV~L~g~~  565 (898)
                      ..+.|+++|+..||++|...++||+|+||.||+|.+.+|+.||||++........++|.+|+++|.+++|+|+|+|+|||
T Consensus        61 ~~~~fs~~el~~AT~~Fs~~~~ig~Ggfg~VYkG~l~~~~~vAVK~~~~~~~~~~~eF~~Ei~~ls~l~H~Nlv~LlGyC  140 (361)
T KOG1187|consen   61 PLRSFSYDELRKATNNFSESNLIGEGGFGTVYKGVLSDGTVVAVKRLSSNSGQGEREFLNEVEILSRLRHPNLVKLLGYC  140 (361)
T ss_pred             CcceeeHHHHHHHHhCCchhcceecCCCeEEEEEEECCCCEEEEEEecCCCCcchhHHHHHHHHHhcCCCcCcccEEEEE
Confidence            57789999999999999999999999999999999999999999988764432146799999999999999999999999


Q ss_pred             eccCc-eeEEEeeccCCcccccccCCCcCCCCCCHHHHHHHHHHHHHHhhhhhccCCCceeeccCCCCCeEEcCCCceEE
Q 002632          566 IEDNN-RCLVYELIHNGSLESHLHGDDKVNGPLDWDARMKIALGAARGLAYLHEDSSPRVIHRDFKSSNILLEHDFTPKV  644 (898)
Q Consensus       566 ~~~~~-~~LV~Ey~~~GSL~d~L~~~~~~~~~Ls~~~rl~Ia~qIa~gL~yLH~~gsp~IIHrDLKpsNILLd~~~~vKL  644 (898)
                      .+.+. .+||||||++|+|.++|+.....  +|+|.+|++||.++|+||+|||+.+.++|||||||++|||||+++++||
T Consensus       141 ~e~~~~~~LVYEym~nGsL~d~L~~~~~~--~L~W~~R~kIa~g~A~gL~yLH~~~~~~iiHrDiKssNILLD~~~~aKl  218 (361)
T KOG1187|consen  141 LEGGEHRLLVYEYMPNGSLEDHLHGKKGE--PLDWETRLKIALGAARGLAYLHEGCPPPIIHRDIKSSNILLDEDFNAKL  218 (361)
T ss_pred             ecCCceEEEEEEccCCCCHHHHhCCCCCC--CCCHHHHHHHHHHHHHHHHHHccCCCCCEecCCCCHHHeeECCCCCEEc
Confidence            99984 99999999999999999875433  8999999999999999999999999889999999999999999999999


Q ss_pred             eccCcchhcccCCCcceeeccccCccCCChhhhhcCCCCccchhhhHHHHHHHHHhCCCCCCCCCCCCchhHHHhhhhcc
Q 002632          645 SDFGLARTALDEGNKHISTHVMGTFGYLAPEYAMTGHLLVKSDVYSYGVVLLELLTGRKPVDLSQPPGQENLVAWARPLL  724 (898)
Q Consensus       645 sDFGLA~~~~~~~~~~~~t~~~GT~~Y~APE~l~~~~~t~kSDVwSfGvvL~ELLTGk~Pfd~~~~~~~~~lv~w~~~l~  724 (898)
                      +|||||+..... .....+...||.+|+||||+..+..+.|+|||||||+|+||+||+.+.+.....+..+++.|++..+
T Consensus       219 sDFGLa~~~~~~-~~~~~~~~~gt~gY~~PEy~~~g~lt~KsDVySFGVvllElitgr~~~d~~~~~~~~~l~~w~~~~~  297 (361)
T KOG1187|consen  219 SDFGLAKLGPEG-DTSVSTTVMGTFGYLAPEYASTGKLTEKSDVYSFGVVLLELITGRKAVDQSRPRGELSLVEWAKPLL  297 (361)
T ss_pred             cCccCcccCCcc-ccceeeecCCCCccCChhhhccCCcCcccccccchHHHHHHHhCCcccCCCCCcccccHHHHHHHHH
Confidence            999999754321 2222211189999999999999999999999999999999999999998766566677999998887


Q ss_pred             cccccccccccchhc-cCCCH-HHHHHHHHHHHHccCCCCCCCCCHHHHHHHHHHHH
Q 002632          725 TTKEGLKTIIDPVIE-SNISY-DTLVKVAAIASMCVQPEVSHRPFMGEVVQALKLVC  779 (898)
Q Consensus       725 ~~~~~l~~iiD~~l~-~~~~~-d~~~~L~~Li~~CL~~dP~~RPTm~EVl~~L~~l~  779 (898)
                      ... .+.+++|+.+. ..+.. +++.++..++.+|++.++.+||+|.||+++|+.+.
T Consensus       298 ~~~-~~~eiiD~~l~~~~~~~~~~~~~~~~~a~~C~~~~~~~RP~m~~Vv~~L~~~~  353 (361)
T KOG1187|consen  298 EEG-KLREIVDPRLKEGEYPDEKEVKKLAELALRCLRPDPKERPTMSQVVKELEGIL  353 (361)
T ss_pred             HCc-chhheeCCCccCCCCChHHHHHHHHHHHHHHcCcCCCcCcCHHHHHHHHHhhc
Confidence            765 89999999987 55554 68999999999999999999999999999996543



>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>KOG1266 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>KOG3741 consensus Poly(A) ribonuclease subunit [RNA processing and modification] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG3087 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional Back     alignment and domain information
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains [General function prediction only] Back     alignment and domain information
>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172 Back     alignment and domain information
>PRK09902 hypothetical protein; Provisional Back     alignment and domain information
>PF01636 APH: Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily Back     alignment and domain information
>COG0661 AarF Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>PF06176 WaaY: Lipopolysaccharide core biosynthesis protein (WaaY); InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY) Back     alignment and domain information
>cd05150 APH Aminoglycoside 3'-phosphotransferase (APH) Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>COG1718 RIO1 Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms / Cell division and chromosome partitioning] Back     alignment and domain information
>PLN02876 acyl-CoA dehydrogenase Back     alignment and domain information
>PF12260 PIP49_C: Protein-kinase domain of FAM69; InterPro: IPR022049 Family with sequence similarity 69 has three members (A, B and C) Back     alignment and domain information
>PRK10593 hypothetical protein; Provisional Back     alignment and domain information
>cd05155 APH_ChoK_like_1 Uncharacterized bacterial proteins with similarity to Aminoglycoside 3'-phosphotransferase (APH) and Choline kinase (ChoK) family members Back     alignment and domain information
>KOG1235 consensus Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>PF10707 YrbL-PhoP_reg: PhoP regulatory network protein YrbL; InterPro: IPR019647 This entry represents proteins that are activated by the protein PhoP Back     alignment and domain information
>cd05157 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes Back     alignment and domain information
>TIGR02721 ycfN_thiK thiamine kinase Back     alignment and domain information
>cd05153 HomoserineK_II Homoserine Kinase, type II Back     alignment and domain information
>PF13095 FTA2: Kinetochore Sim4 complex subunit FTA2 Back     alignment and domain information
>COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK05231 homoserine kinase; Provisional Back     alignment and domain information
>TIGR00938 thrB_alt homoserine kinase, Neisseria type Back     alignment and domain information
>PRK09550 mtnK methylthioribose kinase; Reviewed Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03881 Fructosamin_kin: Fructosamine kinase; InterPro: IPR016477 Ketosamines derive from a non-enzymatic reaction between a sugar and a protein [] Back     alignment and domain information
>cd05156 ChoK_euk Choline Kinase (ChoK) in eukaryotes Back     alignment and domain information
>KOG1826 consensus Ras GTPase activating protein RasGAP/neurofibromin [Defense mechanisms] Back     alignment and domain information
>COG3173 Predicted aminoglycoside phosphotransferase [General function prediction only] Back     alignment and domain information
>KOG2268 consensus Serine/threonine protein kinase [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>cd05152 MPH2' Macrolide 2'-Phosphotransferase (MPH2') Back     alignment and domain information
>PLN02236 choline kinase Back     alignment and domain information
>KOG2270 consensus Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02906 spore_CotS spore coat protein, CotS family Back     alignment and domain information
>PLN02756 S-methyl-5-thioribose kinase Back     alignment and domain information
>COG2334 Putative homoserine kinase type II (protein kinase fold) [General function prediction only] Back     alignment and domain information
>TIGR02904 spore_ysxE spore coat protein YsxE Back     alignment and domain information
>PLN02421 phosphotransferase, alcohol group as acceptor/kinase Back     alignment and domain information
>PF01633 Choline_kinase: Choline/ethanolamine kinase; InterPro: IPR002573 Choline kinase, (ATP:choline phosphotransferase, 2 Back     alignment and domain information
>TIGR01767 MTRK 5-methylthioribose kinase Back     alignment and domain information
>PRK11768 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PRK06148 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00384 choline kinase; Provisional Back     alignment and domain information
>PF01102 Glycophorin_A: Glycophorin A; InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane Back     alignment and domain information
>COG3001 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07387 Seadorna_VP7: Seadornavirus VP7; InterPro: IPR009973 This family consists of several Seadornavirus specific VP7 proteins of around 305 residues in length Back     alignment and domain information
>PRK12396 5-methylribose kinase; Reviewed Back     alignment and domain information
>COG5072 ALK1 Serine/threonine kinase of the haspin family [Cell division and chromosome partitioning] Back     alignment and domain information
>PTZ00296 choline kinase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query898
3tl8_A349 The Avrptob-Bak1 Complex Reveals Two Structurally S 1e-61
3uim_A326 Structural Basis For The Impact Of Phosphorylation 5e-61
3hgk_A327 Crystal Structure Of Effect Protein Avrptob Complex 6e-54
2qkw_B321 Structural Basis For Activation Of Plant Immunity B 4e-53
2nry_A307 Crystal Structure Of Irak-4 Length = 307 1e-40
2nru_A307 Crystal Structure Of Irak-4 Length = 307 2e-40
2oib_A301 Crystal Structure Of Irak4 Kinase Domain Apo Form L 2e-40
2o8y_A298 Apo Irak4 Kinase Domain Length = 298 6e-39
3ppz_A309 Crystal Structure Of Ctr1 Kinase Domain In Complex 2e-27
3p86_A309 Crystal Structure Of Ctr1 Kinase Domain Mutant D676 8e-27
4gs6_A315 Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxoz 1e-26
2eva_A307 Structural Basis For The Interaction Of Tak1 Kinase 2e-26
3dtc_A271 Crystal Structure Of Mixed-Lineage Kinase Mlk1 Comp 5e-26
4asz_A299 Crystal Structure Of Apo Trkb Kinase Domain Length 1e-23
3miy_A266 X-Ray Crystal Structure Of Itk Complexed With Sunit 5e-23
4f0f_A287 Crystal Structure Of The Roco4 Kinase Domain Bound 1e-22
4aoj_A329 Human Trka In Complex With The Inhibitor Az-23 Leng 1e-22
4gt5_A306 Crystal Structure Of The Inactive Trka Kinase Domai 1e-22
3qgw_A286 Crystal Structure Of Itk Kinase Bound To An Inhibit 1e-22
4hct_A269 Crystal Structure Of Itk In Complex With Compound 5 1e-22
1sm2_A264 Crystal Structure Of The Phosphorylated Interleukin 2e-22
3v5j_A266 Crystal Structure Of Interleukin-2 Inducible T-Cell 2e-22
4f0i_A300 Crystal Structure Of Apo Trka Length = 300 2e-22
4f1m_A287 Crystal Structure Of The G1179s Roco4 Kinase Domain 5e-22
4f1o_A287 Crystal Structure Of The L1180t Mutant Roco4 Kinase 5e-22
3t9t_A267 Crystal Structure Of Btk Mutant (F435t,K596r) Compl 7e-22
3v5q_A297 Discovery Of A Selective Trk Inhibitor With Efficac 1e-21
3dkg_A317 Sgx Clone 5698a109kfg1h1 Length = 317 3e-21
3q6w_A307 Structure Of Dually-phosphorylated Met Receptor Kin 3e-21
2wd1_A292 Human C-Met Kinase In Complex With Azaindole Inhibi 3e-21
2g15_A318 Structural Characterization Of Autoinhibited C-Met 4e-21
4gg5_A319 Crystal Structure Of Cmet In Complex With Novel Inh 4e-21
3q6u_A308 Structure Of The Apo Met Receptor Kinase In The Dua 4e-21
3i5n_A309 Crystal Structure Of C-Met With Triazolopyridazine 4e-21
3lq8_A302 Structure Of The Kinase Domain Of C-Met Bound To Xl 4e-21
3f66_A298 Human C-Met Kinase In Complex With Quinoxaline Inhi 5e-21
3u4w_A275 Src In Complex With Dna-Templated Macrocyclic Inhib 5e-21
2wgj_A306 X-Ray Structure Of Pf-02341066 Bound To The Kinase 5e-21
2h8h_A535 Src Kinase In Complex With A Quinazoline Inhibitor 5e-21
2rfn_A310 X-ray Structure Of C-met With Inhibitor. Length = 3 5e-21
2ptk_A453 Chicken Src Tyrosine Kinase Length = 453 5e-21
3c1x_A373 Crystal Structure Of The Tyrosine Kinase Domain Of 5e-21
2pl0_A289 Lck Bound To Imatinib Length = 289 5e-21
3d7u_B277 Structural Basis For The Recognition Of C-Src By It 5e-21
3g6h_A286 Src Thr338ile Inhibited In The Dfg-Asp-Out Conforma 7e-21
3bys_A277 Co-Crystal Structure Of Lck And Aminopyrimidine Ami 7e-21
2bdf_A279 Src Kinase In Complex With Inhibitor Ap23451 Length 7e-21
2ofv_A277 Crystal Structure Of Aminoquinazoline 1 Bound To Lc 8e-21
2oiq_A286 Crystal Structure Of Chicken C-Src Kinase Domain In 8e-21
3svv_A286 Crystal Structure Of T338c C-Src Covalently Bound T 8e-21
1fmk_A452 Crystal Structure Of Human Tyrosine-Protein Kinase 8e-21
1y57_A452 Structure Of Unphosphorylated C-Src In Complex With 8e-21
1yol_A283 Crystal Structure Of Src Kinase Domain In Complex W 9e-21
3qti_A314 C-Met Kinase In Complex With Nvp-Bvu972 Length = 31 9e-21
3a4p_A319 Human C-Met Kinase Domain Complexed With 6-Benzylox 9e-21
2of2_A271 Crystal Structure Of Furanopyrimidine 8 Bound To Lc 1e-20
1p4o_A322 Structure Of Apo Unactivated Igf-1r Kinase Domain A 1e-20
3cth_A314 Crystal Structure Of The Tyrosine Kinase Domain Of 1e-20
3dkc_A317 Sgx Clone 5698a65kfg1h1 Length = 317 1e-20
2zm1_A285 Crystal Structure Of Imidazo Pyrazin 1 Bound To The 1e-20
1yi6_A276 C-Term Tail Segment Of Human Tyrosine Kinase (258-5 1e-20
3kxz_A287 The Complex Crystal Structure Of Lck With A Probe M 1e-20
3kmm_A288 Structure Of Human Lck Kinase With A Small Molecule 1e-20
1r0p_A312 Crystal Structure Of The Tyrosine Kinase Domain Of 1e-20
3oez_A286 Crystal Structure Of The L317i Mutant Of The Chicke 1e-20
2og8_A265 Crystal Structure Of Aminoquinazoline 36 Bound To L 1e-20
1ksw_A452 Structure Of Human C-Src Tyrosine Kinase (Thr338gly 1e-20
3dqw_A286 C-Src Kinase Domain Thr338ile Mutant In Complex Wit 1e-20
3geq_A286 Structural Basis For The Chemical Rescue Of Src Kin 1e-20
1m7n_A322 Crystal Structure Of Unactivated Apo Insulin-Like G 2e-20
3sxr_A268 Crystal Structure Of Bmx Non-Receptor Tyrosine Kina 2e-20
1qpe_A279 Structural Analysis Of The Lymphocyte-Specific Kina 2e-20
2qq7_A286 Crystal Structure Of Drug Resistant Src Kinase Doma 2e-20
2ofu_A273 X-Ray Crystal Structure Of 2-Aminopyrimidine Carbam 2e-20
1yoj_A283 Crystal Structure Of Src Kinase Domain Length = 283 2e-20
3lck_A271 The Kinase Domain Of Human Lymphocyte Kinase (Lck), 2e-20
3bym_A272 X-Ray Co-Crystal Structure Aminobenzimidazole Triaz 2e-20
2hwo_A286 Crystal Structure Of Src Kinase Domain In Complex W 2e-20
4e4l_A302 Jak1 Kinase (Jh1 Domain) In Complex With Compound 3 3e-20
2dq7_X283 Crystal Structure Of Fyn Kinase Domain Complexed Wi 3e-20
3mpm_A267 Lck Complexed With A Pyrazolopyrimidine Length = 26 3e-20
3o23_A305 Human Unphosphorylated Igf1-R Kinase Domain In Comp 3e-20
2zm3_A308 Complex Structure Of Insulin-Like Growth Factor Rec 4e-20
3lvp_A336 Crystal Structure Of Bisphosphorylated Igf1-R Kinas 4e-20
3eyg_A290 Crystal Structures Of Jak1 And Jak2 Inhibitor Compl 5e-20
3omv_A307 Crystal Structure Of C-Raf (Raf-1) Length = 307 6e-20
3lw0_A304 Igf-1rk In Complex With Ligand Msc1609119a-1 Length 7e-20
3i81_A315 Crystal Structure Of Insulin-Like Growth Factor 1 R 8e-20
2zv7_A279 Lyn Tyrosine Kinase Domain, Apo Form Length = 279 8e-20
1jqh_A308 Igf-1 Receptor Kinase Domain Length = 308 8e-20
1jpa_A312 Crystal Structure Of Unphosphorylated Ephb2 Recepto 8e-20
2oj9_A307 Structure Of Igf-1r Kinase Domain Complexed With A 9e-20
1k3a_A299 Structure Of The Insulin-Like Growth Factor 1 Recep 1e-19
4eqm_A294 Structural Analysis Of Staphylococcus Aureus Serine 2e-19
3a4o_X286 Lyn Kinase Domain Length = 286 2e-19
3c4c_A280 B-Raf Kinase In Complex With Plx4720 Length = 280 2e-19
3qqu_A301 Cocrystal Structure Of Unphosphorylated Igf With Py 2e-19
1qpd_A279 Structural Analysis Of The Lymphocyte-specific Kina 2e-19
4fk3_A292 B-Raf Kinase V600e Oncogenic Mutant In Complex With 3e-19
1mqb_A333 Crystal Structure Of Ephrin A2 (Epha2) Receptor Pro 3e-19
2hk5_A270 Hck Kinase In Complex With Lck Targetted Inhibitor 3e-19
2vwu_A302 Ephb4 Kinase Domain Inhibitor Complex Length = 302 4e-19
3lcd_A329 Inhibitor Bound To A Dfg-In Structure Of The Kinase 4e-19
3og7_A289 B-Raf Kinase V600e Oncogenic Mutant In Complex With 4e-19
4aw5_A291 Complex Of The Ephb4 Kinase Domain With An Oxindole 5e-19
3d94_A301 Crystal Structure Of The Insulin-Like Growth Factor 5e-19
2ogv_A317 Crystal Structure Of The Autoinhibited Human C-Fms 6e-19
1k9a_A450 Crystal Structure Analysis Of Full-Length Carboxyl- 6e-19
1qcf_A454 Crystal Structure Of Hck In Complex With A Src Fami 6e-19
2hel_A306 Crystal Structure Of A Mutant Epha4 Kinase Domain ( 7e-19
3q96_A282 B-Raf Kinase Domain In Complex With A Tetrahydronap 8e-19
3d7t_A269 Structural Basis For The Recognition Of C-Src By It 8e-19
2fb8_A281 Structure Of The B-Raf Kinase Domain Bound To Sb-59 8e-19
1byg_A278 Kinase Domain Of Human C-Terminal Src Kinase (Csk) 9e-19
4dbn_A284 Crystal Structure Of The Kinase Domain Of Human B-R 1e-18
4h58_A275 Braf In Complex With Compound 3 Length = 275 1e-18
3s95_A310 Crystal Structure Of The Human Limk1 Kinase Domain 1e-18
3d7u_A263 Structural Basis For The Recognition Of C-Src By It 1e-18
3pls_A298 Ron In Complex With Ligand Amp-Pnp Length = 298 1e-18
4e6d_A298 Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex W 1e-18
2r4b_A321 Erbb4 Kinase Domain Complexed With A Thienopyrimidi 1e-18
1uwj_A276 The Complex Of Mutant V599e B-raf And Bay439006 Len 1e-18
3ii5_A306 The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimi 1e-18
3d4q_A307 Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 1e-18
1ir3_A306 Phosphorylated Insulin Receptor Tyrosine Kinase In 1e-18
1uwh_A276 The Complex Of Wild Type B-Raf And Bay439006 Length 1e-18
1i44_A306 Crystallographic Studies Of An Activation Loop Muta 1e-18
2z8c_A303 Phosphorylated Insulin Receptor Tyrosine Kinase In 2e-18
3idp_A300 B-Raf V600e Kinase Domain In Complex With An Aminoi 2e-18
1rqq_A306 Crystal Structure Of The Insulin Receptor Kinase In 2e-18
4g9r_A307 B-Raf V600e Kinase Domain Bound To A Type Ii Dihydr 2e-18
2hen_A286 Crystal Structure Of The Ephb2 Receptor Kinase Doma 2e-18
1irk_A306 Crystal Structure Of The Tyrosine Kinase Domain Of 2e-18
2w1i_A326 Structure Determination Of Aurora Kinase In Complex 2e-18
3rvg_A303 Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido 3e-18
3lpb_A295 Crystal Structure Of Jak2 Complexed With A Potent 2 3e-18
3tjc_A298 Co-Crystal Structure Of Jak2 With Thienopyridine 8 3e-18
2b7a_A293 The Structural Basis Of Janus Kinase 2 Inhibition B 3e-18
3lco_A324 Inhibitor Bound To A Dfg-Out Structure Of The Kinas 3e-18
4hge_A300 Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 3e-18
4e4m_A302 Jak2 Kinase (Jh1 Domain) In Complex With Compound 3 3e-18
3bea_A333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A P 3e-18
3e62_A293 Fragment Based Discovery Of Jak-2 Inhibitors Length 3e-18
4aqc_A301 Triazolopyridine-Based Inhibitor Of Janus Kinase 2 4e-18
3q32_A301 Structure Of Janus Kinase 2 With A Pyrrolotriazine 4e-18
1ad5_A438 Src Family Kinase Hck-Amp-Pnp Complex Length = 438 4e-18
3eta_A317 Kinase Domain Of Insulin Receptor Complexed With A 4e-18
3jy9_A311 Janus Kinase 2 Inhibitors Length = 311 4e-18
3io7_A313 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Sel 4e-18
1rjb_A344 Crystal Structure Of Flt3 Length = 344 5e-18
2xyu_A285 Crystal Structure Of Epha4 Kinase Domain In Complex 5e-18
3cok_A278 Crystal Structure Of Plk4 Kinase Length = 278 5e-18
2qok_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 5e-18
3ugc_A295 Structural Basis Of Jak2 Inhibition By The Type Ii 6e-18
1luf_A343 Crystal Structure Of The Musk Tyrosine Kinase: Insi 6e-18
2y6m_A291 Crystal Structure Of Epha4 Kinase Domain Length = 2 7e-18
2xa4_A298 Inhibitors Of Jak2 Kinase Domain Length = 298 7e-18
3dzq_A361 Human Epha3 Kinase Domain In Complex With Inhibitor 8e-18
2qob_A344 Human Epha3 Kinase Domain, Base Structure Length = 8e-18
3bbt_B328 Crystal Structure Of The Erbb4 Kinase In Complex Wi 8e-18
2qoc_A344 Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp 8e-18
2i1m_A333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An 9e-18
1p14_A306 Crystal Structure Of A Catalytic-Loop Mutant Of The 9e-18
3ekk_A307 Insulin Receptor Kinase Complexed With An Inhibitor 1e-17
2qon_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 1e-17
2qoo_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 1e-17
2r2p_A295 Kinase Domain Of Human Ephrin Type-A Receptor 5 (Ep 1e-17
2qoi_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 1e-17
2gsf_A373 The Human Epha3 Receptor Tyrosine Kinase And Juxtam 1e-17
3fxx_A371 Human Epha3 Kinase And Juxtamembrane Region Bound T 1e-17
2qof_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f 1e-17
2qod_A373 Human Epha3 Kinase And Juxtamembrane Region, Y602f 1e-17
4bbe_A298 Aminoalkylpyrimidine Inhibitor Complexes With Jak2 1e-17
2qo7_A373 Human Epha3 Kinase And Juxtamembrane Region, Dephos 2e-17
2qol_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596:y 2e-17
3pp0_A338 Crystal Structure Of The Kinase Domain Of Human Her 3e-17
3f61_A311 Crystal Structure Of M. Tuberculosis Pknb Leu33aspV 3e-17
4hzs_A341 Crystal Structure Of Ack1 Kinase Domain With C-term 4e-17
3f69_A311 Crystal Structure Of The Mycobacterium Tuberculosis 4e-17
1u54_A291 Crystal Structures Of The Phosphorylated And Unphos 4e-17
1u46_A291 Crystal Structure Of The Unphosphorylated Kinase Do 5e-17
3ori_A311 Mycobacterium Tuberculosis Pknb Kinase Domain L33d 5e-17
4ewh_B275 Co-Crystal Structure Of Ack1 With Inhibitor Length 5e-17
3eqp_B276 Crystal Structure Of Ack1 With Compound T95 Length 5e-17
4hzr_A277 Crystal Structure Of Ack1 Kinase Domain Length = 27 6e-17
3niz_A311 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 7e-17
4id7_A273 Ack1 Kinase In Complex With The Inhibitor Cis-3-[8- 8e-17
2qkr_A313 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 8e-17
4gt4_A308 Structure Of Unliganded, Inactive Ror2 Kinase Domai 9e-17
2i0v_A335 C-Fms Tyrosine Kinase In Complex With A Quinolone I 1e-16
3zzw_A289 Crystal Structure Of The Kinase Domain Of Ror2 Leng 1e-16
3kul_A325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 1e-16
2rei_A318 Kinase Domain Of Human Ephrin Type-a Receptor 7 (ep 1e-16
3gen_A283 The 1.6 A Crystal Structure Of Human Bruton's Tyros 1e-16
1s9i_A354 X-Ray Structure Of The Human Mitogen-Activated Prot 1e-16
3qrj_A277 The Crystal Structure Of Human Abl1 Kinase Domain T 2e-16
3c4f_A302 Fgfr Tyrosine Kinase Domain In Complex With 3-(3- M 2e-16
3kul_B325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 2e-16
3qri_A277 The Crystal Structure Of Human Abl1 Kinase Domain I 2e-16
3k54_A283 Structures Of Human Bruton's Tyrosine Kinase In Act 2e-16
3gql_A326 Crystal Structure Of Activated Receptor Tyrosine Ki 2e-16
3p08_A267 Crystal Structure Of The Human Btk Kinase Domain Le 2e-16
3rhx_B306 Crystal Structure Of The Catalytic Domain Of Fgfr1 2e-16
2hzi_A277 Abl Kinase Domain In Complex With Pd180970 Length = 2e-16
3pix_A274 Crystal Structure Of Btk Kinase Domain Complexed Wi 2e-16
2hyy_A273 Human Abl Kinase Domain In Complex With Imatinib (S 2e-16
2e2b_A293 Crystal Structure Of The C-Abl Kinase Domain In Com 2e-16
1fgk_A310 Crystal Structure Of The Tyrosine Kinase Domain Of 2e-16
4f63_A309 Crystal Structure Of Human Fibroblast Growth Factor 3e-16
3qa8_A 676 Crystal Structure Of Inhibitor Of Kappa B Kinase Be 3e-16
3rzf_A 677 Crystal Structure Of Inhibitor Of Kappab Kinase Bet 3e-16
3ocs_A271 Crystal Structure Of Bruton's Tyrosine Kinase In Co 3e-16
2j0l_A276 Crystal Structure Of A The Active Conformation Of T 3e-16
3kxx_A317 Structure Of The Mutant Fibroblast Growth Factor Re 3e-16
1k2p_A263 Crystal Structure Of Bruton's Tyrosine Kinase Domai 3e-16
2hz0_A270 Abl Kinase Domain In Complex With Nvp-Aeg082 Length 3e-16
3tt0_A382 Co-Structure Of Fibroblast Growth Factor Receptor 1 3e-16
3js2_A317 Crystal Structure Of Minimal Kinase Domain Of Fibro 3e-16
3lct_A344 Crystal Structure Of The Anaplastic Lymphoma Kinase 3e-16
3l9p_A367 Crystal Structure Of The Anaplastic Lymphoma Kinase 3e-16
4ebw_A304 Structure Of Focal Adhesion Kinase Catalytic Domain 3e-16
2jkm_A276 Focal Adhesion Kinase Catalytic Domain In Complex W 3e-16
3pyy_A298 Discovery And Characterization Of A Cell-Permeable, 4e-16
2hiw_A287 Crystal Structure Of Inactive Conformation Abl Kina 4e-16
3pxk_A282 Focal Adhesion Kinase Catalytic Domain In Complex W 4e-16
2g1t_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 4e-16
2etm_A281 Crystal Structure Of Focal Adhesion Kinase Domain C 4e-16
1mp8_A281 Crystal Structure Of Focal Adhesion Kinase (Fak) Le 4e-16
3bz3_A276 Crystal Structure Analysis Of Focal Adhesion Kinase 5e-16
2j0m_B276 Crystal Structure A Two-Chain Complex Between The F 5e-16
2gqg_A278 X-Ray Crystal Structure Of Dasatinib (Bms-354825) B 5e-16
4fnw_A327 Crystal Structure Of The Apo F1174l Anaplastic Lymp 5e-16
2v7a_A286 Crystal Structure Of The T315i Abl Mutant In Comple 5e-16
3orm_A311 Mycobacterium Tuberculosis Pknb Kinase Domain D76a 6e-16
3gqi_A326 Crystal Structure Of Activated Receptor Tyrosine Ki 6e-16
2yjr_A342 Structure Of F1174l Mutant Anaplastic Lymphoma Kina 7e-16
2oo8_X317 Synthesis, Structural Analysis, And Sar Studies Of 8e-16
2jkk_A276 Focal Adhesion Kinase Catalytic Domain In Complex W 8e-16
2j0j_A656 Crystal Structure Of A Fragment Of Focal Adhesion K 8e-16
1fvr_A327 Tie2 Kinase Domain Length = 327 8e-16
1mru_A311 Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycob 8e-16
1fpu_A293 Crystal Structure Of Abl Kinase Domain In Complex W 9e-16
2qlu_A314 Crystal Structure Of Activin Receptor Type Ii Kinas 1e-15
3oy3_A284 Crystal Structure Of Abl T315i Mutant Kinase Domain 1e-15
2z60_A288 Crystal Structure Of The T315i Mutant Of Abl Kinase 1e-15
4fnz_A327 Crystal Structure Of Human Anaplastic Lymphoma Kina 1e-15
3oxz_A284 Crystal Structure Of Abl Kinase Domain Bound With A 1e-15
3oht_A389 Crystal Structure Of Salmo Salar P38alpha Length = 1e-15
1ob3_A288 Structure Of P. Falciparum Pfpk5 Length = 288 1e-15
2yfx_A327 Structure Of L1196m Mutant Anaplastic Lymphoma Kina 1e-15
2qoh_A288 Crystal Structure Of Abl Kinase Bound With Ppy-a Le 1e-15
2xb7_A315 Structure Of Human Anaplastic Lymphoma Kinase In Co 1e-15
3oct_A265 Crystal Structure Of Bruton's Tyrosine Kinase Mutan 1e-15
4fob_A353 Crystal Structure Of Human Anaplastic Lymphoma Kina 1e-15
3nyx_A302 Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-T 1e-15
4dce_A333 Crystal Structure Of Human Anaplastic Lymphoma Kina 1e-15
3ika_A331 Crystal Structure Of Egfr 696-1022 T790m Mutant Cov 1e-15
2xp2_A327 Structure Of The Human Anaplastic Lymphoma Kinase I 1e-15
1v0o_A288 Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulpho 1e-15
3aox_A344 X-Ray Crystal Structure Of Human Anaplastic Lymphom 2e-15
1opl_A537 Structural Basis For The Auto-Inhibition Of C-Abl T 2e-15
2f4j_A287 Structure Of The Kinase Domain Of An Imatinib-Resis 2e-15
2yhv_A342 Structure Of L1196m Mutant Anaplastic Lymphoma Kina 2e-15
2fo0_A495 Organization Of The Sh3-Sh2 Unit In Active And Inac 2e-15
1v0b_A288 Crystal Structure Of The T198a Mutant Of Pfpk5 Leng 2e-15
2jiu_A328 Crystal Structure Of Egfr Kinase Domain T790m Mutat 2e-15
2g2f_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 2e-15
2pk9_A317 Structure Of The Pho85-pho80 Cdk-cyclin Complex Of 2e-15
1o6y_A299 Catalytic Domain Of Pknb Kinase From Mycobacterium 2e-15
2j0k_A656 Crystal Structure Of A Fragment Of Focal Adhesion K 2e-15
4i24_A329 Structure Of T790m Egfr Kinase Domain Co-crystalliz 2e-15
2jiv_A328 Crystal Structure Of Egfr Kinase Domain T790m Mutat 2e-15
3dak_A290 Crystal Structure Of Domain-Swapped Osr1 Kinase Dom 2e-15
2yjs_A342 Structure Of C1156y Mutant Anaplastic Lymphoma Kina 2e-15
2vwi_A303 Structure Of The Osr1 Kinase, A Hypertension Drug T 2e-15
2wqm_A310 Structure Of Apo Human Nek7 Length = 310 2e-15
1m14_A333 Tyrosine Kinase Domain From Epidermal Growth Factor 2e-15
3c7q_A316 Structure Of Vegfr2 Kinase Domain In Complex With B 2e-15
2p0c_A313 Catalytic Domain Of The Proto-Oncogene Tyrosine-Pro 2e-15
4g5p_A330 Crystal Structure Of Egfr Kinase T790m In Complex W 2e-15
3ezr_A300 Cdk-2 With Indazole Inhibitor 17 Bound At Its Activ 2e-15
2jit_A327 Crystal Structure Of Egfr Kinase Domain T790m Mutat 2e-15
4i23_A329 Crystal Structure Of The Wild-type Egfr Kinase Doma 3e-15
3pxf_A306 Cdk2 In Complex With Two Molecules Of 8-Anilino-1-N 3e-15
3vjo_A334 Crystal Structure Of The Wild-Type Egfr Kinase Doma 3e-15
4erw_A306 Cdk2 In Complex With Staurosporine Length = 306 3e-15
3nz0_A302 Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 3 3e-15
2w17_A299 Cdk2 In Complex With The Imidazole Pyrimidine Amide 3e-15
1opk_A495 Structural Basis For The Auto-Inhibition Of C-Abl T 3e-15
1fin_A298 Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 3e-15
3pj8_A299 Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D] 3e-15
2pvf_A334 Crystal Structure Of Tyrosine Phosphorylated Activa 3e-15
1gz8_A299 Human Cyclin Dependent Kinase 2 Complexed With The 3e-15
1xkk_A352 Egfr Kinase Domain Complexed With A Quinazoline Inh 3e-15
2wqb_A324 Structure Of The Tie2 Kinase Domain In Complex With 3e-15
3cly_A334 Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase 3e-15
1pf8_A298 Crystal Structure Of Human Cyclin-dependent Kinase 3e-15
2oh4_A316 Crystal Structure Of Vegfr2 With A Benzimidazole-Ur 3e-15
4g5j_A330 Crystal Structure Of Egfr Kinase In Complex With Bi 3e-15
2j5f_A327 Crystal Structure Of Egfr Kinase Domain In Complex 3e-15
2gs2_A330 Crystal Structure Of The Active Egfr Kinase Domain 3e-15
2p2h_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 4e-15
2gs7_A330 Crystal Structure Of The Inactive Egfr Kinase Domai 4e-15
3lzb_A327 Egfr Kinase Domain Complexed With An Imidazo[2,1-B] 4e-15
1vyw_A309 Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 4e-15
4fnx_A327 Crystal Structure Of The Apo R1275q Anaplastic Lymp 4e-15
2p2i_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 4e-15
2j5e_A327 Crystal Structure Of Egfr Kinase Domain In Complex 4e-15
2ivv_A314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 4e-15
3u6j_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 4e-15
2f57_A317 Crystal Structure Of The Human P21-activated Kinase 4e-15
3lxn_A318 Structural And Thermodynamic Characterization Of Th 4e-15
3ewh_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 4e-15
1vr2_A316 Human Vascular Endothelial Growth Factor Receptor 2 5e-15
1ywn_A316 Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]p 5e-15
3gvu_A292 The Crystal Structure Of Human Abl2 In Complex With 5e-15
1gii_A298 Human Cyclin Dependent Kinase 2 Complexed With The 5e-15
1pkg_A329 Structure Of A C-kit Kinase Product Complex Length 5e-15
2psq_A370 Crystal Structure Of Unphosphorylated Unactivated W 5e-15
2pzp_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 5e-15
3gop_A361 Crystal Structure Of The Egf Receptor Juxtamembrane 5e-15
3g0e_A336 Kit Kinase Domain In Complex With Sunitinib Length 6e-15
2xir_A316 Crystal Structure Of The Vegfr2 Kinase Domain In Co 6e-15
2ivt_A314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 6e-15
2puu_A348 Crystal Structure Of P38 Complex With 1-(5-Tert-But 6e-15
3vnt_A318 Crystal Structure Of The Kinase Domain Of Human Veg 6e-15
2fsl_X367 Mitogen Activated Protein Kinase P38alpha (D176a+f3 7e-15
3cjf_A309 Crystal Structure Of Vegfr2 In Complex With A 3,4,5 7e-15
1oit_A299 Imidazopyridines: A Potent And Selective Class Of C 7e-15
4agc_A353 Crystal Structure Of Vegfr2 (Juxtamembrane And Kina 7e-15
3cjg_A309 Crystal Structure Of Vegfr2 In Complex With A 3,4,5 7e-15
2iw6_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A Com 7e-15
4e1z_A291 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 7e-15
2baq_A365 P38alpha Bound To Ro3201195 Length = 365 7e-15
4e20_A290 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 7e-15
2pvy_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 7e-15
1t46_A313 Structural Basis For The Autoinhibition And Sti-571 7e-15
2z7q_A321 Crystal Structure Of The N-Terminal Kinase Domain O 7e-15
2pz5_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 7e-15
2fso_X367 Mitogen Activated Protein Kinase P38alpha (D176a) A 7e-15
1t45_A331 Structural Basis For The Autoinhibition And Sti-571 7e-15
4hjo_A337 Crystal Structure Of The Inactive Egfr Tyrosine Kin 8e-15
2fst_X367 Mitogen Activated Protein Kinase P38alpha (d176a+f3 8e-15
4e5a_X360 The W197a Mutant Of P38a Map Kinase Length = 360 8e-15
3b2t_A311 Structure Of Phosphotransferase Length = 311 8e-15
4eos_A300 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 9e-15
2ivs_A314 Crystal Structure Of Non-Phosphorylated Ret Tyrosin 9e-15
3ug1_A334 Crystal Structure Of The Mutated Egfr Kinase Domain 9e-15
3orn_A307 Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In 9e-15
3g0f_A336 Kit Kinase Domain Mutant D816h In Complex With Suni 9e-15
4eoq_A301 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 1e-14
4bcq_A301 Structure Of Cdk2 In Complex With Cyclin A And A 2- 1e-14
1e9h_A297 Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex 1e-14
1lew_A360 Crystal Structure Of Map Kinase P38 Complexed To Th 1e-14
2pwl_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 1e-14
4eop_A300 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 1e-14
3p4k_A370 The Third Conformation Of P38a Map Kinase Observed 1e-14
2gtm_A348 Mutated Mouse P38 Map Kinase Domain In Complex With 1e-14
3dk6_A293 Crystal Structure Of Mutant Abl Kinase Domain In Co 1e-14
1ogu_A302 Structure Of Human Thr160-phospho Cdk2/cyclin A Com 1e-14
3ri1_A313 Crystal Structure Of The Catalytic Domain Of Fgfr2 1e-14
1qmz_A299 Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com 1e-14
4i1z_A329 Crystal Structure Of The Monomeric (v948r) Form Of 1e-14
1w98_A298 The Structural Basis Of Cdk2 Activation By Cyclin E 1e-14
1bmk_A379 The Complex Structure Of The Map Kinase P38SB218655 1e-14
1h1p_A303 Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMP 1e-14
1gjo_A316 The Fgfr2 Tyrosine Kinase Domain Length = 316 1e-14
2bal_A365 P38alpha Map Kinase Bound To Pyrazoloamine Length = 1e-14
4i3z_A296 Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES 1e-14
2xik_A294 Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related K 1e-14
3bel_A315 X-Ray Structure Of Egfr In Complex With Oxime Inhib 1e-14
4eoo_A299 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 1e-14
3bht_A300 Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN 1e-14
3hvc_A362 Crystal Structure Of Human P38alpha Map Kinase Leng 1e-14
3d83_A360 Crystal Structure Of P38 Kinase In Complex With A B 1e-14
4i21_A329 Crystal Structure Of L858r + T790m Egfr Kinase Doma 1e-14
3ody_X360 Crystal Structure Of P38alpha Y323q Active Mutant L 1e-14
2eb2_A334 Crystal Structure Of Mutated Egfr Kinase Domain (G7 1e-14
3nnu_A354 Crystal Structure Of P38 Alpha In Complex With Dp13 1e-14
3tg1_A380 Crystal Structure Of P38alpha In Complex With A Map 1e-14
3oef_X360 Crystal Structure Of Y323f Inactive Mutant Of P38al 1e-14
4eoi_A299 Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc 1e-14
3od6_X360 Crystal Structure Of P38alpha Y323t Active Mutant L 1e-14
3e92_A371 Crystal Structure Of P38 Kinase In Complex With A B 1e-14
3is5_A285 Crystal Structure Of Cdpk Kinase Domain From Toxopl 1e-14
3odz_X360 Crystal Structure Of P38alpha Y323r Active Mutant L 1e-14
3g2f_A336 Crystal Structure Of The Kinase Domain Of Bone Morp 1e-14
1bi8_A326 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 1e-14
2baj_A365 P38alpha Bound To Pyrazolourea Length = 365 1e-14
3hrb_A359 P38 Kinase Crystal Structure In Complex With Small 1e-14
2npq_A367 A Novel Lipid Binding Site In The P38 Alpha Map Kin 1e-14
1di9_A360 The Structure Of P38 Mitogen-Activated Protein Kina 1e-14
3a7f_A303 Human Mst3 Kinase Length = 303 1e-14
2pzr_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 1e-14
3gcu_A360 Human P38 Map Kinase In Complex With Rl48 Length = 1e-14
2oza_B366 Structure Of P38alpha Complex Length = 366 1e-14
1oir_A299 Imidazopyridines: A Potent And Selective Class Of C 1e-14
1h01_A298 Cdk2 In Complex With A Disubstituted 2, 4-Bis Anili 1e-14
4i20_A329 Crystal Structure Of Monomeric (v948r) Primary Onco 1e-14
4h1j_A293 Crystal Structure Of Pyk2 With The Pyrazole 13a Len 1e-14
2lgc_A359 Joint Nmr And X-Ray Refinement Reveals The Structur 1e-14
2jgz_A289 Crystal Structure Of Phospho-Cdk2 In Complex With C 1e-14
1jst_A298 Phosphorylated Cyclin-Dependent Kinase-2 Bound To C 1e-14
3k3j_A362 P38alpha Bound To Novel Dfg-Out Compound Pf-0041612 1e-14
1oz1_A372 P38 Mitogen-Activated Kinase In Complex With 4-Azai 1e-14
2gfs_A372 P38 Kinase Crystal Structure In Complex With Ro3201 1e-14
3hec_A348 P38 In Complex With Imatinib Length = 348 1e-14
3qhr_A298 Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic 1e-14
1bl6_A379 The Complex Structure Of The Map Kinase P38SB216995 1e-14
3zsg_A362 X-Ray Structure Of P38alpha Bound To Tak-715 Length 1e-14
3q4t_A322 Crystal Structure Of Activin Receptor Type-Iia (Acv 1e-14
3k3i_A350 P38alpha Bound To Novel Dgf-Out Compound Pf-0021595 1e-14
1h1w_A289 High Resolution Crystal Structure Of The Human Pdk1 1e-14
3s3i_A349 P38 Kinase Crystal Structure In Complex With Small 2e-14
3mpt_A371 Crystal Structure Of P38 Kinase In Complex With A P 2e-14
2itn_A327 Crystal Structure Of Egfr Kinase Domain G719s Mutat 2e-14
2y8o_A362 Crystal Structure Of Human P38alpha Complexed With 2e-14
3orx_A316 Pdk1 Mutant Bound To Allosteric Disulfide Fragment 2e-14
3d7z_A360 Crystal Structure Of P38 Kinase In Complex With A B 2e-14
3cc6_A281 Crystal Structure Of Kinase Domain Of Protein Tyros 2e-14
1zzl_A351 Crystal Structure Of P38 With Triazolopyridine Leng 2e-14
3kq7_A380 Structure Of Human P38alpha With N-[4-Methyl-3-(6-{ 2e-14
2y4i_C395 Ksr2-Mek1 Heterodimer Length = 395 2e-14
2eb3_A334 Crystal Structure Of Mutated Egfr Kinase Domain (L8 2e-14
1ove_A366 The Structure Of P38 Alpha In Complex With A Dihydr 2e-14
1m7q_A366 Crystal Structure Of P38 Map Kinase In Complex With 2e-14
3fzo_A277 Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosin 2e-14
3dk7_A277 Crystal Structure Of Mutant Abl Kinase Domain In Co 2e-14
3dt1_A383 P38 Complexed With A Quinazoline Inhibitor Length = 2e-14
3ckx_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 2e-14
2rfd_A324 Crystal Structure Of The Complex Between The Egfr K 2e-14
1uu9_A286 Structure Of Human Pdk1 Kinase Domain In Complex Wi 2e-14
1jow_B308 Crystal Structure Of A Complex Of Human Cdk6 And A 2e-14
3nup_A307 Cdk6 (Monomeric) In Complex With Inhibitor Length = 2e-14
4ewq_A383 Human P38 Alpha Mapk In Complex With A Pyridazine B 2e-14
1ian_A366 Human P38 Map Kinase Inhibitor Complex Length = 366 2e-14
3dk3_A293 Crystal Structure Of Mutant Abl Kinase Domain In Co 2e-14
3zhp_C294 Human Mst3 (stk24) In Complex With Mo25beta Length 2e-14
3ckw_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 2e-14
3com_A314 Crystal Structure Of Mst1 Kinase Length = 314 2e-14
3cd3_A377 Crystal Structure Of Phosphorylated Human Feline Sa 2e-14
2itt_A327 Crystal Structure Of Egfr Kinase Domain L858r Mutat 2e-14
1z5m_A286 Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrr 2e-14
4hvd_A314 Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h 3e-14
3nus_A286 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fra 3e-14
2r7b_A312 Crystal Structure Of The Phosphoinositide-Dependent 3e-14
3pjc_A315 Crystal Structure Of Jak3 Complexed With A Potent A 3e-14
4an2_A301 Crystal Structures Of Human Mek1 With Carboxamide-B 3e-14
3nnx_A354 Crystal Structure Of Phosphorylated P38 Alpha In Co 3e-14
3h9o_A311 Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) 3e-14
3bkb_A377 Crystal Structure Of Human Feline Sarcoma Viral Onc 3e-14
3lxk_A327 Structural And Thermodynamic Characterization Of Th 3e-14
3iop_A312 Pdk-1 In Complex With The Inhibitor Compound-8i Len 3e-14
2q0b_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 3e-14
2p55_A333 X-Ray Structure Of The Human Mitogen-Activated Prot 3e-14
3w2o_A331 Egfr Kinase Domain T790m/l858r Mutant With Tak-285 3e-14
3mh2_A360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 3e-14
3fi4_A372 P38 Kinase Crystal Structure In Complex With Ro4499 3e-14
2uv2_A287 Crystal Structure Of Human Ste20-Like Kinase Bound 3e-14
2ghl_A348 Mutant Mus Musculus P38 Kinase Domain In Complex Wi 3e-14
1s9j_A341 X-Ray Structure Of The Human Mitogen-Activated Prot 3e-14
3qc4_A314 Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 3e-14
1ywr_A360 Crystal Structure Analysis Of Inactive P38 Kinase D 3e-14
3py3_A380 Crystal Structure Of Phosphorylated P38alpha Map Ki 3e-14
3dfa_A286 Crystal Structure Of Kinase Domain Of Calcium-depen 4e-14
1yw2_A360 Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 4e-14
2xch_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 4e-14
1uu3_A310 Structure Of Human Pdk1 Kinase Domain In Complex Wi 4e-14
3sc1_A311 Novel Isoquinolone Pdk1 Inhibitors Discovered Throu 4e-14
2wei_A287 Crystal Structure Of The Kinase Domain Of Cryptospo 4e-14
3rwp_A311 Discovery Of A Novel, Potent And Selective Inhibito 4e-14
3hrc_A311 Crystal Structure Of A Mutant Of Human Pdk1 Kinase 4e-14
2biy_A310 Structure Of Pdk1-S241a Mutant Kinase Domain Length 4e-14
4a07_A311 Human Pdk1 Kinase Domain In Complex With Allosteric 4e-14
3gcp_A360 Human P38 Map Kinase In Complex With Sb203580 Lengt 5e-14
2py3_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 5e-14
4fie_A423 Full-Length Human Pak4 Length = 423 6e-14
3ma6_A298 Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr 6e-14
3pwy_A311 Crystal Structure Of An Extender (Spd28345)-Modifie 6e-14
3mbl_A328 Crystal Structure Of The Human Mitogen-Activated Pr 6e-14
3dv3_A322 Mek1 With Pf-04622664 Bound Length = 322 6e-14
3qc9_A543 Crystal Structure Of Cross-Linked Bovine Grk1 T8cN4 6e-14
3c4w_A543 Crystal Structure Of G Protein Coupled Receptor Kin 6e-14
3c4x_A543 Crystal Structure Of G Protein Coupled Receptor Kin 7e-14
3nun_A292 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lea 7e-14
1yvj_A290 Crystal Structure Of The Jak3 Kinase Domain In Comp 7e-14
2jfm_A325 Crystal Structure Of Human Ste20-Like Kinase (Unlig 7e-14
2j51_A325 Crystal Structure Of Human Ste20-Like Kinase Bound 7e-14
3igo_A486 Crystal Structure Of Cryptosporidium Parvum Cdpk1, 7e-14
3t8o_A543 Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolu 7e-14
3eqc_A360 X-Ray Structure Of The Human Mitogen-Activated Prot 7e-14
3nax_A311 Pdk1 In Complex With Inhibitor Mp7 Length = 311 8e-14
3ggf_A301 Crystal Structure Of Human SerineTHREONINE-Protein 8e-14
4apc_A350 Crystal Structure Of Human Nima-Related Kinase 1 (N 8e-14
4g31_A299 Crystal Structure Of Gsk6414 Bound To Perk (R587-R1 8e-14
3gi3_A360 Crystal Structure Of A N-Phenyl-N'-Naphthylurea Ana 9e-14
3nay_A311 Pdk1 In Complex With Inhibitor Mp6 Length = 311 9e-14
3fi3_A364 Crystal Structure Of Jnk3 With Indazole Inhibitor, 9e-14
2jfl_A325 Crystal Structure Of Human Ste20-Like Kinase ( Diph 9e-14
4eom_A301 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 1e-13
4eoj_A302 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 1e-13
2hak_A328 Catalytic And Ubiqutin-Associated Domains Of Mark1P 1e-13
2xck_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 1e-13
3vul_A370 Crystal Structure Of A Cysteine-deficient Mutant M1 1e-13
4eon_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 1e-13
4eok_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 1e-13
3o8p_A360 Conformational Plasticity Of P38 Map Kinase Dfg Mot 1e-13
1pme_A380 Structure Of Penta Mutant Human Erk2 Map Kinase Com 1e-13
3ttj_A464 Crystal Structure Of Jnk3 Complexed With Cc-359, A 1e-13
3vum_A370 Crystal Structure Of A Cysteine-deficient Mutant M7 1e-13
4fif_A346 Catalytic Domain Of Human Pak4 With Rpkplvdp Peptid 1e-13
1fot_A318 Structure Of The Unliganded Camp-Dependent Protein 1e-13
2x7f_A326 Crystal Structure Of The Kinase Domain Of Human Tra 1e-13
4bc6_A293 Crystal Structure Of Human Serine Threonine Kinase- 1e-13
3sls_A304 Crystal Structure Of Human Mek-1 Kinase In Complex 1e-13
2iw8_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82 1e-13
2cdz_A303 Crystal Structure Of The Human P21-Activated Kinase 2e-13
3hx4_A508 Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg 2e-13
3kvx_A364 Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Le 2e-13
1u59_A287 Crystal Structure Of The Zap-70 Kinase Domain In Co 2e-13
2q0n_A301 Structure Of Human P21 Activating Kinase 4 (Pak4) I 2e-13
3ku2_A507 Crystal Structure Of Inactivated Form Of Cdpk1 From 2e-13
3mh0_A360 Mutagenesis Of P38 Map Kinase Eshtablishes Key Role 2e-13
2j7t_A302 Crystal Structure Of Human Serine Threonine Kinase- 2e-13
2r9s_A356 C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Qu 2e-13
3i79_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 2e-13
3mh3_A360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 2e-13
1jnk_A423 The C-Jun N-Terminal Kinase (Jnk3s) Complexed With 2e-13
2ozo_A613 Autoinhibited Intact Human Zap-70 Length = 613 2e-13
2r0i_A327 Crystal Structure Of A Kinase Mark2PAR-1 Mutant Len 2e-13
3fi2_A353 Crystal Structure Of Jnk3 With Amino-Pyrazole Inhib 2e-13
2x4z_A296 Crystal Structure Of The Human P21-Activated Kinase 2e-13
3fv8_A355 Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Le 2e-13
1zmu_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 2e-13
2bva_A292 Crystal Structure Of The Human P21-Activated Kinase 2e-13
3mh1_A360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 2e-13
1b6c_B342 Crystal Structure Of The Cytoplasmic Domain Of The 3e-13
1h4l_A292 Structure And Regulation Of The Cdk5-P25(Nck5a) Com 3e-13
3oxi_A362 Design And Synthesis Of Disubstituted Thiophene And 3e-13
1ua2_A346 Crystal Structure Of Human Cdk7 Length = 346 3e-13
3ptg_A363 Design And Synthesis Of A Novel, Orally Efficacious 3e-13
2o0u_A364 Crystal Structure Of Human Jnk3 Complexed With N-{3 3e-13
1pmn_A364 Crystal Structure Of Jnk3 In Complex With An Imidaz 3e-13
1rw8_A301 Crystal Structure Of Tgf-Beta Receptor I Kinase Wit 3e-13
2qnj_A328 Kinase And Ubiquitin-Associated Domains Of Mark3PAR 3e-13
1py5_A326 Crystal Structure Of Tgf-Beta Receptor I Kinase Wit 3e-13
2b1p_A355 Inhibitor Complex Of Jnk3 Length = 355 3e-13
3tzm_A309 Tgf-Beta Receptor Type 1 In Complex With Sb431542 L 3e-13
2j4z_A306 Structure Of Aurora-2 In Complex With Pha-680626 Le 3e-13
4h36_A356 Crystal Structure Of Jnk3 In Complex With Atf2 Pept 3e-13
2ok1_A365 Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3 3e-13
2wot_A306 Alk5 In Complex With 4-((5,6-Dimethyl-2-(2-Pyridyl) 3e-13
3d5w_A317 Crystal Structure Of A Phosphorylated Polo-Like Kin 3e-13
2exc_X356 Inhibitor Complex Of Jnk3 Length = 356 3e-13
4aaa_A331 Crystal Structure Of The Human Cdkl2 Kinase Domain 3e-13
3d5v_A317 Crystal Structure Of An Activated (Thr->asp) Polo-L 3e-13
3g51_A325 Structural Diversity Of The Active Conformation Of 3e-13
3d5u_A317 Crystal Structure Of A Wildtype Polo-Like Kinase 1 4e-13
2dyl_A318 Crystal Structure Of Human Mitogen-Activated Protei 4e-13
2wzj_A327 Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82 4e-13
1vjy_A303 Crystal Structure Of A Naphthyridine Inhibitor Of H 4e-13
1zmw_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 4e-13
2wtw_A285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 4e-13
2xru_A280 Aurora-A T288e Complexed With Pha-828300 Length = 2 5e-13
1u5q_A348 Crystal Structure Of The Tao2 Kinase Domain: Activa 5e-13
1zmv_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 5e-13
3vuk_A370 Crystal Structure Of A Cysteine-deficient Mutant M5 5e-13
1ukh_A369 Structural Basis For The Selective Inhibition Of Jn 6e-13
1yhv_A297 Crystal Structure Of Pak1 Kinase Domain With Two Po 6e-13
2clq_A295 Structure Of Mitogen-Activated Protein Kinase Kinas 6e-13
3vui_A370 Crystal Structure Of A Cysteine-deficient Mutant M2 6e-13
3vug_A370 Crystal Structure Of A Cysteine-deficient Mutant M2 6e-13
3db6_A301 Crystal Structure Of An Activated (Thr->asp) Polo-L 6e-13
4fl3_A635 Structural And Biophysical Characterization Of The 6e-13
2xrw_A371 Linear Binding Motifs For Jnk And For Calcineurin A 6e-13
3iec_A319 Helicobacter Pylori Caga Inhibits Par1MARK FAMILY K 6e-13
3ubd_A304 Structure Of N-Terminal Domain Of Rsk2 Kinase In Co 7e-13
3vud_A370 Crystal Structure Of A Cysteine-deficient Mutant M1 7e-13
4el9_A305 Structure Of N-Terminal Kinase Domain Of Rsk2 With 7e-13
3fe3_A328 Crystal Structure Of The Kinase Mark3PAR-1: T211a-S 7e-13
3v3v_A379 Structural And Functional Analysis Of Quercetagetin 7e-13
2j50_A280 Structure Of Aurora-2 In Complex With Pha-739358 Le 7e-13
3vuh_A370 Crystal Structure Of A Cysteine-deficient Mutant M3 7e-13
2gcd_A309 Tao2 Kinase Domain-Staurosporine Structure Length = 7e-13
4fl2_A636 Structural And Biophysical Characterization Of The 8e-13
2c6e_A283 Aurora A Kinase Activated Mutant (T287d) In Complex 8e-13
3q52_A306 Structure Of Phosphorylated Pak1 Kinase Domain Leng 8e-13
3npc_A364 Crystal Structure Of Jnk2 Complexed With Birb796 Le 8e-13
2xng_A283 Structure Of Aurora-A Bound To A Selective Imidazop 8e-13
1muo_A297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 8e-13
3fxz_A297 Crystal Structure Of Pak1 Kinase Domain With Ruthen 8e-13
2x6d_A285 Aurora-A Bound To An Inhibitor Length = 285 9e-13
2dwb_A285 Aurora-A Kinase Complexed With Amppnp Length = 285 9e-13
3lmg_A344 Crystal Structure Of The Erbb3 Kinase Domain In Com 9e-13
3fdn_A279 Structure-Based Drug Design Of Novel Aurora Kinase 9e-13
3kex_A325 Crystal Structure Of The Catalytically Inactive Kin 9e-13
4ic7_A442 Crystal Structure Of The Erk5 Kinase Domain In Comp 9e-13
1f3m_C297 Crystal Structure Of Human SerineTHREONINE KINASE P 1e-12
1y8g_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 1e-12
2c6d_A275 Aurora A Kinase Activated Mutant (T287d) In Complex 1e-12
2bmc_A306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 1e-12
3gc9_A370 The Structure Of P38beta C119s, C162s In Complex Wi 1e-12
3vw6_A269 Crystal Structure Of Human Apoptosis Signal-Regulat 1e-12
3a62_A327 Crystal Structure Of Phosphorylated P70s6k1 Length 1e-12
3nyn_A576 Crystal Structure Of G Protein-Coupled Receptor Kin 1e-12
3hko_A345 Crystal Structure Of A Cdpk Kinase Domain From Cryp 1e-12
3lau_A287 Crystal Structure Of Aurora2 Kinase In Complex With 1e-12
3e5a_A268 Crystal Structure Of Aurora A In Complex With Vx-68 1e-12
1mq4_A272 Crystal Structure Of Aurora-A Protein Kinase Length 1e-12
2acx_A576 Crystal Structure Of G Protein Coupled Receptor Kin 1e-12
3a60_A327 Crystal Structure Of Unphosphorylated P70s6k1 (Form 1e-12
3qbn_A281 Structure Of Human Aurora A In Complex With A Diami 1e-12
2wtv_A285 Aurora-A Inhibitor Structure Length = 285 1e-12
2xs0_A386 Linear Binding Motifs For Jnk And For Calcineurin A 1e-12
1ung_A292 Structural Mechanism For The Inhibition Of Cdk5-P25 1e-12
3i7c_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 1e-12
2a19_B284 Pkr Kinase Domain- Eif2alpha- Amp-Pnp Complex. Leng 1e-12
3o50_A267 Crystal Structure Of Benzamide 9 Bound To Auroraa L 2e-12
2r0u_A323 Crystal Structure Of Chek1 In Complex With Inhibito 2e-12
3qup_A323 Inhibitor Bound Structure Of The Kinase Domain Of T 2e-12
2hog_A322 Crystal Structure Of Chek1 In Complex With Inhibito 2e-12
3gp0_A348 Crystal Structure Of Human Mitogen Activated Protei 2e-12
2c30_A321 Crystal Structure Of The Human P21-Activated Kinase 2e-12
2ydj_A276 Discovery Of Checkpoint Kinase Inhibitor Azd7762 By 2e-12
4fsy_A279 Crystal Structure Of The Chk1 Length = 279 2e-12
3srv_A277 Crystal Structure Of Spleen Tyrosine Kinase (Syk) I 2e-12
3e7o_A360 Crystal Structure Of Jnk2 Length = 360 2e-12
4fsz_A279 Crystal Structure Of The Chk1 Length = 279 2e-12
2w1d_A275 Structure Determination Of Aurora Kinase In Complex 2e-12
1ol5_A282 Structure Of Aurora-A 122-403, Phosphorylated On Th 2e-12
4b99_A398 Crystal Structure Of Mapk7 (Erk5) With Inhibitor Le 2e-12
2br1_A297 Structure-Based Design Of Novel Chk1 Inhibitors: In 3e-12
1ia8_A289 The 1.7 A Crystal Structure Of Human Cell Cycle Che 3e-12
3tub_A293 Crystal Structure Of Syk Kinase Domain With 1-(5-(6 3e-12
3vf8_A299 Crystal Structure Of Spleen Tyrosine Kinase Syk Cat 3e-12
1zlt_A295 Crystal Structure Of Chk1 Complexed With A Hymenald 3e-12
1xba_A291 Crystal Structure Of Apo Syk Tyrosine Kinase Domain 3e-12
4f4p_A273 Syk In Complex With Ligand Lasw836 Length = 273 3e-12
3emg_A291 Discovery And Sar Of Novel 4-Thiazolyl-2- Phenylami 3e-12
3srv_B277 Crystal Structure Of Spleen Tyrosine Kinase (Syk) I 3e-12
4dfl_A274 Crystal Structure Of Spleen Tyrosine Kinase Complex 3e-12
3elj_A369 Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine 3e-12
3nrm_A283 Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito 3e-12
1ol6_A282 Structure Of Unphosphorylated D274n Mutant Of Auror 3e-12
3gc8_A370 The Structure Of P38beta C162s In Complex With A Di 3e-12
3pze_A358 Jnk1 In Complex With Inhibitor Length = 358 3e-12
2zoq_A382 Structural Dissection Of Human Mitogen-Activated Ki 3e-12
2x8e_A276 Discovery Of A Novel Class Of Triazolones As Checkp 3e-12
4fsn_A278 Crystal Structure Of The Chk1 Length = 278 3e-12
3uiu_A306 Crystal Structure Of Apo-Pkr Kinase Domain Length = 3e-12
2v5q_A315 Crystal Structure Of Wild-type Plk-1 Kinase Domain 3e-12
1zys_A273 Co-Crystal Structure Of Checkpoint Kinase Chk1 With 3e-12
3r21_A271 Design, Synthesis, And Biological Evaluation Of Pyr 4e-12
4fsm_A279 Crystal Structure Of The Chk1 Length = 279 4e-12
2wqe_A262 Structure Of S155r Aurora-A Somatic Mutant Length = 4e-12
4fsw_A279 Crystal Structure Of The Chk1 Length = 279 4e-12
3unz_A279 Aurora A In Complex With Rpm1679 Length = 279 4e-12
2y94_A476 Structure Of An Active Form Of Mammalian Ampk Lengt 4e-12
4ft3_A279 Crystal Structure Of The Chk1 Length = 279 4e-12
3q4z_A306 Structure Of Unphosphorylated Pak1 Kinase Domain Le 4e-12
2e9v_A268 Structure Of H-Chk1 Complexed With A859017 Length = 4e-12
4fv6_A360 Crystal Structure Of The Erk2 Complexed With E57 Le 4e-12
2y9q_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 4e-12
4fux_A360 Crystal Structure Of The Erk2 Complexed With E75 Le 4e-12
3ha6_A268 Crystal Structure Of Aurora A In Complex With Tpx2 4e-12
3ot3_A273 X-Ray Crystal Structure Of Compound 22k Bound To Hu 4e-12
2ayp_A269 Crystal Structure Of Chk1 With An Indol Inhibitor L 4e-12
3kb7_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 4e-12
2ghg_A269 H-Chk1 Complexed With A431994 Length = 269 4e-12
2yac_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 5e-12
4fv7_A360 Crystal Structure Of The Erk2 Complexed With E94 Le 5e-12
1gol_A364 Coordinates Of Rat Map Kinase Erk2 With An Arginine 5e-12
2gph_A364 Docking Motif Interactions In The Map Kinase Erk2 L 5e-12
3jvr_A271 Characterization Of The Chk1 Allosteric Inhibitor B 5e-12
4gsb_A364 Monoclinic Crystal Form Of The Apo-Erk2 Length = 36 5e-12
3h0y_A268 Aurora A In Complex With A Bisanilinopyrimidine Len 5e-12
2ojg_A380 Crystal Structure Of Erk2 In Complex With N,n-dimet 5e-12
4fst_A269 Crystal Structure Of The Chk1 Length = 269 5e-12
3zu7_A365 Crystal Structure Of A Designed Selected Ankyrin Re 5e-12
2z7l_A366 Unphosphorylated Mitogen Activated Protein Kinase E 5e-12
3c9w_A357 Crystal Structure Of Erk-2 With Hypothemycin Covale 5e-12
2fys_B364 Crystal Structure Of Erk2 Complex With Kim Peptide 5e-12
3qyw_A364 Crystal Structure Of Erk2 In Complex With An Inhibi 5e-12
3o71_A358 Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length 5e-12
2w1c_A275 Structure Determination Of Aurora Kinase In Complex 5e-12
2xne_A272 Structure Of Aurora-A Bound To An Imidazopyrazine I 6e-12
3aln_A327 Crystal Structure Of Human Non-Phosphorylated Mkk4 6e-12
3sa0_A360 Complex Of Erk2 With Norathyriol Length = 360 6e-12
1wzy_A368 Crystal Structure Of Human Erk2 Complexed With A Py 6e-12
1tvo_A368 The Structure Of Erk2 In Complex With A Small Molec 6e-12
3r63_A358 Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 6e-12
3d14_A272 Crystal Structure Of Mouse Aurora A (Asn186->gly, L 6e-12
2ou7_A335 Structure Of The Catalytic Domain Of Human Polo-Lik 6e-12
2hw6_A307 Crystal Structure Of Mnk1 Catalytic Domain Length = 6e-12
3thb_A333 Structure Of Plk1 Kinase Domain In Complex With A B 7e-12
3coh_A268 Crystal Structure Of Aurora-A In Complex With A Pen 8e-12
1zy4_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 1e-11
3dxn_A287 Crystal Structure Of The Calcium-dependent Kinase F 1e-11
2rku_A294 Structure Of Plk1 In Complex With Bi2536 Length = 2 1e-11
3o17_A370 Crystal Structure Of Jnk1-Alpha1 Isoform Length = 3 1e-11
2bdw_A362 Crystal Structure Of The Auto-Inhibited Kinase Doma 1e-11
4fsu_A279 Crystal Structure Of The Chk1 Length = 279 2e-11
3txo_A353 Pkc Eta Kinase In Complex With A Naphthyridine Leng 2e-11
2x4f_A373 The Crystal Structure Of The Human Myosin Light Cha 2e-11
3lij_A494 Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) 2e-11
3daj_A272 Crystal Structure Of Aurora A Complexed With An Inh 2e-11
3oz6_A388 Crystal Structure Of Mapk From Cryptosporidium Parv 2e-11
2g01_A370 Pyrazoloquinolones As Novel, Selective Jnk1 Inhibit 2e-11
3zuv_A364 Crystal Structure Of A Designed Selected Ankyrin Re 2e-11
2erk_A365 Phosphorylated Map Kinase Erk2 Length = 365 2e-11
2w96_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 3e-11
2bfx_B284 Mechanism Of Aurora-B Activation By Incenp And Inhi 3e-11
3tei_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 3e-11
2w99_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 3e-11
2vrx_A285 Structure Of Aurora B Kinase In Complex With Zm4474 3e-11
4fr4_A384 Crystal Structure Of Human SerineTHREONINE-Protein 4e-11
3g33_A308 Crystal Structure Of Cdk4CYCLIN D3 Length = 308 4e-11
3cik_A 689 Human Grk2 In Complex With Gbetagamma Subunits Leng 4e-11
3krw_A 688 Human Grk2 In Complex With Gbetgamma Subunits And B 4e-11
2bfy_A284 Complex Of Aurora-B With Incenp And Hesperidin. Len 4e-11
2ac5_A316 Structure Of Human Mnk2 Kinase Domain Mutant D228g 4e-11
3q5i_A504 Crystal Structure Of Pbanka_031420 Length = 504 4e-11
1omw_A 689 Crystal Structure Of The Complex Between G Protein- 4e-11
4ejn_A446 Crystal Structure Of Autoinhibited Form Of Akt1 In 4e-11
3psc_A 695 Bovine Grk2 In Complex With Gbetagamma Subunits Len 4e-11
4h3q_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 4e-11
3zgw_A347 Crystal Structure Of Maternal Embryonic Leucine Zip 5e-11
4fvp_A289 Crystal Structure Of The Jak2 Pseudokinase Domain ( 5e-11
3o96_A446 Crystal Structure Of Human Akt1 With An Allosteric 5e-11
2w9f_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 5e-11
3hzt_A467 Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 5e-11
2f9g_A353 Crystal Structure Of Fus3 Phosphorylated On Tyr182 6e-11
2b9f_A353 Crystal Structure Of Non-Phosphorylated Fus3 Length 6e-11
3cqu_A342 Crystal Structure Of Akt-1 Complexed With Substrate 7e-11
1zyc_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 7e-11
3my0_A305 Crystal Structure Of The Acvrl1 (Alk1) Kinase Domai 7e-11
4gv1_A340 Pkb Alpha In Complex With Azd5363 Length = 340 8e-11
3ocb_A341 Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor 8e-11
4fvr_A289 Crystal Structure Of The Jak2 Pseudokinase Domain M 1e-10
1pyx_A422 Gsk-3 Beta Complexed With Amp-Pnp Length = 422 1e-10
1yrp_A278 Catalytic Domain Of Human Zip Kinase Phosphorylated 1e-10
3mn3_A271 An Inhibited Conformation For The Protein Kinase Do 2e-10
1q3d_A424 Gsk-3 Beta Complexed With Staurosporine Length = 42 2e-10
1i09_A420 Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Len 2e-10
1q5k_A414 Crystal Structure Of Glycogen Synthase Kinase 3 In 2e-10
3vid_A356 Crystal Structure Of Human Vegfr2 Kinase Domain Wit 2e-10
3vhe_A359 Crystal Structure Of Human Vegfr2 Kinase Domain Wit 2e-10
2b9h_A353 Crystal Structure Of Fus3 With A Docking Motif From 2e-10
2jed_A352 The Crystal Structure Of The Kinase Domain Of The P 2e-10
3say_A430 Crystal Structure Of Human Glycogen Synthase Kinase 2e-10
3iw4_A360 Crystal Structure Of Pkc Alpha In Complex With Nvp- 2e-10
3vn9_A340 Rifined Crystal Structure Of Non-Phosphorylated Map 2e-10
3dae_A283 Crystal Structure Of Phosphorylated Snf1 Kinase Dom 2e-10
2fh9_A274 Structure And Dimerization Of The Kinase Domain Fro 2e-10
4acc_A465 Gsk3b In Complex With Inhibitor Length = 465 2e-10
3hyh_A275 Crystal Structure Of The Protein Kinase Domain Of Y 2e-10
1cm8_A367 Phosphorylated Map Kinase P38-Gamma Length = 367 2e-10
2ac3_A316 Structure Of Human Mnk2 Kinase Domain Length = 316 2e-10
2i6l_A320 Crystal Structure Of Human Mitogen Activated Protei 2e-10
1r0e_A391 Glycogen Synthase Kinase-3 Beta In Complex With 3-I 2e-10
3fme_A290 Crystal Structure Of Human Mitogen-Activated Protei 3e-10
3mdy_A337 Crystal Structure Of The Cytoplasmic Domain Of The 3e-10
3ll6_A337 Crystal Structure Of The Human Cyclin G Associated 3e-10
3f88_A349 Glycogen Synthase Kinase 3beta Inhibitor Complex Le 3e-10
2buj_A317 Crystal Structure Of The Human Serine-Threonine Kin 3e-10
2gnj_A350 Pka Three Fold Mutant Model Of Rho-Kinase With Y-27 3e-10
4exu_A371 Mapk13, Inactive Form Length = 371 3e-10
1y6a_A366 Crystal Structure Of Vegfr2 In Complex With A 2-Ani 3e-10
1gng_A378 Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With 3e-10
4dit_A382 Crystal Structure Of Gsk3beta In Complex With A Imi 3e-10
3vhk_A368 Crystal Structure Of The Vegfr2 Kinase Domain In Co 4e-10
3uto_A573 Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin- 4e-10
3zrk_A371 Identification Of 2-(4-Pyridyl)thienopyridinones As 4e-10
2o5k_A372 Crystal Structure Of Gsk3beta In Complex With A Ben 4e-10
2ow3_A352 Glycogen Synthase Kinase-3 Beta In Complex With Bis 4e-10
3sd0_A350 Identification Of A Glycogen Synthase Kinase-3b Inh 4e-10
3zdi_A350 Glycogen Synthase Kinase 3 Beta Complexed With Axin 4e-10
4afj_A367 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selec 4e-10
3coi_A353 Crystal Structure Of P38delta Kinase Length = 353 4e-10
3kl8_A269 Camkiintide Inhibitor Complex Length = 269 4e-10
2w4o_A349 Crystal Structure Of Human Camk4 In Complex With 4- 4e-10
1xjd_A345 Crystal Structure Of Pkc-Theta Complexed With Staur 4e-10
1h8f_A352 Glycogen Synthase Kinase 3 Beta. Length = 352 4e-10
1uv5_A350 Glycogen Synthase Kinase 3 Beta Complexed With 6-Br 4e-10
3gb2_A353 Gsk3beta Inhibitor Complex Length = 353 4e-10
3f7z_A350 X-ray Co-crystal Structure Of Glycogen Synthase Kin 4e-10
1zxe_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 5e-10
3kk9_A282 Camkii Substrate Complex B Length = 282 5e-10
3kk8_A284 Camkii Substrate Complex A Length = 284 5e-10
2gng_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 5e-10
1koa_A491 Twitchin Kinase Fragment (C.Elegans), Autoregulated 5e-10
2gnf_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 5e-10
1xh9_A350 Crystal Structures Of Protein Kinase B Selective In 6e-10
3n9x_A432 Crystal Structure Of Map Kinase From Plasmodium Ber 6e-10
2xuu_A334 Crystal Structure Of A Dap-Kinase 1 Mutant Length = 6e-10
4af3_A292 Human Aurora B Kinase In Complex With Incenp And Vx 6e-10
1o9u_A350 Glycogen Synthase Kinase 3 Beta Complexed With Axin 6e-10
1mrv_A339 Crystal Structure Of An Inactive Akt2 Kinase Domain 6e-10
1gzn_A335 Structure Of Pkb Kinase Domain Length = 335 7e-10
3bhy_A283 Crystal Structure Of Human Death Associated Protein 7e-10
1gzk_A315 Molecular Mechanism For The Regulation Of Protein K 7e-10
3dfc_B295 Crystal Structure Of A Glycine-Rich Loop Mutant Of 7e-10
4a4x_A279 Nek2-Ede Bound To Cct248662 Length = 279 7e-10
3f5u_A295 Crystal Structure Of The Death Associated Protein K 7e-10
1ig1_A294 1.8a X-Ray Structure Of Ternary Complex Of A Cataly 8e-10
1p4f_A293 Death Associated Protein Kinase Catalytic Domain Wi 8e-10
1o6k_A336 Structure Of Activated Form Of Pkb Kinase Domain S4 8e-10
3e87_A335 Crystal Structures Of The Kinase Domain Of Akt2 In 9e-10
2j90_A304 Crystal Structure Of Human Zip Kinase In Complex Wi 9e-10
2w5a_A279 Human Nek2 Kinase Adp-Bound Length = 279 9e-10
2jdo_A342 Structure Of Pkb-Beta (Akt2) Complexed With Isoquin 1e-09
2x0g_A334 X-ray Structure Of A Dap-kinase Calmodulin Complex 1e-09
3bhh_A295 Crystal Structure Of Human Calcium/calmodulin-depen 1e-09
1o6l_A337 Crystal Structure Of An Activated Akt/protein Kinas 1e-09
2xzs_A312 Death Associated Protein Kinase 1 Residues 1-312 Le 1e-09
3gu4_A295 Crystal Structure Of Dapkq23v-Amppnp Length = 295 1e-09
3h4j_B336 Crystal Structure Of Pombe Ampk Kdaid Fragment Leng 1e-09
2yak_A285 Structure Of Death-Associated Protein Kinase 1 (Dap 1e-09
1wvw_A278 Crystal Structures Of Kinase Domain Of Dap Kinase I 1e-09
2w4k_A302 X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 1e-09
1ydt_E350 Structure Of Camp-Dependent Protein Kinase, Alpha-C 1e-09
2w4j_A277 X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 1e-09
1ql6_A298 The Catalytic Mechanism Of Phosphorylase Kinase Pro 1e-09
1smh_A350 Protein Kinase A Variant Complex With Completely Or 1e-09
1stc_E350 Camp-Dependent Protein Kinase, Alpha-Catalytic Subu 2e-09
3gu8_A295 Crystal Structure Of Dapkl93g With N6-Cyclopentylad 2e-09
3h9r_A330 Crystal Structure Of The Kinase Domain Of Type I Ac 2e-09
2c1a_A351 Structure Of Camp-Dependent Protein Kinase Complexe 2e-09
2h6d_A276 Protein Kinase Domain Of The Human 5'-Amp-Activated 2e-09
1svh_A350 Crystal Structure Of Protein Kinase A In Complex Wi 2e-09
3dnd_A350 Camp-Dependent Protein Kinase Pka Catalytic Subunit 2e-09
2y0a_A326 Structure Of Dapk1 Construct Residues 1-304 Length 2e-09
4dym_A301 Crystal Structure Of The Acvr1 Kinase Domain In Com 2e-09
3mtf_A301 Crystal Structure Of The Acvr1 Kinase In Complex Wi 2e-09
3mtl_A324 Crystal Structure Of The Pctaire1 Kinase In Complex 2e-09
2f7e_E351 Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoqu 2e-09
2uzt_A336 Pka Structures Of Akt, Indazole-Pyridine Inhibitors 2e-09
2jav_A279 Human Kinase With Pyrrole-Indolinone Ligand Length 2e-09
1q8w_A350 The Catalytic Subunit Of Camp-Dependent Protein Kin 2e-09
2jds_A351 Structure Of Camp-Dependent Protein Kinase Complexe 2e-09
1phk_A298 Two Structures Of The Catalytic Domain Of Phosphory 2e-09
1xh7_A350 Crystal Structures Of Protein Kinase B Selective In 3e-09
2qur_A350 Crystal Structure Of F327aK285P MUTANT OF CAMP-Depe 3e-09
1q61_A350 Pka Triple Mutant Model Of Pkb Length = 350 3e-09
2jam_A304 Crystal Structure Of Human Calmodulin-Dependent Pro 3e-09
4dfy_A371 Crystal Structure Of R194a Mutant Of Camp-Dependent 3e-09
3hng_A360 Crystal Structure Of Vegfr1 In Complex With N-(4-ch 3e-09
2yza_A276 Crystal Structure Of Kinase Domain Of Human 5'-Amp- 3e-09
1fmo_E350 Crystal Structure Of A Polyhistidine-Tagged Recombi 4e-09
1j3h_A350 Crystal Structure Of Apoenzyme Camp-Dependent Prote 4e-09
3qal_E350 Crystal Structure Of Arg280ala Mutant Of Catalytic 4e-09
2erz_E351 Crystal Structure Of C-amp Dependent Kinase (pka) B 4e-09
4ec8_A373 Structure Of Full Length Cdk9 In Complex With Cycli 4e-09
1bkx_A350 A Binary Complex Of The Catalytic Subunit Of Camp-D 4e-09
2r5t_A373 Crystal Structure Of Inactive Serum And Glucocortic 4e-09
3fhi_A350 Crystal Structure Of A Complex Between The Catalyti 4e-09
1ctp_E350 Structure Of The Mammalian Catalytic Subunit Of Cam 5e-09
1szm_A350 Dual Binding Mode Of Bisindolylmaleimide 2 To Prote 5e-09
2ycf_A322 Crystal Structure Of Checkpoint Kinase 2 In Complex 5e-09
3enm_A316 The Structure Of The Map2k Mek6 Reveals An Autoinhi 5e-09
1cdk_A350 Camp-Dependent Protein Kinase Catalytic Subunit (E. 5e-09
4dfx_E350 Crystal Structure Of Myristoylated K7c Catalytic Su 5e-09
1cmk_E350 Crystal Structures Of The Myristylated Catalytic Su 5e-09
4ae6_A343 Structure And Function Of The Human Sperm-specific 5e-09
3a8w_A345 Crystal Structure Of Pkciota Kinase Domain Length = 5e-09
2w0j_A323 Crystal Structure Of Chk2 In Complex With Nsc 10955 5e-09
3mvj_A371 Human Cyclic Amp-Dependent Protein Kinase Pka Inhib 5e-09
1zrz_A364 Crystal Structure Of The Catalytic Domain Of Atypic 5e-09
4aw2_A437 Crystal Structure Of Cdc42 Binding Protein Kinase A 5e-09
3zh8_A349 A Novel Small Molecule Apkc Inhibitor Length = 349 5e-09
2ycr_A323 Crystal Structure Of Checkpoint Kinase 2 In Complex 5e-09
3nx8_A351 Human Camp Dependent Protein Kinase In Complex With 5e-09
2gu8_A337 Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel 5e-09
3agl_A351 Complex Of Pka With The Bisubstrate Protein Kinase 6e-09
3agm_A351 Complex Of Pka With The Bisubstrate Protein Kinase 6e-09
2cn5_A329 Crystal Structure Of Human Chk2 In Complex With Adp 6e-09
4dg3_E371 Crystal Structure Of R336a Mutant Of Camp-dependent 6e-09
2qcs_A350 A Complex Structure Between The Catalytic And Regul 6e-09
2zv2_A298 Crystal Structure Of Human CalciumCALMODULIN-Depend 6e-09
2xk9_A322 Structural Analysis Of Checkpoint Kinase 2 (Chk2) I 6e-09
3pvb_A345 Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca 6e-09
1l3r_E350 Crystal Structure Of A Transition State Mimic Of Th 6e-09
3mi9_A351 Crystal Structure Of Hiv-1 Tat Complexed With Human 7e-09
2phk_A277 The Crystal Structure Of A Phosphorylase Kinase Pep 7e-09
4ae9_A343 Structure And Function Of The Human Sperm-specific 7e-09
1apm_E350 2.0 Angstrom Refined Crystal Structure Of The Catal 7e-09
1q24_A350 Pka Double Mutant Model Of Pkb In Complex With Mgat 8e-09
4dc2_A396 Structure Of Pkc In Complex With A Substrate Peptid 8e-09
4bcf_A331 Structure Of Cdk9 In Complex With Cyclin T And A 2- 8e-09
3o7l_B350 Crystal Structure Of Phospholamban (1-19):pka C-Sub 8e-09
1syk_A350 Crystal Structure Of E230q Mutant Of Camp-Dependent 9e-09
2vz6_A313 Structure Of Human Calcium Calmodulin Dependent Pro 9e-09
3blh_A331 Crystal Structure Of Human Cdk9CYCLINT1 Length = 33 9e-09
3gbz_A329 Structure Of The Cmgc Cdk Kinase From Giardia Lambl 9e-09
2vo0_A351 Structure Of Pka-Pkb Chimera Complexed With C-(4-(4 1e-08
3dls_A335 Crystal Structure Of Human Pas Kinase Bound To Adp 1e-08
2jdt_A351 Structure Of Pka-Pkb Chimera Complexed With Isoquin 1e-08
3l9m_A351 Crystal Structure Of Pkab3 (Pka Triple Mutant V123a 1e-08
1jbp_E350 Crystal Structure Of The Catalytic Subunit Of Camp- 1e-08
2y7j_A365 Structure Of Human Phosphorylase Kinase, Gamma 2 Le 1e-08
4g3d_A371 Crystal Structure Of Human Nf-kappab Inducing Kinas 1e-08
2uvy_A351 Structure Of Pka-pkb Chimera Complexed With Methyl- 1e-08
2wel_A327 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 1e-08
4dn5_A356 Crystal Structure Of Nf-kb-inducing Kinase (nik) Le 1e-08
3nie_A429 Crystal Structure Of Pf11_0147 Length = 429 1e-08
1zws_A288 Crystal Structure Of The Catalytic Domain Of Human 2e-08
3fpq_A290 Crystal Structure Of The Kinase Domain Of Wnk1 Leng 2e-08
3ama_A351 Protein Kinase A Sixfold Mutant Model Of Aurora B W 2e-08
2a27_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 2e-08
2vn9_A301 Crystal Structure Of Human Calcium Calmodulin Depen 2e-08
2ya9_A361 Crystal Structure Of The Autoinhibited Form Of Mous 2e-08
1wmk_A321 Human Death-Associated Kinase Drp-1, Mutant S308d D 2e-08
2a2a_A321 High-resolution Crystallographic Analysis Of The Au 2e-08
1z9x_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 2e-08
4agu_A311 Crystal Structure Of The Human Cdkl1 Kinase Domain 2e-08
2y4i_B319 Ksr2-Mek1 Heterodimer Length = 319 2e-08
3qam_E350 Crystal Structure Of Glu208ala Mutant Of Catalytic 2e-08
3i6u_A419 Structure And Activation Mechanism Of The Chk2 Dna- 2e-08
3i6w_A443 Structure And Activation Mechanism Of The Chk2 Dna- 2e-08
3uib_A362 Map Kinase Lmampk10 From Leishmania Major In Comple 3e-08
3pg1_A362 Map Kinase Lmampk10 From Leishmania Major (1.95 Ang 3e-08
2qr8_A342 2.0a X-ray Structure Of C-terminal Kinase Domain Of 3e-08
3kmw_A271 Crystal Structure Of The IlkALPHA-Parvin Core Compl 3e-08
3pfq_A674 Crystal Structure And Allosteric Activation Of Prot 4e-08
2v7o_A336 Crystal Structure Of Human Calcium-Calmodulin-Depen 4e-08
1rdq_E350 Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of 5e-08
1kob_A387 Twitchin Kinase Fragment (Aplysia), Autoregulated P 6e-08
2i0e_A353 Structure Of Catalytic Domain Of Human Protein Kina 6e-08
2h34_A309 Apoenzyme Crystal Structure Of The Tuberculosis Ser 6e-08
4g3f_A336 Crystal Structure Of Murine Nf-kappab Inducing Kina 7e-08
4e7w_A394 Structure Of Gsk3 From Ustilago Maydis Length = 394 7e-08
3v8s_A410 Human Rho-Associated Protein Kinase 1 (Rock 1) In C 8e-08
2jc6_A334 Crystal Structure Of Human Calmodulin-Dependent Pro 8e-08
4g3c_A352 Crystal Structure Of Apo Murine Nf-kappab Inducing 8e-08
2esm_A415 Crystal Structure Of Rock 1 Bound To Fasudil Length 9e-08
3soa_A444 Full-Length Human Camkii Length = 444 9e-08
2v55_A406 Mechanism Of Multi-site Phosphorylation From A Rock 9e-08
3f3z_A277 Crystal Structure Of Cryptosporidium Parvum Calcium 1e-07
2qr7_A342 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of 1e-07
4g3g_A350 Crystal Structure Of Murine Nf-kappab Inducing Kina 1e-07
2qg5_A294 Cryptosporidium Parvum Calcium Dependent Protein Ki 1e-07
3lm0_A327 Crystal Structure Of Human SerineTHREONINE KINASE 1 1e-07
1vzo_A355 The Structure Of The N-Terminal Kinase Domain Of Ms 1e-07
2f2u_A402 Crystal Structure Of The Rho-Kinase Kinase Domain L 3e-07
3kmu_A271 Crystal Structure Of The IlkALPHA-Parvin Core Compl 3e-07
3uc3_A361 The Crystal Structure Of Snf1-Related Kinase 2.3 Le 3e-07
3qd2_B332 Crsytal Structure Of Mouse Perk Kinase Domain Lengt 3e-07
3ujg_A361 Crystal Structure Of Snrk2.6 In Complex With Hab1 L 6e-07
3uc4_A362 The Crystal Structure Of Snf1-Related Kinase 2.6 Le 7e-07
3udb_A317 Crystal Structure Of Snrk2.6 Length = 317 8e-07
4eut_A396 Structure Of Bx-795 Complexed With Unphosphorylated 1e-06
3kvw_A429 Crystal Structure Of Dual-Specificity Tyrosine Phos 2e-06
3rp9_A458 Crystal Structure Of The Apo Mapk From Toxoplasma G 2e-06
1a06_A332 Calmodulin-Dependent Protein Kinase From Rat Length 2e-06
3kn5_A325 Crystal Structure Of The C-Terminal Kinase Domain O 2e-06
3rny_A346 Crystal Structure Of Human Rsk1 C-Terminal Kinase D 2e-06
4azf_A417 Human Dyrk2 In Complex With Leucettine L41 Length = 2e-06
2wnt_A330 Crystal Structure Of The Human Ribosomal Protein S6 2e-06
4fg7_A293 Crystal Structure Of Human Calcium/calmodulin-depen 3e-06
4fg8_A315 Crystal Structure Of Human Calcium/calmodulin-depen 3e-06
4fg9_A320 Crystal Structure Of Human Calcium/calmodulin-depen 3e-06
3qfv_A415 Mrck Beta In Complex With Tpca-1 Length = 415 4e-06
3tku_A433 Mrck Beta In Complex With Fasudil Length = 433 4e-06
3zut_A362 The Structure Of Ost1 (D160a) Kinase Length = 362 5e-06
3mfr_A351 Cask-4m Cam Kinase Domain, Native Length = 351 5e-06
4euu_A319 Structure Of Bx-795 Complexed With Human Tbk1 Kinas 5e-06
3zuu_A362 The Structure Of Ost1 (D160a, S175d) Kinase In Comp 5e-06
1z57_A339 Crystal Structure Of Human Clk1 In Complex With 10z 9e-06
3k2l_A429 Crystal Structure Of Dual-Specificity Tyrosine Phos 9e-06
3e3p_A360 Glycogen Synthase Kinase From Leishmania Major Leng 1e-05
2rio_A434 Structure Of The Dual Enzyme Ire1 Reveals The Basis 2e-05
3p23_A432 Crystal Structure Of The Human Kinase And Rnase Dom 4e-05
3sdj_A448 Structure Of Rnase-Inactive Point Mutant Of Oligome 5e-05
2in6_A287 Wee1 Kinase Complex With Inhibitor Pd311839 Length 5e-05
2vag_A339 Crystal Structure Of Di-Phosphorylated Human Clk1 I 5e-05
1x8b_A289 Structure Of Human Wee1a Kinase: Kinase Domain Comp 5e-05
3bi6_A287 Wee1 Kinase Complex With Inhibitor Pd352396 Length 6e-05
2z2w_A285 Humand Wee1 Kinase Complexed With Inhibitor Pf03357 6e-05
3fbv_A448 Crystal Structure Of The Oligomer Formed By The Kin 6e-05
2pml_X348 Crystal Structure Of Pfpk7 In Complex With An Atp A 1e-04
2wtk_C305 Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo2 1e-04
3lj0_A434 Ire1 Complexed With Adp And Quercetin Length = 434 1e-04
3llt_A360 Crystal Structure Of Pf14_0431, Kinase Domain Lengt 2e-04
3hmn_A342 Crystal Structure Of Human Mps1 Catalytic Domain In 4e-04
2x9e_A317 Human Mps1 In Complex With Nms-P715 Length = 317 4e-04
2iwi_A312 Crystal Structure Of The Human Pim2 In Complex With 4e-04
3vqu_A320 Crystal Structure Of Human Mps1 Catalytic Domain In 5e-04
3dbq_A343 Crystal Structure Of Ttk Kinase Domain Length = 343 5e-04
3cek_A313 Crystal Structure Of Human Dual Specificity Protein 5e-04
2zmc_A390 Crystal Structure Of Human Mitotic Checkpoint Kinas 6e-04
3tac_A361 Crystal Structure Of The Liprin-AlphaCASK COMPLEX L 6e-04
3sv0_A483 Crystal Structure Of Casein Kinase-1 Like Protein I 8e-04
3h9f_A313 Crystal Structure Of Human Dual Specificity Protein 8e-04
3c0g_A351 Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Len 9e-04
>pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 Back     alignment and structure

Iteration: 1

Score = 234 bits (598), Expect = 1e-61, Method: Compositional matrix adjust. Identities = 125/298 (41%), Positives = 184/298 (61%), Gaps = 5/298 (1%) Query: 482 TYTGTAKTFTLNDIEKATNGFHTSRIIGEGGFGVVYRGILDDGREVAVKVLKRANQHGGR 541 + G K F+L +++ A++ F I+G GGFG VY+G L DG VAVK LK GG Sbjct: 20 VHLGQLKRFSLRELQVASDNFSNKNILGRGGFGKVYKGRLADGTLVAVKRLKEERXQGGE 79 Query: 542 -EFLAELEMLSRLHHRNLVKLFGVCIEDNNRCLVYELIHNGSLESHLHGDDKVNGPLDWD 600 +F E+EM+S HRNL++L G C+ R LVY + NGS+ S L + PLDW Sbjct: 80 LQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERPESQPPLDWP 139 Query: 601 ARMKIALGAARGLAYLHEDSSPRVIHRDFKSSNILLEHDFTPKVSDFGLARTALDEGNKH 660 R +IALG+ARGLAYLH+ P++IHRD K++NILL+ +F V DFGLA+ +D + H Sbjct: 140 KRQRIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKL-MDYKDXH 198 Query: 661 ISTHVMGTFGYLAPEYAMTGHLLVKSDVYSYGVVLLELLTGRKPVDLSQPPGQEN--LVA 718 + V GT G++APEY TG K+DV+ YGV+LLEL+TG++ DL++ ++ L+ Sbjct: 199 VXXAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLD 258 Query: 719 WARPLLTTKEGLKTIIDPVIESNISYDTLVKVAAIASMCVQPEVSHRPFMGEVVQALK 776 W + LL K+ L+ ++D ++ N + + ++ +A +C Q RP M EVV+ L+ Sbjct: 259 WVKGLLKEKK-LEALVDVDLQGNYKDEEVEQLIQVALLCTQSSPMERPKMSEVVRMLE 315
>pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 Back     alignment and structure
>pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 Back     alignment and structure
>pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 Back     alignment and structure
>pdb|2NRY|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2NRU|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2OIB|A Chain A, Crystal Structure Of Irak4 Kinase Domain Apo Form Length = 301 Back     alignment and structure
>pdb|2O8Y|A Chain A, Apo Irak4 Kinase Domain Length = 298 Back     alignment and structure
>pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|3P86|A Chain A, Crystal Structure Of Ctr1 Kinase Domain Mutant D676n In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|4GS6|A Chain A, Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxozeaenol Length = 315 Back     alignment and structure
>pdb|2EVA|A Chain A, Structural Basis For The Interaction Of Tak1 Kinase With Its Activating Protein Tab1 Length = 307 Back     alignment and structure
>pdb|3DTC|A Chain A, Crystal Structure Of Mixed-Lineage Kinase Mlk1 Complexed With Compound 16 Length = 271 Back     alignment and structure
>pdb|4ASZ|A Chain A, Crystal Structure Of Apo Trkb Kinase Domain Length = 299 Back     alignment and structure
>pdb|3MIY|A Chain A, X-Ray Crystal Structure Of Itk Complexed With Sunitinib Length = 266 Back     alignment and structure
>pdb|4F0F|A Chain A, Crystal Structure Of The Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|4AOJ|A Chain A, Human Trka In Complex With The Inhibitor Az-23 Length = 329 Back     alignment and structure
>pdb|4GT5|A Chain A, Crystal Structure Of The Inactive Trka Kinase Domain Length = 306 Back     alignment and structure
>pdb|3QGW|A Chain A, Crystal Structure Of Itk Kinase Bound To An Inhibitor Length = 286 Back     alignment and structure
>pdb|4HCT|A Chain A, Crystal Structure Of Itk In Complex With Compound 52 Length = 269 Back     alignment and structure
>pdb|1SM2|A Chain A, Crystal Structure Of The Phosphorylated Interleukin-2 Tyrosine Kinase Catalytic Domain Length = 264 Back     alignment and structure
>pdb|3V5J|A Chain A, Crystal Structure Of Interleukin-2 Inducible T-Cell Kinase Itk Catalytic Domain With Thienopyrazolylindole Inhibitor 090 Length = 266 Back     alignment and structure
>pdb|4F0I|A Chain A, Crystal Structure Of Apo Trka Length = 300 Back     alignment and structure
>pdb|4F1M|A Chain A, Crystal Structure Of The G1179s Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|4F1O|A Chain A, Crystal Structure Of The L1180t Mutant Roco4 Kinase Domain From D. Discoideum Bound To Appcp Length = 287 Back     alignment and structure
>pdb|3T9T|A Chain A, Crystal Structure Of Btk Mutant (F435t,K596r) Complexed With Imidazo[1,5-A]quinoxaline Length = 267 Back     alignment and structure
>pdb|3V5Q|A Chain A, Discovery Of A Selective Trk Inhibitor With Efficacy In Rodent Cancer Tumor Models Length = 297 Back     alignment and structure
>pdb|3DKG|A Chain A, Sgx Clone 5698a109kfg1h1 Length = 317 Back     alignment and structure
>pdb|3Q6W|A Chain A, Structure Of Dually-phosphorylated Met Receptor Kinase In Complex With An Mk-2461 Analog With Specificity For The Activated Receptor Length = 307 Back     alignment and structure
>pdb|2WD1|A Chain A, Human C-Met Kinase In Complex With Azaindole Inhibitor Length = 292 Back     alignment and structure
>pdb|2G15|A Chain A, Structural Characterization Of Autoinhibited C-Met Kinase Length = 318 Back     alignment and structure
>pdb|4GG5|A Chain A, Crystal Structure Of Cmet In Complex With Novel Inhibitor Length = 319 Back     alignment and structure
>pdb|3Q6U|A Chain A, Structure Of The Apo Met Receptor Kinase In The Dually-Phosphorylated, Activated State Length = 308 Back     alignment and structure
>pdb|3I5N|A Chain A, Crystal Structure Of C-Met With Triazolopyridazine Inhibitor 13 Length = 309 Back     alignment and structure
>pdb|3LQ8|A Chain A, Structure Of The Kinase Domain Of C-Met Bound To Xl880 (Gsk1 Length = 302 Back     alignment and structure
>pdb|3F66|A Chain A, Human C-Met Kinase In Complex With Quinoxaline Inhibitor Length = 298 Back     alignment and structure
>pdb|3U4W|A Chain A, Src In Complex With Dna-Templated Macrocyclic Inhibitor Mc4b Length = 275 Back     alignment and structure
>pdb|2WGJ|A Chain A, X-Ray Structure Of Pf-02341066 Bound To The Kinase Domain Of C-Met Length = 306 Back     alignment and structure
>pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 Back     alignment and structure
>pdb|2RFN|A Chain A, X-ray Structure Of C-met With Inhibitor. Length = 310 Back     alignment and structure
>pdb|2PTK|A Chain A, Chicken Src Tyrosine Kinase Length = 453 Back     alignment and structure
>pdb|3C1X|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Pyrrolotriazine Based Inhibitor Length = 373 Back     alignment and structure
>pdb|2PL0|A Chain A, Lck Bound To Imatinib Length = 289 Back     alignment and structure
>pdb|3D7U|B Chain B, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 277 Back     alignment and structure
>pdb|3G6H|A Chain A, Src Thr338ile Inhibited In The Dfg-Asp-Out Conformation Length = 286 Back     alignment and structure
>pdb|3BYS|A Chain A, Co-Crystal Structure Of Lck And Aminopyrimidine Amide 10b Length = 277 Back     alignment and structure
>pdb|2BDF|A Chain A, Src Kinase In Complex With Inhibitor Ap23451 Length = 279 Back     alignment and structure
>pdb|2OFV|A Chain A, Crystal Structure Of Aminoquinazoline 1 Bound To Lck Length = 277 Back     alignment and structure
>pdb|2OIQ|A Chain A, Crystal Structure Of Chicken C-Src Kinase Domain In Complex With The Cancer Drug Imatinib. Length = 286 Back     alignment and structure
>pdb|3SVV|A Chain A, Crystal Structure Of T338c C-Src Covalently Bound To Vinylsulfonamide- Pyrazolopyrimidine 9 Length = 286 Back     alignment and structure
>pdb|1FMK|A Chain A, Crystal Structure Of Human Tyrosine-Protein Kinase C-Src Length = 452 Back     alignment and structure
>pdb|1Y57|A Chain A, Structure Of Unphosphorylated C-Src In Complex With An Inhibitor Length = 452 Back     alignment and structure
>pdb|1YOL|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Cgp77675 Length = 283 Back     alignment and structure
>pdb|3QTI|A Chain A, C-Met Kinase In Complex With Nvp-Bvu972 Length = 314 Back     alignment and structure
>pdb|3A4P|A Chain A, Human C-Met Kinase Domain Complexed With 6-Benzyloxyquinoline Inhibitor Length = 319 Back     alignment and structure
>pdb|2OF2|A Chain A, Crystal Structure Of Furanopyrimidine 8 Bound To Lck Length = 271 Back     alignment and structure
>pdb|1P4O|A Chain A, Structure Of Apo Unactivated Igf-1r Kinase Domain At 1.5a Resolution. Length = 322 Back     alignment and structure
>pdb|3CTH|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Aminopyridine Based Inhibitor Length = 314 Back     alignment and structure
>pdb|3DKC|A Chain A, Sgx Clone 5698a65kfg1h1 Length = 317 Back     alignment and structure
>pdb|2ZM1|A Chain A, Crystal Structure Of Imidazo Pyrazin 1 Bound To The Kinase Domain Of Human Lck, (Auto-Phosphorylated On Tyr394) Length = 285 Back     alignment and structure
>pdb|1YI6|A Chain A, C-Term Tail Segment Of Human Tyrosine Kinase (258-533) Length = 276 Back     alignment and structure
>pdb|3KXZ|A Chain A, The Complex Crystal Structure Of Lck With A Probe Molecule W259 Length = 287 Back     alignment and structure
>pdb|3KMM|A Chain A, Structure Of Human Lck Kinase With A Small Molecule Inhibitor Length = 288 Back     alignment and structure
>pdb|1R0P|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With The Microbial Alkaloid K-252a Length = 312 Back     alignment and structure
>pdb|3OEZ|A Chain A, Crystal Structure Of The L317i Mutant Of The Chicken C-Src Tyrosine Kinase Domain Complexed With Imatinib Length = 286 Back     alignment and structure
>pdb|2OG8|A Chain A, Crystal Structure Of Aminoquinazoline 36 Bound To Lck Length = 265 Back     alignment and structure
>pdb|1KSW|A Chain A, Structure Of Human C-Src Tyrosine Kinase (Thr338gly Mutant) In Complex With N6-Benzyl Adp Length = 452 Back     alignment and structure
>pdb|3DQW|A Chain A, C-Src Kinase Domain Thr338ile Mutant In Complex With Atpgs Length = 286 Back     alignment and structure
>pdb|3GEQ|A Chain A, Structural Basis For The Chemical Rescue Of Src Kinase Activity Length = 286 Back     alignment and structure
>pdb|1M7N|A Chain A, Crystal Structure Of Unactivated Apo Insulin-Like Growth Factor-1 Receptor Kinase Domain Length = 322 Back     alignment and structure
>pdb|3SXR|A Chain A, Crystal Structure Of Bmx Non-Receptor Tyrosine Kinase Complex With Dasatinib Length = 268 Back     alignment and structure
>pdb|1QPE|A Chain A, Structural Analysis Of The Lymphocyte-Specific Kinase Lck In Complex With Non-Selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|2QQ7|A Chain A, Crystal Structure Of Drug Resistant Src Kinase Domain With Irreversible Inhibitor Length = 286 Back     alignment and structure
>pdb|2OFU|A Chain A, X-Ray Crystal Structure Of 2-Aminopyrimidine Carbamate 43 Bound To Lck Length = 273 Back     alignment and structure
>pdb|1YOJ|A Chain A, Crystal Structure Of Src Kinase Domain Length = 283 Back     alignment and structure
>pdb|3LCK|A Chain A, The Kinase Domain Of Human Lymphocyte Kinase (Lck), Activated Form (Auto-Phosphorylated On Tyr394) Length = 271 Back     alignment and structure
>pdb|3BYM|A Chain A, X-Ray Co-Crystal Structure Aminobenzimidazole Triazine 1 Bound To Lck Length = 272 Back     alignment and structure
>pdb|2HWO|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Covalent Inhibitor Length = 286 Back     alignment and structure
>pdb|4E4L|A Chain A, Jak1 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|2DQ7|X Chain X, Crystal Structure Of Fyn Kinase Domain Complexed With Staurosporine Length = 283 Back     alignment and structure
>pdb|3MPM|A Chain A, Lck Complexed With A Pyrazolopyrimidine Length = 267 Back     alignment and structure
>pdb|3O23|A Chain A, Human Unphosphorylated Igf1-R Kinase Domain In Complex With An Hydantoin Inhibitor Length = 305 Back     alignment and structure
>pdb|2ZM3|A Chain A, Complex Structure Of Insulin-Like Growth Factor Receptor And Isoquinolinedione Inhibitor Length = 308 Back     alignment and structure
>pdb|3LVP|A Chain A, Crystal Structure Of Bisphosphorylated Igf1-R Kinase Domain (2p) In Complex With A Bis-Azaindole Inhibitor Length = 336 Back     alignment and structure
>pdb|3EYG|A Chain A, Crystal Structures Of Jak1 And Jak2 Inhibitor Complexes Length = 290 Back     alignment and structure
>pdb|3OMV|A Chain A, Crystal Structure Of C-Raf (Raf-1) Length = 307 Back     alignment and structure
>pdb|3LW0|A Chain A, Igf-1rk In Complex With Ligand Msc1609119a-1 Length = 304 Back     alignment and structure
>pdb|3I81|A Chain A, Crystal Structure Of Insulin-Like Growth Factor 1 Receptor (Igf-1r-Wt) Complex With Bms-754807 [1-(4-((5-Cyclopropyl- 1h-Pyrazol-3-Yl)amino)pyrrolo[2,1-F][1,2, 4]triazin-2-Yl)-N- (6-Fluoro-3-Pyridinyl)-2-Methyl-L-Prolinamide] Length = 315 Back     alignment and structure
>pdb|2ZV7|A Chain A, Lyn Tyrosine Kinase Domain, Apo Form Length = 279 Back     alignment and structure
>pdb|1JQH|A Chain A, Igf-1 Receptor Kinase Domain Length = 308 Back     alignment and structure
>pdb|1JPA|A Chain A, Crystal Structure Of Unphosphorylated Ephb2 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 312 Back     alignment and structure
>pdb|2OJ9|A Chain A, Structure Of Igf-1r Kinase Domain Complexed With A Benzimidazole Inhibitor Length = 307 Back     alignment and structure
>pdb|1K3A|A Chain A, Structure Of The Insulin-Like Growth Factor 1 Receptor Kinase Length = 299 Back     alignment and structure
>pdb|4EQM|A Chain A, Structural Analysis Of Staphylococcus Aureus SerineTHREONINE KINASE Pknb Length = 294 Back     alignment and structure
>pdb|3A4O|X Chain X, Lyn Kinase Domain Length = 286 Back     alignment and structure
>pdb|3C4C|A Chain A, B-Raf Kinase In Complex With Plx4720 Length = 280 Back     alignment and structure
>pdb|3QQU|A Chain A, Cocrystal Structure Of Unphosphorylated Igf With Pyrimidine 8 Length = 301 Back     alignment and structure
>pdb|1QPD|A Chain A, Structural Analysis Of The Lymphocyte-specific Kinase Lck In Complex With Non-selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|4FK3|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx3203 Length = 292 Back     alignment and structure
>pdb|1MQB|A Chain A, Crystal Structure Of Ephrin A2 (Epha2) Receptor Protein Kinase Length = 333 Back     alignment and structure
>pdb|2HK5|A Chain A, Hck Kinase In Complex With Lck Targetted Inhibitor Pg- 1009247 Length = 270 Back     alignment and structure
>pdb|2VWU|A Chain A, Ephb4 Kinase Domain Inhibitor Complex Length = 302 Back     alignment and structure
>pdb|3LCD|A Chain A, Inhibitor Bound To A Dfg-In Structure Of The Kinase Domain Of Csf-1r Length = 329 Back     alignment and structure
>pdb|3OG7|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx4032 Length = 289 Back     alignment and structure
>pdb|4AW5|A Chain A, Complex Of The Ephb4 Kinase Domain With An Oxindole Inhibitor Length = 291 Back     alignment and structure
>pdb|3D94|A Chain A, Crystal Structure Of The Insulin-Like Growth Factor-1 Receptor Kinase In Complex With Pqip Length = 301 Back     alignment and structure
>pdb|2OGV|A Chain A, Crystal Structure Of The Autoinhibited Human C-Fms Kinase Domain Length = 317 Back     alignment and structure
>pdb|1K9A|A Chain A, Crystal Structure Analysis Of Full-Length Carboxyl-Terminal Src Kinase At 2.5 A Resolution Length = 450 Back     alignment and structure
>pdb|1QCF|A Chain A, Crystal Structure Of Hck In Complex With A Src Family- Selective Tyrosine Kinase Inhibitor Length = 454 Back     alignment and structure
>pdb|2HEL|A Chain A, Crystal Structure Of A Mutant Epha4 Kinase Domain (Y742a) Length = 306 Back     alignment and structure
>pdb|3Q96|A Chain A, B-Raf Kinase Domain In Complex With A Tetrahydronaphthalene Inhibitor Length = 282 Back     alignment and structure
>pdb|3D7T|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 269 Back     alignment and structure
>pdb|2FB8|A Chain A, Structure Of The B-Raf Kinase Domain Bound To Sb-590885 Length = 281 Back     alignment and structure
>pdb|1BYG|A Chain A, Kinase Domain Of Human C-Terminal Src Kinase (Csk) In Complex With Inhibitor Staurosporine Length = 278 Back     alignment and structure
>pdb|4DBN|A Chain A, Crystal Structure Of The Kinase Domain Of Human B-Raf With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 284 Back     alignment and structure
>pdb|4H58|A Chain A, Braf In Complex With Compound 3 Length = 275 Back     alignment and structure
>pdb|3S95|A Chain A, Crystal Structure Of The Human Limk1 Kinase Domain In Complex With Staurosporine Length = 310 Back     alignment and structure
>pdb|3D7U|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 263 Back     alignment and structure
>pdb|3PLS|A Chain A, Ron In Complex With Ligand Amp-Pnp Length = 298 Back     alignment and structure
>pdb|4E6D|A Chain A, Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex With Compound 7 Length = 298 Back     alignment and structure
>pdb|2R4B|A Chain A, Erbb4 Kinase Domain Complexed With A Thienopyrimidine Inhibitor Length = 321 Back     alignment and structure
>pdb|1UWJ|A Chain A, The Complex Of Mutant V599e B-raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|3II5|A Chain A, The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimidine Inhibitor Length = 306 Back     alignment and structure
>pdb|3D4Q|A Chain A, Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 307 Back     alignment and structure
>pdb|1IR3|A Chain A, Phosphorylated Insulin Receptor Tyrosine Kinase In Complex With Peptide Substrate And Atp Analog Length = 306 Back     alignment and structure
>pdb|1UWH|A Chain A, The Complex Of Wild Type B-Raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|1I44|A Chain A, Crystallographic Studies Of An Activation Loop Mutant Of The Insulin Receptor Tyrosine Kinase Length = 306 Back     alignment and structure
>pdb|2Z8C|A Chain A, Phosphorylated Insulin Receptor Tyrosine Kinase In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin-2- Yl]amino}phenyl)acetic Acid Length = 303 Back     alignment and structure
>pdb|3IDP|A Chain A, B-Raf V600e Kinase Domain In Complex With An Aminoisoquinoline Inhibitor Length = 300 Back     alignment and structure
>pdb|1RQQ|A Chain A, Crystal Structure Of The Insulin Receptor Kinase In Complex With The Sh2 Domain Of Aps Length = 306 Back     alignment and structure
>pdb|4G9R|A Chain A, B-Raf V600e Kinase Domain Bound To A Type Ii Dihydroquinazoline Inhibitor Length = 307 Back     alignment and structure
>pdb|2HEN|A Chain A, Crystal Structure Of The Ephb2 Receptor Kinase Domain In Complex With Adp Length = 286 Back     alignment and structure
>pdb|1IRK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Human Insulin Receptor Length = 306 Back     alignment and structure
>pdb|2W1I|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 326 Back     alignment and structure
>pdb|3RVG|A Chain A, Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido[4,3-B]indol-4- Carboxamide Inhibitor Length = 303 Back     alignment and structure
>pdb|3LPB|A Chain A, Crystal Structure Of Jak2 Complexed With A Potent 2,8-Diaryl Quinoxaline Inhibitor Length = 295 Back     alignment and structure
>pdb|3TJC|A Chain A, Co-Crystal Structure Of Jak2 With Thienopyridine 8 Length = 298 Back     alignment and structure
>pdb|2B7A|A Chain A, The Structural Basis Of Janus Kinase 2 Inhibition By A Potent And Specific Pan-Janus Kinase Inhibitor Length = 293 Back     alignment and structure
>pdb|3LCO|A Chain A, Inhibitor Bound To A Dfg-Out Structure Of The Kinase Domain Of Csf-1r Length = 324 Back     alignment and structure
>pdb|4HGE|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 Length = 300 Back     alignment and structure
>pdb|4E4M|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|3BEA|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A Pyrimidinopyridone Inhibitor Length = 333 Back     alignment and structure
>pdb|3E62|A Chain A, Fragment Based Discovery Of Jak-2 Inhibitors Length = 293 Back     alignment and structure
>pdb|4AQC|A Chain A, Triazolopyridine-Based Inhibitor Of Janus Kinase 2 Length = 301 Back     alignment and structure
>pdb|3Q32|A Chain A, Structure Of Janus Kinase 2 With A Pyrrolotriazine Inhibitor Length = 301 Back     alignment and structure
>pdb|1AD5|A Chain A, Src Family Kinase Hck-Amp-Pnp Complex Length = 438 Back     alignment and structure
>pdb|3ETA|A Chain A, Kinase Domain Of Insulin Receptor Complexed With A Pyrrolo Pyridine Inhibitor Length = 317 Back     alignment and structure
>pdb|3JY9|A Chain A, Janus Kinase 2 Inhibitors Length = 311 Back     alignment and structure
>pdb|3IO7|A Chain A, 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Selective Inhibitors Of Jak2 Length = 313 Back     alignment and structure
>pdb|1RJB|A Chain A, Crystal Structure Of Flt3 Length = 344 Back     alignment and structure
>pdb|2XYU|A Chain A, Crystal Structure Of Epha4 Kinase Domain In Complex With Vuf 12058 Length = 285 Back     alignment and structure
>pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 Back     alignment and structure
>pdb|2QOK|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:s768a Triple Mutant Length = 373 Back     alignment and structure
>pdb|3UGC|A Chain A, Structural Basis Of Jak2 Inhibition By The Type Ii Inhibtor Nvp-Bbt594 Length = 295 Back     alignment and structure
>pdb|1LUF|A Chain A, Crystal Structure Of The Musk Tyrosine Kinase: Insights Into Receptor Autoregulation Length = 343 Back     alignment and structure
>pdb|2Y6M|A Chain A, Crystal Structure Of Epha4 Kinase Domain Length = 291 Back     alignment and structure
>pdb|2XA4|A Chain A, Inhibitors Of Jak2 Kinase Domain Length = 298 Back     alignment and structure
>pdb|3DZQ|A Chain A, Human Epha3 Kinase Domain In Complex With Inhibitor Awl-Ii- 38.3 Length = 361 Back     alignment and structure
>pdb|2QOB|A Chain A, Human Epha3 Kinase Domain, Base Structure Length = 344 Back     alignment and structure
>pdb|3BBT|B Chain B, Crystal Structure Of The Erbb4 Kinase In Complex With Lapatinib Length = 328 Back     alignment and structure
>pdb|2QOC|A Chain A, Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp Bound Structure Length = 344 Back     alignment and structure
>pdb|2I1M|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An Arylamide Inhibitor Length = 333 Back     alignment and structure
>pdb|1P14|A Chain A, Crystal Structure Of A Catalytic-Loop Mutant Of The Insulin Receptor Tyrosine Kinase Length = 306 Back     alignment and structure
>pdb|3EKK|A Chain A, Insulin Receptor Kinase Complexed With An Inhibitor Length = 307 Back     alignment and structure
>pdb|2QON|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742a Triple Mutant Length = 373 Back     alignment and structure
>pdb|2QOO|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742f Triple Mutant Length = 373 Back     alignment and structure
>pdb|2R2P|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 5 (Epha5) Length = 295 Back     alignment and structure
>pdb|2QOI|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f Double Mutant Length = 373 Back     alignment and structure
>pdb|2GSF|A Chain A, The Human Epha3 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 373 Back     alignment and structure
>pdb|3FXX|A Chain A, Human Epha3 Kinase And Juxtamembrane Region Bound To Substrate Kqwdnye[ptyr]iw Length = 371 Back     alignment and structure
>pdb|2QOF|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f Mutant Length = 373 Back     alignment and structure
>pdb|2QOD|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y602f Mutant Length = 373 Back     alignment and structure
>pdb|4BBE|A Chain A, Aminoalkylpyrimidine Inhibitor Complexes With Jak2 Length = 298 Back     alignment and structure
>pdb|2QO7|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Dephosphorylated, Amp-Pnp Bound Length = 373 Back     alignment and structure
>pdb|2QOL|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596:y602:s768g Triple Mutant Length = 373 Back     alignment and structure
>pdb|3PP0|A Chain A, Crystal Structure Of The Kinase Domain Of Human Her2 (Erbb2). Length = 338 Back     alignment and structure
>pdb|3F61|A Chain A, Crystal Structure Of M. Tuberculosis Pknb Leu33aspVAL222ASP DOUBLE MUTANT IN COMPLEX WITH ADP Length = 311 Back     alignment and structure
>pdb|4HZS|A Chain A, Crystal Structure Of Ack1 Kinase Domain With C-terminal Sh3 Domain Length = 341 Back     alignment and structure
>pdb|3F69|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Pknb Mutant Kinase Domain In Complex With Kt5720 Length = 311 Back     alignment and structure
>pdb|1U54|A Chain A, Crystal Structures Of The Phosphorylated And Unphosphorylated Kinase Domains Of The Cdc42-Associated Tyrosine Kinase Ack1 Bound To Amp-Pcp Length = 291 Back     alignment and structure
>pdb|1U46|A Chain A, Crystal Structure Of The Unphosphorylated Kinase Domain Of The Tyrosine Kinase Ack1 Length = 291 Back     alignment and structure
>pdb|3ORI|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain L33d Mutant (Crystal Form 1) Length = 311 Back     alignment and structure
>pdb|4EWH|B Chain B, Co-Crystal Structure Of Ack1 With Inhibitor Length = 275 Back     alignment and structure
>pdb|3EQP|B Chain B, Crystal Structure Of Ack1 With Compound T95 Length = 276 Back     alignment and structure
>pdb|4HZR|A Chain A, Crystal Structure Of Ack1 Kinase Domain Length = 277 Back     alignment and structure
>pdb|3NIZ|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Adp Bound Length = 311 Back     alignment and structure
>pdb|4ID7|A Chain A, Ack1 Kinase In Complex With The Inhibitor Cis-3-[8-amino-1-(4- Phenoxyphenyl)imidazo[1,5-a]pyrazin-3-yl]cyclobutanol Length = 273 Back     alignment and structure
>pdb|2QKR|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Indirubin 3'-Monoxime Bound Length = 313 Back     alignment and structure
>pdb|4GT4|A Chain A, Structure Of Unliganded, Inactive Ror2 Kinase Domain Length = 308 Back     alignment and structure
>pdb|2I0V|A Chain A, C-Fms Tyrosine Kinase In Complex With A Quinolone Inhibitor Length = 335 Back     alignment and structure
>pdb|3ZZW|A Chain A, Crystal Structure Of The Kinase Domain Of Ror2 Length = 289 Back     alignment and structure
>pdb|3KUL|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|2REI|A Chain A, Kinase Domain Of Human Ephrin Type-a Receptor 7 (epha7) Length = 318 Back     alignment and structure
>pdb|3GEN|A Chain A, The 1.6 A Crystal Structure Of Human Bruton's Tyrosine Kinase Bound To A Pyrrolopyrimidine-Containing Compound Length = 283 Back     alignment and structure
>pdb|1S9I|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 2 (Mek2)in A Complex With Ligand And Mgatp Length = 354 Back     alignment and structure
>pdb|3QRJ|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain T315i Mutant In Complex With Dcc-2036 Length = 277 Back     alignment and structure
>pdb|3C4F|A Chain A, Fgfr Tyrosine Kinase Domain In Complex With 3-(3- Methoxybenzyl)-7-Azaindole Length = 302 Back     alignment and structure
>pdb|3KUL|B Chain B, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|3QRI|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain In Complex With Dcc- 2036 Length = 277 Back     alignment and structure
>pdb|3K54|A Chain A, Structures Of Human Bruton's Tyrosine Kinase In Active And Inactive Conformations Suggests A Mechanism Of Activation For Tec Family Kinases Length = 283 Back     alignment and structure
>pdb|3GQL|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|3P08|A Chain A, Crystal Structure Of The Human Btk Kinase Domain Length = 267 Back     alignment and structure
>pdb|3RHX|B Chain B, Crystal Structure Of The Catalytic Domain Of Fgfr1 Kinase In Complex With Arq 069 Length = 306 Back     alignment and structure
>pdb|2HZI|A Chain A, Abl Kinase Domain In Complex With Pd180970 Length = 277 Back     alignment and structure
>pdb|3PIX|A Chain A, Crystal Structure Of Btk Kinase Domain Complexed With 2-Isopropyl-7- (4-Methyl-Piperazin-1-Yl)-4-(5-Methyl-2h-Pyrazol-3- Ylamino)-2h- Phthalazin-1-One Length = 274 Back     alignment and structure
>pdb|2HYY|A Chain A, Human Abl Kinase Domain In Complex With Imatinib (Sti571, Glivec) Length = 273 Back     alignment and structure
>pdb|2E2B|A Chain A, Crystal Structure Of The C-Abl Kinase Domain In Complex With Inno-406 Length = 293 Back     alignment and structure
>pdb|1FGK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of Fibroblast Growth Factor Receptor 1 Length = 310 Back     alignment and structure
>pdb|4F63|A Chain A, Crystal Structure Of Human Fibroblast Growth Factor Receptor 1 Kinase Domain In Complex With Compound 1 Length = 309 Back     alignment and structure
>pdb|3QA8|A Chain A, Crystal Structure Of Inhibitor Of Kappa B Kinase Beta Length = 676 Back     alignment and structure
>pdb|3RZF|A Chain A, Crystal Structure Of Inhibitor Of Kappab Kinase Beta (I4122) Length = 677 Back     alignment and structure
>pdb|3OCS|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase In Complex With Inhibitor Cgi1746 Length = 271 Back     alignment and structure
>pdb|2J0L|A Chain A, Crystal Structure Of A The Active Conformation Of The Kinase Domain Of Focal Adhesion Kinase With A Phosphorylated Activation Loop Length = 276 Back     alignment and structure
>pdb|3KXX|A Chain A, Structure Of The Mutant Fibroblast Growth Factor Receptor 1 Length = 317 Back     alignment and structure
>pdb|1K2P|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Domain Length = 263 Back     alignment and structure
>pdb|2HZ0|A Chain A, Abl Kinase Domain In Complex With Nvp-Aeg082 Length = 270 Back     alignment and structure
>pdb|3TT0|A Chain A, Co-Structure Of Fibroblast Growth Factor Receptor 1 Kinase Domain With 3-(2,6-Dichloro-3, 5-Dimethoxy-Phenyl)-1-{6-[4-(4-Ethyl-Piperazin-1- Yl)-Phenylamino]-Pyrimidin-4-Yl}-1-Methyl-Urea (Bgj398) Length = 382 Back     alignment and structure
>pdb|3JS2|A Chain A, Crystal Structure Of Minimal Kinase Domain Of Fibroblast Growth Factor Receptor 1 In Complex With 5-(2-Thienyl) Nicotinic Acid Length = 317 Back     alignment and structure
>pdb|3LCT|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 344 Back     alignment and structure
>pdb|3L9P|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 367 Back     alignment and structure
>pdb|4EBW|A Chain A, Structure Of Focal Adhesion Kinase Catalytic Domain In Complex With Novel Allosteric Inhibitor Length = 304 Back     alignment and structure
>pdb|2JKM|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|3PYY|A Chain A, Discovery And Characterization Of A Cell-Permeable, Small-Molecule C- Abl Kinase Activator That Binds To The Myristoyl Binding Site Length = 298 Back     alignment and structure
>pdb|2HIW|A Chain A, Crystal Structure Of Inactive Conformation Abl Kinase Catalytic Domain Complexed With Type Ii Inhibitor Length = 287 Back     alignment and structure
>pdb|3PXK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Pyrrolo[2,3- D]thiazole Length = 282 Back     alignment and structure
>pdb|2G1T|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|2ETM|A Chain A, Crystal Structure Of Focal Adhesion Kinase Domain Complexed With 7h-Pyrrolo [2,3-D] Pyrimidine Derivative Length = 281 Back     alignment and structure
>pdb|1MP8|A Chain A, Crystal Structure Of Focal Adhesion Kinase (Fak) Length = 281 Back     alignment and structure
>pdb|3BZ3|A Chain A, Crystal Structure Analysis Of Focal Adhesion Kinase With A Methanesulfonamide Diaminopyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|2J0M|B Chain B, Crystal Structure A Two-Chain Complex Between The Ferm And Kinase Domains Of Focal Adhesion Kinase. Length = 276 Back     alignment and structure
>pdb|2GQG|A Chain A, X-Ray Crystal Structure Of Dasatinib (Bms-354825) Bound To Activated Abl Kinase Domain Length = 278 Back     alignment and structure
>pdb|4FNW|A Chain A, Crystal Structure Of The Apo F1174l Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 Back     alignment and structure
>pdb|2V7A|A Chain A, Crystal Structure Of The T315i Abl Mutant In Complex With The Inhibitor Pha-739358 Length = 286 Back     alignment and structure
>pdb|3ORM|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain D76a Mutant Length = 311 Back     alignment and structure
>pdb|3GQI|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|2YJR|A Chain A, Structure Of F1174l Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|2OO8|X Chain X, Synthesis, Structural Analysis, And Sar Studies Of Triazine Derivatives As Potent, Selective Tie-2 Inhibitors Length = 317 Back     alignment and structure
>pdb|2JKK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|2J0J|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains Length = 656 Back     alignment and structure
>pdb|1FVR|A Chain A, Tie2 Kinase Domain Length = 327 Back     alignment and structure
>pdb|1MRU|A Chain A, Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycobacterium Tuberculosis Pknb. Length = 311 Back     alignment and structure
>pdb|1FPU|A Chain A, Crystal Structure Of Abl Kinase Domain In Complex With A Small Molecule Inhibitor Length = 293 Back     alignment and structure
>pdb|2QLU|A Chain A, Crystal Structure Of Activin Receptor Type Ii Kinase Domain From Human Length = 314 Back     alignment and structure
>pdb|3OY3|A Chain A, Crystal Structure Of Abl T315i Mutant Kinase Domain Bound With A Dfg- Out Inhibitor Ap24589 Length = 284 Back     alignment and structure
>pdb|2Z60|A Chain A, Crystal Structure Of The T315i Mutant Of Abl Kinase Bound With Ppy-A Length = 288 Back     alignment and structure
>pdb|4FNZ|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Piperidine-Carboxamide Inhibitor 2 Length = 327 Back     alignment and structure
>pdb|3OXZ|A Chain A, Crystal Structure Of Abl Kinase Domain Bound With A Dfg-Out Inhibitor Ap24534 Length = 284 Back     alignment and structure
>pdb|3OHT|A Chain A, Crystal Structure Of Salmo Salar P38alpha Length = 389 Back     alignment and structure
>pdb|1OB3|A Chain A, Structure Of P. Falciparum Pfpk5 Length = 288 Back     alignment and structure
>pdb|2YFX|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase In Complex With Crizotinib Length = 327 Back     alignment and structure
>pdb|2QOH|A Chain A, Crystal Structure Of Abl Kinase Bound With Ppy-a Length = 288 Back     alignment and structure
>pdb|2XB7|A Chain A, Structure Of Human Anaplastic Lymphoma Kinase In Complex With Nvp- Tae684 Length = 315 Back     alignment and structure
>pdb|3OCT|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Mutant V555r In Complex With Dasatinib Length = 265 Back     alignment and structure
>pdb|4FOB|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Acyliminobenzimidazole Inhibitor 1 Length = 353 Back     alignment and structure
>pdb|3NYX|A Chain A, Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-Thiadiazole- Thiophene Inhibitor Length = 302 Back     alignment and structure
>pdb|4DCE|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With A Piperidine-Carboxamide Inhibitor Length = 333 Back     alignment and structure
>pdb|3IKA|A Chain A, Crystal Structure Of Egfr 696-1022 T790m Mutant Covalently Binding To Wz4002 Length = 331 Back     alignment and structure
>pdb|2XP2|A Chain A, Structure Of The Human Anaplastic Lymphoma Kinase In Complex With Crizotinib (Pf-02341066) Length = 327 Back     alignment and structure
>pdb|1V0O|A Chain A, Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulphonate Ligand Complex Length = 288 Back     alignment and structure
>pdb|3AOX|A Chain A, X-Ray Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Ch5424802 Length = 344 Back     alignment and structure
>pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 Back     alignment and structure
>pdb|2F4J|A Chain A, Structure Of The Kinase Domain Of An Imatinib-Resistant Abl Mutant In Complex With The Aurora Kinase Inhibitor Vx-680 Length = 287 Back     alignment and structure
>pdb|2YHV|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|1V0B|A Chain A, Crystal Structure Of The T198a Mutant Of Pfpk5 Length = 288 Back     alignment and structure
>pdb|2JIU|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Complex With Aee788 Length = 328 Back     alignment and structure
>pdb|2G2F|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|2PK9|A Chain A, Structure Of The Pho85-pho80 Cdk-cyclin Complex Of The Phosphate-responsive Signal Transduction Pathway Length = 317 Back     alignment and structure
>pdb|1O6Y|A Chain A, Catalytic Domain Of Pknb Kinase From Mycobacterium Tuberculosis Length = 299 Back     alignment and structure
>pdb|2J0K|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains. Length = 656 Back     alignment and structure
>pdb|4I24|A Chain A, Structure Of T790m Egfr Kinase Domain Co-crystallized With Dacomitinib Length = 329 Back     alignment and structure
>pdb|2JIV|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Compex With Hki-272 Length = 328 Back     alignment and structure
>pdb|3DAK|A Chain A, Crystal Structure Of Domain-Swapped Osr1 Kinase Domain Length = 290 Back     alignment and structure
>pdb|2YJS|A Chain A, Structure Of C1156y Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|2VWI|A Chain A, Structure Of The Osr1 Kinase, A Hypertension Drug Target Length = 303 Back     alignment and structure
>pdb|2WQM|A Chain A, Structure Of Apo Human Nek7 Length = 310 Back     alignment and structure
>pdb|1M14|A Chain A, Tyrosine Kinase Domain From Epidermal Growth Factor Receptor Length = 333 Back     alignment and structure
>pdb|3C7Q|A Chain A, Structure Of Vegfr2 Kinase Domain In Complex With Bibf1120 Length = 316 Back     alignment and structure
>pdb|2P0C|A Chain A, Catalytic Domain Of The Proto-Oncogene Tyrosine-Protein Kina Length = 313 Back     alignment and structure
>pdb|4G5P|A Chain A, Crystal Structure Of Egfr Kinase T790m In Complex With Bibw2992 Length = 330 Back     alignment and structure
>pdb|3EZR|A Chain A, Cdk-2 With Indazole Inhibitor 17 Bound At Its Active Site Length = 300 Back     alignment and structure
>pdb|2JIT|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation Length = 327 Back     alignment and structure
>pdb|4I23|A Chain A, Crystal Structure Of The Wild-type Egfr Kinase Domain In Complex With Dacomitinib (soaked) Length = 329 Back     alignment and structure
>pdb|3PXF|A Chain A, Cdk2 In Complex With Two Molecules Of 8-Anilino-1-Naphthalene Sulfonate Length = 306 Back     alignment and structure
>pdb|3VJO|A Chain A, Crystal Structure Of The Wild-Type Egfr Kinase Domain In Complex With Amppnp Length = 334 Back     alignment and structure
>pdb|4ERW|A Chain A, Cdk2 In Complex With Staurosporine Length = 306 Back     alignment and structure
>pdb|3NZ0|A Chain A, Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 302 Back     alignment and structure
>pdb|2W17|A Chain A, Cdk2 In Complex With The Imidazole Pyrimidine Amide, Compound (S)-8b Length = 299 Back     alignment and structure
>pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 Back     alignment and structure
>pdb|1FIN|A Chain A, Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 298 Back     alignment and structure
>pdb|3PJ8|A Chain A, Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D]pyrimidine Bioisostere Of Roscovitine Length = 299 Back     alignment and structure
>pdb|2PVF|A Chain A, Crystal Structure Of Tyrosine Phosphorylated Activated Fgf Receptor 2 (Fgfr2) Kinase Domain In Complex With Atp Analog And Substrate Peptide Length = 334 Back     alignment and structure
>pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Inhibitor 2-Amino-6-(3'-Methyl-2'-Oxo)butoxypurine Length = 299 Back     alignment and structure
>pdb|1XKK|A Chain A, Egfr Kinase Domain Complexed With A Quinazoline Inhibitor- Gw572016 Length = 352 Back     alignment and structure
>pdb|2WQB|A Chain A, Structure Of The Tie2 Kinase Domain In Complex With A Thiazolopyrimidine Inhibitor Length = 324 Back     alignment and structure
>pdb|3CLY|A Chain A, Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase Domains Trapped In Trans-Phosphorylation Reaction Length = 334 Back     alignment and structure
>pdb|1PF8|A Chain A, Crystal Structure Of Human Cyclin-dependent Kinase 2 Complexed With A Nucleoside Inhibitor Length = 298 Back     alignment and structure
>pdb|2OH4|A Chain A, Crystal Structure Of Vegfr2 With A Benzimidazole-Urea Inhibitor Length = 316 Back     alignment and structure
>pdb|4G5J|A Chain A, Crystal Structure Of Egfr Kinase In Complex With Bibw2992 Length = 330 Back     alignment and structure
>pdb|2J5F|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 34-Jab Length = 327 Back     alignment and structure
>pdb|2GS2|A Chain A, Crystal Structure Of The Active Egfr Kinase Domain Length = 330 Back     alignment and structure
>pdb|2P2H|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridinyl-Triazine Inhibitor Length = 314 Back     alignment and structure
>pdb|2GS7|A Chain A, Crystal Structure Of The Inactive Egfr Kinase Domain In Complex With Amp-Pnp Length = 330 Back     alignment and structure
>pdb|3LZB|A Chain A, Egfr Kinase Domain Complexed With An Imidazo[2,1-B]thiazole Inhibitor Length = 327 Back     alignment and structure
>pdb|1VYW|A Chain A, Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 309 Back     alignment and structure
>pdb|4FNX|A Chain A, Crystal Structure Of The Apo R1275q Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 Back     alignment and structure
>pdb|2P2I|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Nicotinamide Inhibitor Length = 314 Back     alignment and structure
>pdb|2J5E|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 13-Jab Length = 327 Back     alignment and structure
>pdb|2IVV|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Complexed With The Inhibitor Pp1 Length = 314 Back     alignment and structure
>pdb|3U6J|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyrazolone Inhibitor Length = 314 Back     alignment and structure
>pdb|2F57|A Chain A, Crystal Structure Of The Human P21-activated Kinase 5 Length = 317 Back     alignment and structure
>pdb|3LXN|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 318 Back     alignment and structure
>pdb|3EWH|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridyl-Pyrimidine Benzimidazole Inhibitor Length = 314 Back     alignment and structure
>pdb|1VR2|A Chain A, Human Vascular Endothelial Growth Factor Receptor 2 (Kdr) Kinase Domain Length = 316 Back     alignment and structure
>pdb|1YWN|A Chain A, Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]pyrimidine Length = 316 Back     alignment and structure
>pdb|3GVU|A Chain A, The Crystal Structure Of Human Abl2 In Complex With Gleevec Length = 292 Back     alignment and structure
>pdb|1GII|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|1PKG|A Chain A, Structure Of A C-kit Kinase Product Complex Length = 329 Back     alignment and structure
>pdb|2PSQ|A Chain A, Crystal Structure Of Unphosphorylated Unactivated Wild Type Fgf Receptor 2 (Fgfr2) Kinase Domain Length = 370 Back     alignment and structure
>pdb|2PZP|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K526e Mutation Responsible For Crouzon Syndrome Length = 324 Back     alignment and structure
>pdb|3GOP|A Chain A, Crystal Structure Of The Egf Receptor Juxtamembrane And Kinase Domains Length = 361 Back     alignment and structure
>pdb|3G0E|A Chain A, Kit Kinase Domain In Complex With Sunitinib Length = 336 Back     alignment and structure
>pdb|2XIR|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With Pf-00337210 (N,2-Dimethyl-6-(7-(2-Morpholinoethoxy) Quinolin-4-Yloxy)benzofuran-3-Carboxamide) Length = 316 Back     alignment and structure
>pdb|2IVT|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|2PUU|A Chain A, Crystal Structure Of P38 Complex With 1-(5-Tert-Butyl-2-P- Tolyl-2h-Pyrazol-3-Yl)-3-[4-(6-Morpholin-4-Ylmethyl- Pyridin-3-Yl)naphthalen-1-Yl]urea Length = 348 Back     alignment and structure
>pdb|3VNT|A Chain A, Crystal Structure Of The Kinase Domain Of Human Vegfr2 With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 318 Back     alignment and structure
>pdb|2FSL|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a+f327s) Activating Mutant Form-A Length = 367 Back     alignment and structure
>pdb|3CJF|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 Back     alignment and structure
>pdb|1OIT|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-dependent Kinase Inhibitors Identified Through Structure-based Hybridisation Length = 299 Back     alignment and structure
>pdb|4AGC|A Chain A, Crystal Structure Of Vegfr2 (Juxtamembrane And Kinase Domains) In Complex With Axitinib (Ag-013736) (N-Methyl-2-( 3-((E)-2-Pyridin-2-Yl-Vinyl)-1h-Indazol-6-Ylsulfanyl)- Benzamide) Length = 353 Back     alignment and structure
>pdb|3CJG|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 Back     alignment and structure
>pdb|2IW6|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A Complexed With A Bisanilinopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|4E1Z|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 291 Back     alignment and structure
>pdb|2BAQ|A Chain A, P38alpha Bound To Ro3201195 Length = 365 Back     alignment and structure
>pdb|4E20|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 290 Back     alignment and structure
>pdb|2PVY|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K659n Mutation Responsible For An Unclassified Craniosynostosis Syndrome. Length = 324 Back     alignment and structure
>pdb|1T46|A Chain A, Structural Basis For The Autoinhibition And Sti-571 Inhibition Of C-kit Tyrosine Kinase Length = 313 Back     alignment and structure
>pdb|2Z7Q|A Chain A, Crystal Structure Of The N-Terminal Kinase Domain Of Human Rsk-1 Bound To Amp-Pcp Length = 321 Back     alignment and structure
>pdb|2PZ5|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549t Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2FSO|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a) Activating Mutant Length = 367 Back     alignment and structure
>pdb|1T45|A Chain A, Structural Basis For The Autoinhibition And Sti-571 Inhibition Of C- Kit Tyrosine Kinase Length = 331 Back     alignment and structure
>pdb|4HJO|A Chain A, Crystal Structure Of The Inactive Egfr Tyrosine Kinase Domain With Erlotinib Length = 337 Back     alignment and structure
>pdb|2FST|X Chain X, Mitogen Activated Protein Kinase P38alpha (d176a+f327l) Activating Mutant Length = 367 Back     alignment and structure
>pdb|4E5A|X Chain X, The W197a Mutant Of P38a Map Kinase Length = 360 Back     alignment and structure
>pdb|3B2T|A Chain A, Structure Of Phosphotransferase Length = 311 Back     alignment and structure
>pdb|4EOS|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|2IVS|A Chain A, Crystal Structure Of Non-Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|3UG1|A Chain A, Crystal Structure Of The Mutated Egfr Kinase Domain (G719sT790M) IN The Apo Form Length = 334 Back     alignment and structure
>pdb|3ORN|A Chain A, Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In Complex With Ch4987655 And Mgamp-Pnp Length = 307 Back     alignment and structure
>pdb|3G0F|A Chain A, Kit Kinase Domain Mutant D816h In Complex With Sunitinib Length = 336 Back     alignment and structure
>pdb|4EOQ|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|4BCQ|A Chain A, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 301 Back     alignment and structure
>pdb|1E9H|A Chain A, Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex With The Inhibitor Indirubin-5-Sulphonate Bound Length = 297 Back     alignment and structure
>pdb|1LEW|A Chain A, Crystal Structure Of Map Kinase P38 Complexed To The Docking Site On Its Nuclear Substrate Mef2a Length = 360 Back     alignment and structure
>pdb|2PWL|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549h Mutation Responsible For Crouzon Syndrome. Length = 324 Back     alignment and structure
>pdb|4EOP|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|3P4K|A Chain A, The Third Conformation Of P38a Map Kinase Observed In Phosphorylated P38a And In Solution Length = 370 Back     alignment and structure
>pdb|2GTM|A Chain A, Mutated Mouse P38 Map Kinase Domain In Complex With Inhibitor Pg-892579 Length = 348 Back     alignment and structure
>pdb|3DK6|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|1OGU|A Chain A, Structure Of Human Thr160-phospho Cdk2/cyclin A Complexed With A 2-arylamino-4-cyclohexylmethyl-5-nitroso-6- aminopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|3RI1|A Chain A, Crystal Structure Of The Catalytic Domain Of Fgfr2 Kinase In Complex With Arq 069 Length = 313 Back     alignment and structure
>pdb|1QMZ|A Chain A, Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Complex Length = 299 Back     alignment and structure
>pdb|4I1Z|A Chain A, Crystal Structure Of The Monomeric (v948r) Form Of The Gefitinib/erlotinib Resistant Egfr Kinase Domain L858r+t790m Length = 329 Back     alignment and structure
>pdb|1W98|A Chain A, The Structural Basis Of Cdk2 Activation By Cyclin E Length = 298 Back     alignment and structure
>pdb|1BMK|A Chain A, The Complex Structure Of The Map Kinase P38SB218655 Length = 379 Back     alignment and structure
>pdb|1H1P|A Chain A, Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMPLEXED With The Inhibitor Nu2058 Length = 303 Back     alignment and structure
>pdb|1GJO|A Chain A, The Fgfr2 Tyrosine Kinase Domain Length = 316 Back     alignment and structure
>pdb|2BAL|A Chain A, P38alpha Map Kinase Bound To Pyrazoloamine Length = 365 Back     alignment and structure
>pdb|4I3Z|A Chain A, Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNESIUM IONS Length = 296 Back     alignment and structure
>pdb|2XIK|A Chain A, Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related Kinase 1) Length = 294 Back     alignment and structure
>pdb|3BEL|A Chain A, X-Ray Structure Of Egfr In Complex With Oxime Inhibitor Length = 315 Back     alignment and structure
>pdb|4EOO|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With Atp Length = 299 Back     alignment and structure
>pdb|3BHT|A Chain A, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX WITH THE Inhibitor Meriolin 3 Length = 300 Back     alignment and structure
>pdb|3HVC|A Chain A, Crystal Structure Of Human P38alpha Map Kinase Length = 362 Back     alignment and structure
>pdb|3D83|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|4I21|A Chain A, Crystal Structure Of L858r + T790m Egfr Kinase Domain In Complex With Mig6 Peptide Length = 329 Back     alignment and structure
>pdb|3ODY|X Chain X, Crystal Structure Of P38alpha Y323q Active Mutant Length = 360 Back     alignment and structure
>pdb|2EB2|A Chain A, Crystal Structure Of Mutated Egfr Kinase Domain (G719s) Length = 334 Back     alignment and structure
>pdb|3NNU|A Chain A, Crystal Structure Of P38 Alpha In Complex With Dp1376 Length = 354 Back     alignment and structure
>pdb|3TG1|A Chain A, Crystal Structure Of P38alpha In Complex With A Mapk Docking Partner Length = 380 Back     alignment and structure
>pdb|3OEF|X Chain X, Crystal Structure Of Y323f Inactive Mutant Of P38alpha Map Kinase Length = 360 Back     alignment and structure
>pdb|4EOI|A Chain A, Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 299 Back     alignment and structure
>pdb|3OD6|X Chain X, Crystal Structure Of P38alpha Y323t Active Mutant Length = 360 Back     alignment and structure
>pdb|3E92|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biaryl Amide Inhibitor Length = 371 Back     alignment and structure
>pdb|3IS5|A Chain A, Crystal Structure Of Cdpk Kinase Domain From Toxoplasma Gondii, Tgme49_018720 Length = 285 Back     alignment and structure
>pdb|3ODZ|X Chain X, Crystal Structure Of P38alpha Y323r Active Mutant Length = 360 Back     alignment and structure
>pdb|3G2F|A Chain A, Crystal Structure Of The Kinase Domain Of Bone Morphogenetic Protein Receptor Type Ii (Bmpr2) At 2.35 A Resolution Length = 336 Back     alignment and structure
>pdb|1BI8|A Chain A, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 326 Back     alignment and structure
>pdb|2BAJ|A Chain A, P38alpha Bound To Pyrazolourea Length = 365 Back     alignment and structure
>pdb|3HRB|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 359 Back     alignment and structure
>pdb|2NPQ|A Chain A, A Novel Lipid Binding Site In The P38 Alpha Map Kinase Length = 367 Back     alignment and structure
>pdb|1DI9|A Chain A, The Structure Of P38 Mitogen-Activated Protein Kinase In Complex With 4-[3-Methylsulfanylanilino]-6,7- Dimethoxyquinazoline Length = 360 Back     alignment and structure
>pdb|3A7F|A Chain A, Human Mst3 Kinase Length = 303 Back     alignment and structure
>pdb|2PZR|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K641r Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|3GCU|A Chain A, Human P38 Map Kinase In Complex With Rl48 Length = 360 Back     alignment and structure
>pdb|2OZA|B Chain B, Structure Of P38alpha Complex Length = 366 Back     alignment and structure
>pdb|1OIR|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-Dependent Kinase Inhibitors Identified Through Structure-Based Hybridisation Length = 299 Back     alignment and structure
>pdb|1H01|A Chain A, Cdk2 In Complex With A Disubstituted 2, 4-Bis Anilino Pyrimidine Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|4I20|A Chain A, Crystal Structure Of Monomeric (v948r) Primary Oncogenic Mutant L858r Egfr Kinase Domain Length = 329 Back     alignment and structure
>pdb|4H1J|A Chain A, Crystal Structure Of Pyk2 With The Pyrazole 13a Length = 293 Back     alignment and structure
>pdb|2LGC|A Chain A, Joint Nmr And X-Ray Refinement Reveals The Structure Of A Novel Dibenzo[a,D]cycloheptenone InhibitorP38 MAP KINASE COMPLEX IN Solution Length = 359 Back     alignment and structure
>pdb|2JGZ|A Chain A, Crystal Structure Of Phospho-Cdk2 In Complex With Cyclin B Length = 289 Back     alignment and structure
>pdb|1JST|A Chain A, Phosphorylated Cyclin-Dependent Kinase-2 Bound To Cyclin A Length = 298 Back     alignment and structure
>pdb|3K3J|A Chain A, P38alpha Bound To Novel Dfg-Out Compound Pf-00416121 Length = 362 Back     alignment and structure
>pdb|1OZ1|A Chain A, P38 Mitogen-Activated Kinase In Complex With 4-Azaindole Inhibitor Length = 372 Back     alignment and structure
>pdb|2GFS|A Chain A, P38 Kinase Crystal Structure In Complex With Ro3201195 Length = 372 Back     alignment and structure
>pdb|3HEC|A Chain A, P38 In Complex With Imatinib Length = 348 Back     alignment and structure
>pdb|3QHR|A Chain A, Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic Length = 298 Back     alignment and structure
>pdb|1BL6|A Chain A, The Complex Structure Of The Map Kinase P38SB216995 Length = 379 Back     alignment and structure
>pdb|3ZSG|A Chain A, X-Ray Structure Of P38alpha Bound To Tak-715 Length = 362 Back     alignment and structure
>pdb|3Q4T|A Chain A, Crystal Structure Of Activin Receptor Type-Iia (Acvr2a) Kinase Domain In Complex With Dorsomorphin Length = 322 Back     alignment and structure
>pdb|3K3I|A Chain A, P38alpha Bound To Novel Dgf-Out Compound Pf-00215955 Length = 350 Back     alignment and structure
>pdb|1H1W|A Chain A, High Resolution Crystal Structure Of The Human Pdk1 Catalytic Domain Length = 289 Back     alignment and structure
>pdb|3S3I|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 349 Back     alignment and structure
>pdb|3MPT|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Pyrrole-2- Carboxamide Inhibitor Length = 371 Back     alignment and structure
>pdb|2ITN|A Chain A, Crystal Structure Of Egfr Kinase Domain G719s Mutation In Complex With Amp-Pnp Length = 327 Back     alignment and structure
>pdb|2Y8O|A Chain A, Crystal Structure Of Human P38alpha Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|3ORX|A Chain A, Pdk1 Mutant Bound To Allosteric Disulfide Fragment Inhibitor 1f8 Length = 316 Back     alignment and structure
>pdb|3D7Z|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|3CC6|A Chain A, Crystal Structure Of Kinase Domain Of Protein Tyrosine Kinase 2 Beta (ptk2b) Length = 281 Back     alignment and structure
>pdb|1ZZL|A Chain A, Crystal Structure Of P38 With Triazolopyridine Length = 351 Back     alignment and structure
>pdb|3KQ7|A Chain A, Structure Of Human P38alpha With N-[4-Methyl-3-(6-{[2-(1- Methylpyrrolidin-2-Yl)ethyl]amino}pyridine-3- Amido)phenyl]- 2-(Morpholin-4-Yl)pyridine-4-Carboxamide Length = 380 Back     alignment and structure
>pdb|2Y4I|C Chain C, Ksr2-Mek1 Heterodimer Length = 395 Back     alignment and structure
>pdb|2EB3|A Chain A, Crystal Structure Of Mutated Egfr Kinase Domain (L858r) In Complex With Amppnp Length = 334 Back     alignment and structure
>pdb|1OVE|A Chain A, The Structure Of P38 Alpha In Complex With A Dihydroquinolinone Length = 366 Back     alignment and structure
>pdb|1M7Q|A Chain A, Crystal Structure Of P38 Map Kinase In Complex With A Dihydroquinazolinone Inhibitor Length = 366 Back     alignment and structure
>pdb|3FZO|A Chain A, Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosine Kinase Length = 277 Back     alignment and structure
>pdb|3DK7|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 277 Back     alignment and structure
>pdb|3DT1|A Chain A, P38 Complexed With A Quinazoline Inhibitor Length = 383 Back     alignment and structure
>pdb|3CKX|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) In Complex With Staurosporine Length = 304 Back     alignment and structure
>pdb|2RFD|A Chain A, Crystal Structure Of The Complex Between The Egfr Kinase Domain And A Mig6 Peptide Length = 324 Back     alignment and structure
>pdb|1UU9|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Bim-3 Length = 286 Back     alignment and structure
>pdb|1JOW|B Chain B, Crystal Structure Of A Complex Of Human Cdk6 And A Viral Cyclin Length = 308 Back     alignment and structure
>pdb|3NUP|A Chain A, Cdk6 (Monomeric) In Complex With Inhibitor Length = 307 Back     alignment and structure
>pdb|4EWQ|A Chain A, Human P38 Alpha Mapk In Complex With A Pyridazine Based Inhibitor Length = 383 Back     alignment and structure
>pdb|1IAN|A Chain A, Human P38 Map Kinase Inhibitor Complex Length = 366 Back     alignment and structure
>pdb|3DK3|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|3ZHP|C Chain C, Human Mst3 (stk24) In Complex With Mo25beta Length = 294 Back     alignment and structure
>pdb|3CKW|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) Length = 304 Back     alignment and structure
>pdb|3COM|A Chain A, Crystal Structure Of Mst1 Kinase Length = 314 Back     alignment and structure
>pdb|3CD3|A Chain A, Crystal Structure Of Phosphorylated Human Feline Sarcoma Viral Oncogene Homologue (V-Fes) In Complex With Staurosporine And A Consensus Peptide Length = 377 Back     alignment and structure
>pdb|2ITT|A Chain A, Crystal Structure Of Egfr Kinase Domain L858r Mutation In Complex With Aee788 Length = 327 Back     alignment and structure
>pdb|1Z5M|A Chain A, Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrrolidinylcarbonyl) Amino]phenyl]amino]-4-pyrimidinyl]amino]propyl]-2,2- Dimethylpropanediamide Complexed With Human Pdk1 Length = 286 Back     alignment and structure
>pdb|4HVD|A Chain A, Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h-pyrrolo[2,3- B]pyrazine-7-carboxylic Acid ((s)-1,2,2-trimethyl-propyl)-amide Length = 314 Back     alignment and structure
>pdb|3NUS|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fragment8 Length = 286 Back     alignment and structure
>pdb|2R7B|A Chain A, Crystal Structure Of The Phosphoinositide-Dependent Kinase- 1 (Pdk-1)catalytic Domain Bound To A Dibenzonaphthyridine Inhibitor Length = 312 Back     alignment and structure
>pdb|3PJC|A Chain A, Crystal Structure Of Jak3 Complexed With A Potent Atp Site Inhibitor Showing High Selectivity Within The Janus Kinase Family Length = 315 Back     alignment and structure
>pdb|4AN2|A Chain A, Crystal Structures Of Human Mek1 With Carboxamide-Based Allosteric Inhibitor Xl518 (Gdc-0973), Or Related Analogs. Length = 301 Back     alignment and structure
>pdb|3NNX|A Chain A, Crystal Structure Of Phosphorylated P38 Alpha In Complex With Dp802 Length = 354 Back     alignment and structure
>pdb|3H9O|A Chain A, Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) In Complex With Compound 9 Length = 311 Back     alignment and structure
>pdb|3BKB|A Chain A, Crystal Structure Of Human Feline Sarcoma Viral Oncogene Homologue (V- Fes) Length = 377 Back     alignment and structure
>pdb|3LXK|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 327 Back     alignment and structure
>pdb|3IOP|A Chain A, Pdk-1 In Complex With The Inhibitor Compound-8i Length = 312 Back     alignment and structure
>pdb|2Q0B|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565a Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2P55|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Complex With Ligand And Mgatp Length = 333 Back     alignment and structure
>pdb|3W2O|A Chain A, Egfr Kinase Domain T790m/l858r Mutant With Tak-285 Length = 331 Back     alignment and structure
>pdb|3MH2|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|3FI4|A Chain A, P38 Kinase Crystal Structure In Complex With Ro4499 Length = 372 Back     alignment and structure
>pdb|2GHL|A Chain A, Mutant Mus Musculus P38 Kinase Domain In Complex With Inhibitor Pg-874743 Length = 348 Back     alignment and structure
>pdb|1S9J|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Complex With Ligand And Mgatp Length = 341 Back     alignment and structure
>pdb|3QC4|A Chain A, Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 314 Back     alignment and structure
>pdb|1YWR|A Chain A, Crystal Structure Analysis Of Inactive P38 Kinase Domain In Complex With A Monocyclic Pyrazolone Inhibitor Length = 360 Back     alignment and structure
>pdb|3PY3|A Chain A, Crystal Structure Of Phosphorylated P38alpha Map Kinase Length = 380 Back     alignment and structure
>pdb|3DFA|A Chain A, Crystal Structure Of Kinase Domain Of Calcium-dependent Protein Kinase Cgd3_920 From Cryptosporidium Parvum Length = 286 Back     alignment and structure
>pdb|1YW2|A Chain A, Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 Back     alignment and structure
>pdb|2XCH|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|1UU3|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Ly333531 Length = 310 Back     alignment and structure
>pdb|3SC1|A Chain A, Novel Isoquinolone Pdk1 Inhibitors Discovered Through Fragment-Based Lead Discovery Length = 311 Back     alignment and structure
>pdb|2WEI|A Chain A, Crystal Structure Of The Kinase Domain Of Cryptosporidium Parvum Calcium Dependent Protein Kinase In Complex With 3- Mb-Pp1 Length = 287 Back     alignment and structure
>pdb|3RWP|A Chain A, Discovery Of A Novel, Potent And Selective Inhibitor Of 3- Phosphoinositide Dependent Kinase (Pdk1) Length = 311 Back     alignment and structure
>pdb|3HRC|A Chain A, Crystal Structure Of A Mutant Of Human Pdk1 Kinase Domain In Complex With Atp Length = 311 Back     alignment and structure
>pdb|2BIY|A Chain A, Structure Of Pdk1-S241a Mutant Kinase Domain Length = 310 Back     alignment and structure
>pdb|4A07|A Chain A, Human Pdk1 Kinase Domain In Complex With Allosteric Activator Ps171 Bound To The Pif-Pocket Length = 311 Back     alignment and structure
>pdb|3GCP|A Chain A, Human P38 Map Kinase In Complex With Sb203580 Length = 360 Back     alignment and structure
>pdb|2PY3|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565g Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|4FIE|A Chain A, Full-Length Human Pak4 Length = 423 Back     alignment and structure
>pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 Back     alignment and structure
>pdb|3PWY|A Chain A, Crystal Structure Of An Extender (Spd28345)-Modified Human Pdk1 Complex 2 Length = 311 Back     alignment and structure
>pdb|3MBL|A Chain A, Crystal Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek 1) In Complex With Ligand And Mgadp Length = 328 Back     alignment and structure
>pdb|3DV3|A Chain A, Mek1 With Pf-04622664 Bound Length = 322 Back     alignment and structure
>pdb|3QC9|A Chain A, Crystal Structure Of Cross-Linked Bovine Grk1 T8cN480C DOUBLE MUTANT Complexed With Adp And Mg Length = 543 Back     alignment and structure
>pdb|3C4W|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.7a Length = 543 Back     alignment and structure
>pdb|3C4X|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.9a Length = 543 Back     alignment and structure
>pdb|3NUN|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lead Compound Length = 292 Back     alignment and structure
>pdb|1YVJ|A Chain A, Crystal Structure Of The Jak3 Kinase Domain In Complex With A Staurosporine Analogue Length = 290 Back     alignment and structure
>pdb|2JFM|A Chain A, Crystal Structure Of Human Ste20-Like Kinase (Unliganded Form) Length = 325 Back     alignment and structure
>pdb|2J51|A Chain A, Crystal Structure Of Human Ste20-Like Kinase Bound To 5- Amino-3-((4-(Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2,4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 Back     alignment and structure
>pdb|3T8O|A Chain A, Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolution Length = 543 Back     alignment and structure
>pdb|3EQC|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Ternary Complex With Compound 1, Atp-Gs And Mg2p Length = 360 Back     alignment and structure
>pdb|3NAX|A Chain A, Pdk1 In Complex With Inhibitor Mp7 Length = 311 Back     alignment and structure
>pdb|3GGF|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase Mst4 In Complex With An Quinazolin Length = 301 Back     alignment and structure
>pdb|4APC|A Chain A, Crystal Structure Of Human Nima-Related Kinase 1 (Nek1) Length = 350 Back     alignment and structure
>pdb|4G31|A Chain A, Crystal Structure Of Gsk6414 Bound To Perk (R587-R1092, Delete A660- T867) At 2.28 A Resolution Length = 299 Back     alignment and structure
>pdb|3GI3|A Chain A, Crystal Structure Of A N-Phenyl-N'-Naphthylurea Analog In Complex With P38 Map Kinase Length = 360 Back     alignment and structure
>pdb|3NAY|A Chain A, Pdk1 In Complex With Inhibitor Mp6 Length = 311 Back     alignment and structure
>pdb|3FI3|A Chain A, Crystal Structure Of Jnk3 With Indazole Inhibitor, Sr-3737 Length = 364 Back     alignment and structure
>pdb|2JFL|A Chain A, Crystal Structure Of Human Ste20-Like Kinase ( Diphosphorylated Form) Bound To 5- Amino-3-((4-( Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2, 4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|4EOM|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|4EOJ|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With Atp Length = 302 Back     alignment and structure
>pdb|2HAK|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark1PAR-1 Length = 328 Back     alignment and structure
>pdb|2XCK|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|3VUL|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|4EON|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|4EOK|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With The Inhibitor Nu6102 Length = 300 Back     alignment and structure
>pdb|3O8P|A Chain A, Conformational Plasticity Of P38 Map Kinase Dfg Motif Mutants In Response To Inhibitor Binding Length = 360 Back     alignment and structure
>pdb|1PME|A Chain A, Structure Of Penta Mutant Human Erk2 Map Kinase Complexed With A Specific Inhibitor Of Human P38 Map Kinase Length = 380 Back     alignment and structure
>pdb|3TTJ|A Chain A, Crystal Structure Of Jnk3 Complexed With Cc-359, A Jnk Inhibitor For The Prevention Of Ischemia-Reperfusion Injury Length = 464 Back     alignment and structure
>pdb|3VUM|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M7 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|4FIF|A Chain A, Catalytic Domain Of Human Pak4 With Rpkplvdp Peptide Length = 346 Back     alignment and structure
>pdb|1FOT|A Chain A, Structure Of The Unliganded Camp-Dependent Protein Kinase Catalytic Subunit From Saccharomyces Cerevisiae Length = 318 Back     alignment and structure
>pdb|2X7F|A Chain A, Crystal Structure Of The Kinase Domain Of Human Traf2- And Nck-Interacting Kinase With Wee1chk1 Inhibitor Length = 326 Back     alignment and structure
>pdb|4BC6|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Novel Bosutinib Isoform 1, Previously Thought To Be Bosutinib Length = 293 Back     alignment and structure
>pdb|3SLS|A Chain A, Crystal Structure Of Human Mek-1 Kinase In Complex With Ucb1353770 And Amppnp Length = 304 Back     alignment and structure
>pdb|2IW8|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82h-L83v- H84d Mutant With An O6-Cyclohexylmethylguanine Inhibitor Length = 302 Back     alignment and structure
>pdb|2CDZ|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Cgp74514a Length = 303 Back     alignment and structure
>pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 Back     alignment and structure
>pdb|3KVX|A Chain A, Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Length = 364 Back     alignment and structure
>pdb|1U59|A Chain A, Crystal Structure Of The Zap-70 Kinase Domain In Complex With Staurosporine Length = 287 Back     alignment and structure
>pdb|2Q0N|A Chain A, Structure Of Human P21 Activating Kinase 4 (Pak4) In Complex With A Consensus Peptide Length = 301 Back     alignment and structure
>pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 Back     alignment and structure
>pdb|3MH0|A Chain A, Mutagenesis Of P38 Map Kinase Eshtablishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|2J7T|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Su11274 Length = 302 Back     alignment and structure
>pdb|2R9S|A Chain A, C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Quinoline Inhibitor Length = 356 Back     alignment and structure
>pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 Back     alignment and structure
>pdb|3MH3|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|1JNK|A Chain A, The C-Jun N-Terminal Kinase (Jnk3s) Complexed With Mgamp-Pnp Length = 423 Back     alignment and structure
>pdb|2OZO|A Chain A, Autoinhibited Intact Human Zap-70 Length = 613 Back     alignment and structure
>pdb|2R0I|A Chain A, Crystal Structure Of A Kinase Mark2PAR-1 Mutant Length = 327 Back     alignment and structure
>pdb|3FI2|A Chain A, Crystal Structure Of Jnk3 With Amino-Pyrazole Inhibitor, Sr- 3451 Length = 353 Back     alignment and structure
>pdb|2X4Z|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Pf-03758309 Length = 296 Back     alignment and structure
>pdb|3FV8|A Chain A, Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Length = 355 Back     alignment and structure
>pdb|1ZMU|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Wild Type Length = 327 Back     alignment and structure
>pdb|2BVA|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 Length = 292 Back     alignment and structure
>pdb|3MH1|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|1B6C|B Chain B, Crystal Structure Of The Cytoplasmic Domain Of The Type I Tgf-Beta Receptor In Complex With Fkbp12 Length = 342 Back     alignment and structure
>pdb|1H4L|A Chain A, Structure And Regulation Of The Cdk5-P25(Nck5a) Complex Length = 292 Back     alignment and structure
>pdb|3OXI|A Chain A, Design And Synthesis Of Disubstituted Thiophene And Thiazole Based Inhibitors Of Jnk For The Treatment Of Neurodegenerative Diseases Length = 362 Back     alignment and structure
>pdb|1UA2|A Chain A, Crystal Structure Of Human Cdk7 Length = 346 Back     alignment and structure
>pdb|3PTG|A Chain A, Design And Synthesis Of A Novel, Orally Efficacious Tri-Substituted Thiophene Based Jnk Inhibitor Length = 363 Back     alignment and structure
>pdb|2O0U|A Chain A, Crystal Structure Of Human Jnk3 Complexed With N-{3-Cyano-6-[3-(1- Piperidinyl)propanoyl]-4,5,6,7-Tetrahydrothieno[2, 3-C]pyridin-2-Yl}- 1-Naphthalenecarboxamide Length = 364 Back     alignment and structure
>pdb|1PMN|A Chain A, Crystal Structure Of Jnk3 In Complex With An Imidazole- Pyrimidine Inhibitor Length = 364 Back     alignment and structure
>pdb|1RW8|A Chain A, Crystal Structure Of Tgf-Beta Receptor I Kinase With Atp Site Inhibitor Length = 301 Back     alignment and structure
>pdb|2QNJ|A Chain A, Kinase And Ubiquitin-Associated Domains Of Mark3PAR-1 Length = 328 Back     alignment and structure
>pdb|1PY5|A Chain A, Crystal Structure Of Tgf-Beta Receptor I Kinase With Inhibitor Length = 326 Back     alignment and structure
>pdb|2B1P|A Chain A, Inhibitor Complex Of Jnk3 Length = 355 Back     alignment and structure
>pdb|3TZM|A Chain A, Tgf-Beta Receptor Type 1 In Complex With Sb431542 Length = 309 Back     alignment and structure
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure
>pdb|4H36|A Chain A, Crystal Structure Of Jnk3 In Complex With Atf2 Peptide Length = 356 Back     alignment and structure
>pdb|2OK1|A Chain A, Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3- Chlorophenyl)-1h-Pyrazol-3-Yl)-1h-Pyrrole-2-Carboxamide Length = 365 Back     alignment and structure
>pdb|2WOT|A Chain A, Alk5 In Complex With 4-((5,6-Dimethyl-2-(2-Pyridyl)-3- Pyridyl)oxy)-N-(3,4,5-Trimethoxyphenyl)pyridin-2-Amine Length = 306 Back     alignment and structure
>pdb|3D5W|A Chain A, Crystal Structure Of A Phosphorylated Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Adp Length = 317 Back     alignment and structure
>pdb|2EXC|X Chain X, Inhibitor Complex Of Jnk3 Length = 356 Back     alignment and structure
>pdb|4AAA|A Chain A, Crystal Structure Of The Human Cdkl2 Kinase Domain Length = 331 Back     alignment and structure
>pdb|3D5V|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain. Length = 317 Back     alignment and structure
>pdb|3G51|A Chain A, Structural Diversity Of The Active Conformation Of The N- Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 Length = 325 Back     alignment and structure
>pdb|3D5U|A Chain A, Crystal Structure Of A Wildtype Polo-Like Kinase 1 (Plk1) Catalytic Domain Length = 317 Back     alignment and structure
>pdb|2DYL|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 7 Activated Mutant (S287d, T291d) Length = 318 Back     alignment and structure
>pdb|2WZJ|A Chain A, Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82r, T208e Double Mutant Length = 327 Back     alignment and structure
>pdb|1VJY|A Chain A, Crystal Structure Of A Naphthyridine Inhibitor Of Human Tgf- Beta Type I Receptor Length = 303 Back     alignment and structure
>pdb|1ZMW|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: T208aS212A INACTIVE DOUBLE MUTANT Length = 327 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure
>pdb|1U5Q|A Chain A, Crystal Structure Of The Tao2 Kinase Domain: Activation And Specifity Of A Ste20p Map3k Length = 348 Back     alignment and structure
>pdb|1ZMV|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: K82r Mutant Length = 327 Back     alignment and structure
>pdb|3VUK|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M5 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|1UKH|A Chain A, Structural Basis For The Selective Inhibition Of Jnk1 By The Scaffolding Protein Jip1 And Sp600125 Length = 369 Back     alignment and structure
>pdb|1YHV|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Two Point Mutations (K299r, T423e) Length = 297 Back     alignment and structure
>pdb|2CLQ|A Chain A, Structure Of Mitogen-Activated Protein Kinase Kinase Kinase 5 Length = 295 Back     alignment and structure
>pdb|3VUI|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VUG|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3DB6|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Compound 902 Length = 301 Back     alignment and structure
>pdb|4FL3|A Chain A, Structural And Biophysical Characterization Of The Syk Activation Switch Length = 635 Back     alignment and structure
>pdb|2XRW|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 371 Back     alignment and structure
>pdb|3IEC|A Chain A, Helicobacter Pylori Caga Inhibits Par1MARK FAMILY KINASES BY Mimicking Host Substrates Length = 319 Back     alignment and structure
>pdb|3UBD|A Chain A, Structure Of N-Terminal Domain Of Rsk2 Kinase In Complex With Flavonoid Glycoside Sl0101 Length = 304 Back     alignment and structure
>pdb|3VUD|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|4EL9|A Chain A, Structure Of N-Terminal Kinase Domain Of Rsk2 With Afzelin Length = 305 Back     alignment and structure
>pdb|3FE3|A Chain A, Crystal Structure Of The Kinase Mark3PAR-1: T211a-S215a Double Mutant Length = 328 Back     alignment and structure
>pdb|3V3V|A Chain A, Structural And Functional Analysis Of Quercetagetin, A Natural Jnk1 Inhibitor Length = 379 Back     alignment and structure
>pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 Back     alignment and structure
>pdb|3VUH|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M3 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|2GCD|A Chain A, Tao2 Kinase Domain-Staurosporine Structure Length = 309 Back     alignment and structure
>pdb|4FL2|A Chain A, Structural And Biophysical Characterization Of The Syk Activation Switch Length = 636 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|3Q52|A Chain A, Structure Of Phosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|3NPC|A Chain A, Crystal Structure Of Jnk2 Complexed With Birb796 Length = 364 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|3FXZ|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Ruthenium Complex Lambda-Fl172 Length = 297 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|3LMG|A Chain A, Crystal Structure Of The Erbb3 Kinase Domain In Complex With Amp-Pnp Length = 344 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|3KEX|A Chain A, Crystal Structure Of The Catalytically Inactive Kinase Domain Of The Human Epidermal Growth Factor Receptor 3 (Her3) Length = 325 Back     alignment and structure
>pdb|4IC7|A Chain A, Crystal Structure Of The Erk5 Kinase Domain In Complex With An Mkk5 Binding Fragment Length = 442 Back     alignment and structure
>pdb|1F3M|C Chain C, Crystal Structure Of Human SerineTHREONINE KINASE PAK1 Length = 297 Back     alignment and structure
>pdb|1Y8G|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Inactive Double Mutant With Selenomethionine Length = 327 Back     alignment and structure
>pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 Back     alignment and structure
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure
>pdb|3GC9|A Chain A, The Structure Of P38beta C119s, C162s In Complex With A Dihydroquinazolinone Inhibitor Length = 370 Back     alignment and structure
>pdb|3VW6|A Chain A, Crystal Structure Of Human Apoptosis Signal-Regulating Kinase 1 (Ask1) With Imidazopyridine Inhibitor Length = 269 Back     alignment and structure
>pdb|3A62|A Chain A, Crystal Structure Of Phosphorylated P70s6k1 Length = 327 Back     alignment and structure
>pdb|3NYN|A Chain A, Crystal Structure Of G Protein-Coupled Receptor Kinase 6 In Complex With Sangivamycin Length = 576 Back     alignment and structure
>pdb|3HKO|A Chain A, Crystal Structure Of A Cdpk Kinase Domain From Cryptosporidium Parvum, Cgd7_40 Length = 345 Back     alignment and structure
>pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 Back     alignment and structure
>pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 Back     alignment and structure
>pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 Back     alignment and structure
>pdb|2ACX|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 6 Bound To Amppnp Length = 576 Back     alignment and structure
>pdb|3A60|A Chain A, Crystal Structure Of Unphosphorylated P70s6k1 (Form I) Length = 327 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|2XS0|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 386 Back     alignment and structure
>pdb|1UNG|A Chain A, Structural Mechanism For The Inhibition Of Cdk5-P25 By Roscovitine, Aloisine And Indirubin. Length = 292 Back     alignment and structure
>pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 Back     alignment and structure
>pdb|2A19|B Chain B, Pkr Kinase Domain- Eif2alpha- Amp-Pnp Complex. Length = 284 Back     alignment and structure
>pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 Back     alignment and structure
>pdb|2R0U|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 54 Length = 323 Back     alignment and structure
>pdb|3QUP|A Chain A, Inhibitor Bound Structure Of The Kinase Domain Of The Murine Receptor Tyrosine Kinase Tyro3 (Sky) Length = 323 Back     alignment and structure
>pdb|2HOG|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 20 Length = 322 Back     alignment and structure
>pdb|3GP0|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 11 (p38 Beta) In Complex With Nilotinib Length = 348 Back     alignment and structure
>pdb|2C30|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 6 Length = 321 Back     alignment and structure
>pdb|2YDJ|A Chain A, Discovery Of Checkpoint Kinase Inhibitor Azd7762 By Structure Based Design And Optimization Of Thiophene Carboxamide Ureas Length = 276 Back     alignment and structure
>pdb|4FSY|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|3SRV|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase (Syk) In Complex With A Diaminopyrimidine Carboxamide Inhibitor Length = 277 Back     alignment and structure
>pdb|3E7O|A Chain A, Crystal Structure Of Jnk2 Length = 360 Back     alignment and structure
>pdb|4FSZ|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 Back     alignment and structure
>pdb|4B99|A Chain A, Crystal Structure Of Mapk7 (Erk5) With Inhibitor Length = 398 Back     alignment and structure
>pdb|2BR1|A Chain A, Structure-Based Design Of Novel Chk1 Inhibitors: Insights Into Hydrogen Bonding And Protein-Ligand Affinity Length = 297 Back     alignment and structure
>pdb|1IA8|A Chain A, The 1.7 A Crystal Structure Of Human Cell Cycle Checkpoint Kinase Chk1 Length = 289 Back     alignment and structure
>pdb|3TUB|A Chain A, Crystal Structure Of Syk Kinase Domain With 1-(5-(6,7- Dimethoxyquinolin-4-Yloxy)pyridin-2-Yl)-3-((1r,2s)-2- Phenylcyclopropyl)urea Length = 293 Back     alignment and structure
>pdb|3VF8|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase Syk Catalytic Domain With Pyrazolylbenzimidazole Inhibitor 416 Length = 299 Back     alignment and structure
>pdb|1ZLT|A Chain A, Crystal Structure Of Chk1 Complexed With A Hymenaldisine Analog Length = 295 Back     alignment and structure
>pdb|1XBA|A Chain A, Crystal Structure Of Apo Syk Tyrosine Kinase Domain Length = 291 Back     alignment and structure
>pdb|4F4P|A Chain A, Syk In Complex With Ligand Lasw836 Length = 273 Back     alignment and structure
>pdb|3EMG|A Chain A, Discovery And Sar Of Novel 4-Thiazolyl-2- Phenylaminopyrimidines As Potent Inhibitors Of Spleen Tyrosine Kinase (Syk) Length = 291 Back     alignment and structure
>pdb|3SRV|B Chain B, Crystal Structure Of Spleen Tyrosine Kinase (Syk) In Complex With A Diaminopyrimidine Carboxamide Inhibitor Length = 277 Back     alignment and structure
>pdb|4DFL|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase Complexed With A Sulfonamidopyrazine Piperidine Inhibitor Length = 274 Back     alignment and structure
>pdb|3ELJ|A Chain A, Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine Inhibitor Length = 369 Back     alignment and structure
>pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 Back     alignment and structure
>pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 Back     alignment and structure
>pdb|3GC8|A Chain A, The Structure Of P38beta C162s In Complex With A Dihydroquinazolinone Length = 370 Back     alignment and structure
>pdb|3PZE|A Chain A, Jnk1 In Complex With Inhibitor Length = 358 Back     alignment and structure
>pdb|2ZOQ|A Chain A, Structural Dissection Of Human Mitogen-Activated Kinase Erk1 Length = 382 Back     alignment and structure
>pdb|2X8E|A Chain A, Discovery Of A Novel Class Of Triazolones As Checkpoint Kinase Inhibitors - Hit To Lead Exploration Length = 276 Back     alignment and structure
>pdb|4FSN|A Chain A, Crystal Structure Of The Chk1 Length = 278 Back     alignment and structure
>pdb|3UIU|A Chain A, Crystal Structure Of Apo-Pkr Kinase Domain Length = 306 Back     alignment and structure
>pdb|2V5Q|A Chain A, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 315 Back     alignment and structure
>pdb|1ZYS|A Chain A, Co-Crystal Structure Of Checkpoint Kinase Chk1 With A Pyrrolo-Pyridine Inhibitor Length = 273 Back     alignment and structure
>pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 Back     alignment and structure
>pdb|4FSM|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 Back     alignment and structure
>pdb|4FSW|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|2Y94|A Chain A, Structure Of An Active Form Of Mammalian Ampk Length = 476 Back     alignment and structure
>pdb|4FT3|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|3Q4Z|A Chain A, Structure Of Unphosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|2E9V|A Chain A, Structure Of H-Chk1 Complexed With A859017 Length = 268 Back     alignment and structure
>pdb|4FV6|A Chain A, Crystal Structure Of The Erk2 Complexed With E57 Length = 360 Back     alignment and structure
>pdb|2Y9Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|4FUX|A Chain A, Crystal Structure Of The Erk2 Complexed With E75 Length = 360 Back     alignment and structure
>pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 Back     alignment and structure
>pdb|3OT3|A Chain A, X-Ray Crystal Structure Of Compound 22k Bound To Human Chk1 Kinase Domain Length = 273 Back     alignment and structure
>pdb|2AYP|A Chain A, Crystal Structure Of Chk1 With An Indol Inhibitor Length = 269 Back     alignment and structure
>pdb|3KB7|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 311 Back     alignment and structure
>pdb|2GHG|A Chain A, H-Chk1 Complexed With A431994 Length = 269 Back     alignment and structure
>pdb|2YAC|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With Nms-P937 Length = 311 Back     alignment and structure
>pdb|4FV7|A Chain A, Crystal Structure Of The Erk2 Complexed With E94 Length = 360 Back     alignment and structure
>pdb|1GOL|A Chain A, Coordinates Of Rat Map Kinase Erk2 With An Arginine Mutation At Position 52 Length = 364 Back     alignment and structure
>pdb|2GPH|A Chain A, Docking Motif Interactions In The Map Kinase Erk2 Length = 364 Back     alignment and structure
>pdb|3JVR|A Chain A, Characterization Of The Chk1 Allosteric Inhibitor Binding Site Length = 271 Back     alignment and structure
>pdb|4GSB|A Chain A, Monoclinic Crystal Form Of The Apo-Erk2 Length = 364 Back     alignment and structure
>pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 Back     alignment and structure
>pdb|2OJG|A Chain A, Crystal Structure Of Erk2 In Complex With N,n-dimethyl-4-(4- Phenyl-1h-pyrazol-3-yl)-1h-pyrrole-2-carboxamide Length = 380 Back     alignment and structure
>pdb|4FST|A Chain A, Crystal Structure Of The Chk1 Length = 269 Back     alignment and structure
>pdb|3ZU7|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 365 Back     alignment and structure
>pdb|2Z7L|A Chain A, Unphosphorylated Mitogen Activated Protein Kinase Erk2 In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin 2-Yl]amino}phenyl)acetic Acid Length = 366 Back     alignment and structure
>pdb|3C9W|A Chain A, Crystal Structure Of Erk-2 With Hypothemycin Covalently Bound Length = 357 Back     alignment and structure
>pdb|2FYS|B Chain B, Crystal Structure Of Erk2 Complex With Kim Peptide Derived From Mkp3 Length = 364 Back     alignment and structure
>pdb|3QYW|A Chain A, Crystal Structure Of Erk2 In Complex With An Inhibitor Length = 364 Back     alignment and structure
>pdb|3O71|A Chain A, Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length = 358 Back     alignment and structure
>pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 Back     alignment and structure
>pdb|3ALN|A Chain A, Crystal Structure Of Human Non-Phosphorylated Mkk4 Kinase Domain Complexed With Amp-Pnp Length = 327 Back     alignment and structure
>pdb|3SA0|A Chain A, Complex Of Erk2 With Norathyriol Length = 360 Back     alignment and structure
>pdb|1WZY|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Pyrazolopyridazine Derivative Length = 368 Back     alignment and structure
>pdb|1TVO|A Chain A, The Structure Of Erk2 In Complex With A Small Molecule Inhibitor Length = 368 Back     alignment and structure
>pdb|3R63|A Chain A, Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 Back     alignment and structure
>pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 Back     alignment and structure
>pdb|2OU7|A Chain A, Structure Of The Catalytic Domain Of Human Polo-Like Kinase 1 Length = 335 Back     alignment and structure
>pdb|2HW6|A Chain A, Crystal Structure Of Mnk1 Catalytic Domain Length = 307 Back     alignment and structure
>pdb|3THB|A Chain A, Structure Of Plk1 Kinase Domain In Complex With A Benzolactam-Derived Inhibitor Length = 333 Back     alignment and structure
>pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 Back     alignment and structure
>pdb|1ZY4|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: R794g Hyperactivating Mutant In Apo Form. Length = 303 Back     alignment and structure
>pdb|3DXN|A Chain A, Crystal Structure Of The Calcium-dependent Kinase From Toxoplasma Gondii, 541.m00134, Kinase Domain Length = 287 Back     alignment and structure
>pdb|2RKU|A Chain A, Structure Of Plk1 In Complex With Bi2536 Length = 294 Back     alignment and structure
>pdb|3O17|A Chain A, Crystal Structure Of Jnk1-Alpha1 Isoform Length = 370 Back     alignment and structure
>pdb|2BDW|A Chain A, Crystal Structure Of The Auto-Inhibited Kinase Domain Of CalciumCALMODULIN ACTIVATED KINASE II Length = 362 Back     alignment and structure
>pdb|4FSU|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|3TXO|A Chain A, Pkc Eta Kinase In Complex With A Naphthyridine Length = 353 Back     alignment and structure
>pdb|2X4F|A Chain A, The Crystal Structure Of The Human Myosin Light Chain Kinase Loc340156. Length = 373 Back     alignment and structure
>pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 Back     alignment and structure
>pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 Back     alignment and structure
>pdb|3OZ6|A Chain A, Crystal Structure Of Mapk From Cryptosporidium Parvum, Cgd2_1960 Length = 388 Back     alignment and structure
>pdb|2G01|A Chain A, Pyrazoloquinolones As Novel, Selective Jnk1 Inhibitors Length = 370 Back     alignment and structure
>pdb|3ZUV|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 364 Back     alignment and structure
>pdb|2ERK|A Chain A, Phosphorylated Map Kinase Erk2 Length = 365 Back     alignment and structure
>pdb|2W96|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|3TEI|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|2W99|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|2VRX|A Chain A, Structure Of Aurora B Kinase In Complex With Zm447439 Length = 285 Back     alignment and structure
>pdb|4FR4|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase 32a (Yank1) Length = 384 Back     alignment and structure
>pdb|3G33|A Chain A, Crystal Structure Of Cdk4CYCLIN D3 Length = 308 Back     alignment and structure
>pdb|3CIK|A Chain A, Human Grk2 In Complex With Gbetagamma Subunits Length = 689 Back     alignment and structure
>pdb|3KRW|A Chain A, Human Grk2 In Complex With Gbetgamma Subunits And Balanol (Soak) Length = 688 Back     alignment and structure
>pdb|2BFY|A Chain A, Complex Of Aurora-B With Incenp And Hesperidin. Length = 284 Back     alignment and structure
>pdb|2AC5|A Chain A, Structure Of Human Mnk2 Kinase Domain Mutant D228g Length = 316 Back     alignment and structure
>pdb|3Q5I|A Chain A, Crystal Structure Of Pbanka_031420 Length = 504 Back     alignment and structure
>pdb|1OMW|A Chain A, Crystal Structure Of The Complex Between G Protein-Coupled Receptor Kinase 2 And Heterotrimeric G Protein Beta 1 And Gamma 2 Subunits Length = 689 Back     alignment and structure
>pdb|4EJN|A Chain A, Crystal Structure Of Autoinhibited Form Of Akt1 In Complex With N-(4- (5-(3-Acetamidophenyl)-2-(2-Aminopyridin-3-Yl)-3h- Imidazo[4,5- B]pyridin-3-Yl)benzyl)-3-Fluorobenzamide Length = 446 Back     alignment and structure
>pdb|3PSC|A Chain A, Bovine Grk2 In Complex With Gbetagamma Subunits Length = 695 Back     alignment and structure
>pdb|4H3Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|4FVP|A Chain A, Crystal Structure Of The Jak2 Pseudokinase Domain (Apo Form) Length = 289 Back     alignment and structure
>pdb|3O96|A Chain A, Crystal Structure Of Human Akt1 With An Allosteric Inhibitor Length = 446 Back     alignment and structure
>pdb|2W9F|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 Back     alignment and structure
>pdb|2F9G|A Chain A, Crystal Structure Of Fus3 Phosphorylated On Tyr182 Length = 353 Back     alignment and structure
>pdb|2B9F|A Chain A, Crystal Structure Of Non-Phosphorylated Fus3 Length = 353 Back     alignment and structure
>pdb|3CQU|A Chain A, Crystal Structure Of Akt-1 Complexed With Substrate Peptide And Inhibitor Length = 342 Back     alignment and structure
>pdb|1ZYC|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: Wild- Type In Apo Form. Length = 303 Back     alignment and structure
>pdb|3MY0|A Chain A, Crystal Structure Of The Acvrl1 (Alk1) Kinase Domain Bound To Ldn- 193189 Length = 305 Back     alignment and structure
>pdb|4GV1|A Chain A, Pkb Alpha In Complex With Azd5363 Length = 340 Back     alignment and structure
>pdb|3OCB|A Chain A, Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor Length = 341 Back     alignment and structure
>pdb|4FVR|A Chain A, Crystal Structure Of The Jak2 Pseudokinase Domain Mutant V617f (Mg- Atp-Bound Form) Length = 289 Back     alignment and structure
>pdb|1PYX|A Chain A, Gsk-3 Beta Complexed With Amp-Pnp Length = 422 Back     alignment and structure
>pdb|1YRP|A Chain A, Catalytic Domain Of Human Zip Kinase Phosphorylated At Thr265 Length = 278 Back     alignment and structure
>pdb|3MN3|A Chain A, An Inhibited Conformation For The Protein Kinase Domain Of The Saccharomyces Cerevisiae Ampk Homolog Snf1 Length = 271 Back     alignment and structure
>pdb|1Q3D|A Chain A, Gsk-3 Beta Complexed With Staurosporine Length = 424 Back     alignment and structure
>pdb|1I09|A Chain A, Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Length = 420 Back     alignment and structure
>pdb|1Q5K|A Chain A, Crystal Structure Of Glycogen Synthase Kinase 3 In Complexed With Inhibitor Length = 414 Back     alignment and structure
>pdb|3VID|A Chain A, Crystal Structure Of Human Vegfr2 Kinase Domain With Compound A Length = 356 Back     alignment and structure
>pdb|3VHE|A Chain A, Crystal Structure Of Human Vegfr2 Kinase Domain With A Novel Pyrrolopyrimidine Inhibitor Length = 359 Back     alignment and structure
>pdb|2B9H|A Chain A, Crystal Structure Of Fus3 With A Docking Motif From Ste7 Length = 353 Back     alignment and structure
>pdb|2JED|A Chain A, The Crystal Structure Of The Kinase Domain Of The Protein Kinase C Theta In Complex With Nvp-Xaa228 At 2.32a Resolution. Length = 352 Back     alignment and structure
>pdb|3SAY|A Chain A, Crystal Structure Of Human Glycogen Synthase Kinase 3 Beta (Gsk3b) In Complex With Inhibitor 142 Length = 430 Back     alignment and structure
>pdb|3IW4|A Chain A, Crystal Structure Of Pkc Alpha In Complex With Nvp-Aeb071 Length = 360 Back     alignment and structure
>pdb|3VN9|A Chain A, Rifined Crystal Structure Of Non-Phosphorylated Map2k6 In A Putative Auto-Inhibition State Length = 340 Back     alignment and structure
>pdb|3DAE|A Chain A, Crystal Structure Of Phosphorylated Snf1 Kinase Domain Length = 283 Back     alignment and structure
>pdb|2FH9|A Chain A, Structure And Dimerization Of The Kinase Domain From Yeast Snf1 Length = 274 Back     alignment and structure
>pdb|4ACC|A Chain A, Gsk3b In Complex With Inhibitor Length = 465 Back     alignment and structure
>pdb|3HYH|A Chain A, Crystal Structure Of The Protein Kinase Domain Of Yeast Amp-Activated Protein Kinase Snf1 Length = 275 Back     alignment and structure
>pdb|1CM8|A Chain A, Phosphorylated Map Kinase P38-Gamma Length = 367 Back     alignment and structure
>pdb|2AC3|A Chain A, Structure Of Human Mnk2 Kinase Domain Length = 316 Back     alignment and structure
>pdb|2I6L|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 6 (Mapk6) Length = 320 Back     alignment and structure
>pdb|1R0E|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With 3-Indolyl-4- Arylmaleimide Inhibitor Length = 391 Back     alignment and structure
>pdb|3FME|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 6 (Mek6) Activated Mutant (S207d, T211d) Length = 290 Back     alignment and structure
>pdb|3MDY|A Chain A, Crystal Structure Of The Cytoplasmic Domain Of The Bone Morp Protein Receptor Type-1b (Bmpr1b) In Complex With Fkbp12 An 193189 Length = 337 Back     alignment and structure
>pdb|3LL6|A Chain A, Crystal Structure Of The Human Cyclin G Associated Kinase (gak) Length = 337 Back     alignment and structure
>pdb|3F88|A Chain A, Glycogen Synthase Kinase 3beta Inhibitor Complex Length = 349 Back     alignment and structure
>pdb|2BUJ|A Chain A, Crystal Structure Of The Human Serine-Threonine Kinase 16 In Complex With Staurosporine Length = 317 Back     alignment and structure
>pdb|2GNJ|A Chain A, Pka Three Fold Mutant Model Of Rho-Kinase With Y-27632 Length = 350 Back     alignment and structure
>pdb|4EXU|A Chain A, Mapk13, Inactive Form Length = 371 Back     alignment and structure
>pdb|1Y6A|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 2-Anilino-5-Aryl-Oxazole Inhibitor Length = 366 Back     alignment and structure
>pdb|1GNG|A Chain A, Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With Frattide Peptide Length = 378 Back     alignment and structure
>pdb|4DIT|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Imidazopyridine Inhibitor Length = 382 Back     alignment and structure
>pdb|3VHK|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Back Pocket Binder Length = 368 Back     alignment and structure
>pdb|3UTO|A Chain A, Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-Crd-Ig26) Length = 573 Back     alignment and structure
>pdb|3ZRK|A Chain A, Identification Of 2-(4-Pyridyl)thienopyridinones As Gsk-3beta Inhibitors Length = 371 Back     alignment and structure
>pdb|2O5K|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Benzoimidazol Inhibitor Length = 372 Back     alignment and structure
>pdb|2OW3|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With Bis- (Indole)maleimide Pyridinophane Inhibitor Length = 352 Back     alignment and structure
>pdb|3SD0|A Chain A, Identification Of A Glycogen Synthase Kinase-3b Inhibitor That Attenuates Hyperactivity In Clock Mutant Mice Length = 350 Back     alignment and structure
>pdb|3ZDI|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide And Inhibitor 7d Length = 350 Back     alignment and structure
>pdb|4AFJ|A Chain A, 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selective Gsk-3 Inhibitors Length = 367 Back     alignment and structure
>pdb|3COI|A Chain A, Crystal Structure Of P38delta Kinase Length = 353 Back     alignment and structure
>pdb|3KL8|A Chain A, Camkiintide Inhibitor Complex Length = 269 Back     alignment and structure
>pdb|2W4O|A Chain A, Crystal Structure Of Human Camk4 In Complex With 4-Amino( Sulfamoyl-Phenylamino)-Triazole-Carbothioic Acid (2,6- Difluoro-Phenyl)-Amide) Length = 349 Back     alignment and structure
>pdb|1XJD|A Chain A, Crystal Structure Of Pkc-Theta Complexed With Staurosporine At 2a Resolution Length = 345 Back     alignment and structure
>pdb|1H8F|A Chain A, Glycogen Synthase Kinase 3 Beta. Length = 352 Back     alignment and structure
>pdb|1UV5|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With 6-Bromoindirubin-3'-Oxime Length = 350 Back     alignment and structure
>pdb|3GB2|A Chain A, Gsk3beta Inhibitor Complex Length = 353 Back     alignment and structure
>pdb|3F7Z|A Chain A, X-ray Co-crystal Structure Of Glycogen Synthase Kinase 3beta In Complex With An Inhibitor Length = 350 Back     alignment and structure
>pdb|1ZXE|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: D835n Inactivating Mutant In Apo Form Length = 303 Back     alignment and structure
>pdb|3KK9|A Chain A, Camkii Substrate Complex B Length = 282 Back     alignment and structure
>pdb|3KK8|A Chain A, Camkii Substrate Complex A Length = 284 Back     alignment and structure
>pdb|2GNG|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase Length = 350 Back     alignment and structure
>pdb|1KOA|A Chain A, Twitchin Kinase Fragment (C.Elegans), Autoregulated Protein Kinase And Immunoglobulin Domains Length = 491 Back     alignment and structure
>pdb|2GNF|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase With Y- 27632 Length = 350 Back     alignment and structure
>pdb|1XH9|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|3N9X|A Chain A, Crystal Structure Of Map Kinase From Plasmodium Berghei, Pb000659.00.0 Length = 432 Back     alignment and structure
>pdb|2XUU|A Chain A, Crystal Structure Of A Dap-Kinase 1 Mutant Length = 334 Back     alignment and structure
>pdb|4AF3|A Chain A, Human Aurora B Kinase In Complex With Incenp And Vx-680 Length = 292 Back     alignment and structure
>pdb|1O9U|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide Length = 350 Back     alignment and structure
>pdb|1MRV|A Chain A, Crystal Structure Of An Inactive Akt2 Kinase Domain Length = 339 Back     alignment and structure
>pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain Length = 335 Back     alignment and structure
>pdb|3BHY|A Chain A, Crystal Structure Of Human Death Associated Protein Kinase 3 (Dapk3) In Complex With A Beta-Carboline Ligand Length = 283 Back     alignment and structure
>pdb|1GZK|A Chain A, Molecular Mechanism For The Regulation Of Protein Kinase B Akt By Hydrophobic Motif Phosphorylation Length = 315 Back     alignment and structure
>pdb|3DFC|B Chain B, Crystal Structure Of A Glycine-Rich Loop Mutant Of The Death Associated Protein Kinase Catalytic Domain With Amppnp Length = 295 Back     alignment and structure
>pdb|4A4X|A Chain A, Nek2-Ede Bound To Cct248662 Length = 279 Back     alignment and structure
>pdb|3F5U|A Chain A, Crystal Structure Of The Death Associated Protein Kinase In Complex With Amppnp And Mg2+ Length = 295 Back     alignment and structure
>pdb|1IG1|A Chain A, 1.8a X-Ray Structure Of Ternary Complex Of A Catalytic Domain Of Death-Associated Protein Kinase With Atp Analogue And Mn. Length = 294 Back     alignment and structure
>pdb|1P4F|A Chain A, Death Associated Protein Kinase Catalytic Domain With Bound Inhibitor Fragment Length = 293 Back     alignment and structure
>pdb|1O6K|A Chain A, Structure Of Activated Form Of Pkb Kinase Domain S474d With Gsk3 Peptide And Amp-Pnp Length = 336 Back     alignment and structure
>pdb|3E87|A Chain A, Crystal Structures Of The Kinase Domain Of Akt2 In Complex With Atp- Competitive Inhibitors Length = 335 Back     alignment and structure
>pdb|2J90|A Chain A, Crystal Structure Of Human Zip Kinase In Complex With A Tetracyclic Pyridone Inhibitor (pyridone 6) Length = 304 Back     alignment and structure
>pdb|2W5A|A Chain A, Human Nek2 Kinase Adp-Bound Length = 279 Back     alignment and structure
>pdb|2JDO|A Chain A, Structure Of Pkb-Beta (Akt2) Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 342 Back     alignment and structure
>pdb|2X0G|A Chain A, X-ray Structure Of A Dap-kinase Calmodulin Complex Length = 334 Back     alignment and structure
>pdb|3BHH|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase Iib Isoform 1 (camk2b) Length = 295 Back     alignment and structure
>pdb|1O6L|A Chain A, Crystal Structure Of An Activated Akt/protein Kinase B (pkb-pif Chimera) Ternary Complex With Amp-pnp And Gsk3 Peptide Length = 337 Back     alignment and structure
>pdb|2XZS|A Chain A, Death Associated Protein Kinase 1 Residues 1-312 Length = 312 Back     alignment and structure
>pdb|3GU4|A Chain A, Crystal Structure Of Dapkq23v-Amppnp Length = 295 Back     alignment and structure
>pdb|3H4J|B Chain B, Crystal Structure Of Pombe Ampk Kdaid Fragment Length = 336 Back     alignment and structure
>pdb|2YAK|A Chain A, Structure Of Death-Associated Protein Kinase 1 (Dapk1) In Complex With A Ruthenium Octasporine Ligand (Osv) Length = 285 Back     alignment and structure
>pdb|1WVW|A Chain A, Crystal Structures Of Kinase Domain Of Dap Kinase In Complex With Small Molecular Inhibitors Length = 278 Back     alignment and structure
>pdb|2W4K|A Chain A, X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 Back     alignment and structure
>pdb|1YDT|E Chain E, Structure Of Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With H89 Protein Kinase Inhibitor N-[2- (4-Bromocinnamylamino)ethyl]-5-Isoquinoline Length = 350 Back     alignment and structure
>pdb|2W4J|A Chain A, X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 Back     alignment and structure
>pdb|1QL6|A Chain A, The Catalytic Mechanism Of Phosphorylase Kinase Probed By Mutational Studies Length = 298 Back     alignment and structure
>pdb|1SMH|A Chain A, Protein Kinase A Variant Complex With Completely Ordered N- Terminal Helix Length = 350 Back     alignment and structure
>pdb|1STC|E Chain E, Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With Staurosporine Length = 350 Back     alignment and structure
>pdb|3GU8|A Chain A, Crystal Structure Of Dapkl93g With N6-Cyclopentyladenosine Length = 295 Back     alignment and structure
>pdb|3H9R|A Chain A, Crystal Structure Of The Kinase Domain Of Type I Activin Receptor (Acvr1) In Complex With Fkbp12 And Dorsomorphin Length = 330 Back     alignment and structure
>pdb|2C1A|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With Isoquinoline-5-Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl)amide Length = 351 Back     alignment and structure
>pdb|2H6D|A Chain A, Protein Kinase Domain Of The Human 5'-Amp-Activated Protein Kinase Catalytic Subunit Alpha-2 (Ampk Alpha-2 Chain) Length = 276 Back     alignment and structure
>pdb|1SVH|A Chain A, Crystal Structure Of Protein Kinase A In Complex With Azepane Derivative 8 Length = 350 Back     alignment and structure
>pdb|3DND|A Chain A, Camp-Dependent Protein Kinase Pka Catalytic Subunit With Pki-5-24 Length = 350 Back     alignment and structure
>pdb|2Y0A|A Chain A, Structure Of Dapk1 Construct Residues 1-304 Length = 326 Back     alignment and structure
>pdb|4DYM|A Chain A, Crystal Structure Of The Acvr1 Kinase Domain In Complex With The Imidazo[1,2-B]pyridazine Inhibitor K00135 Length = 301 Back     alignment and structure
>pdb|3MTF|A Chain A, Crystal Structure Of The Acvr1 Kinase In Complex With A 2- Aminopyridine Inhibitor Length = 301 Back     alignment and structure
>pdb|3MTL|A Chain A, Crystal Structure Of The Pctaire1 Kinase In Complex With Ind E804 Length = 324 Back     alignment and structure
>pdb|2F7E|E Chain E, Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoquinolin-6- Yl-Pyridin-3-Yloxymethyl-Etylamine Length = 351 Back     alignment and structure
>pdb|2UZT|A Chain A, Pka Structures Of Akt, Indazole-Pyridine Inhibitors Length = 336 Back     alignment and structure
>pdb|2JAV|A Chain A, Human Kinase With Pyrrole-Indolinone Ligand Length = 279 Back     alignment and structure
>pdb|1Q8W|A Chain A, The Catalytic Subunit Of Camp-Dependent Protein Kinase In Complex With Rho-Kinase Inhibitor Fasudil (Ha-1077) Length = 350 Back     alignment and structure
>pdb|2JDS|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With A- 443654 Length = 351 Back     alignment and structure
>pdb|1PHK|A Chain A, Two Structures Of The Catalytic Domain Of Phosphorylase, Kinase: An Active Protein Kinase Complexed With Nucleotide, Substrate-Analogue And Product Length = 298 Back     alignment and structure
>pdb|1XH7|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|2QUR|A Chain A, Crystal Structure Of F327aK285P MUTANT OF CAMP-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|1Q61|A Chain A, Pka Triple Mutant Model Of Pkb Length = 350 Back     alignment and structure
>pdb|2JAM|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase I G Length = 304 Back     alignment and structure
>pdb|4DFY|A Chain A, Crystal Structure Of R194a Mutant Of Camp-Dependent Protein Kinase With Unphosphorylated Activation Loop Length = 371 Back     alignment and structure
>pdb|3HNG|A Chain A, Crystal Structure Of Vegfr1 In Complex With N-(4-chlorophenyl)-2- ((pyridin-4-ylmethyl)amino)benzamide Length = 360 Back     alignment and structure
>pdb|2YZA|A Chain A, Crystal Structure Of Kinase Domain Of Human 5'-Amp-Activated Protein Kinase Alpha-2 Subunit Mutant (T172d) Length = 276 Back     alignment and structure
>pdb|1FMO|E Chain E, Crystal Structure Of A Polyhistidine-Tagged Recombinant Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With The Peptide Inhibitor Pki(5-24) And Adenosine Length = 350 Back     alignment and structure
>pdb|1J3H|A Chain A, Crystal Structure Of Apoenzyme Camp-Dependent Protein Kinase Catalytic Subunit Length = 350 Back     alignment and structure
>pdb|3QAL|E Chain E, Crystal Structure Of Arg280ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|2ERZ|E Chain E, Crystal Structure Of C-amp Dependent Kinase (pka) Bound To Hydroxyfasudil Length = 351 Back     alignment and structure
>pdb|4EC8|A Chain A, Structure Of Full Length Cdk9 In Complex With Cyclint And Drb Length = 373 Back     alignment and structure
>pdb|1BKX|A Chain A, A Binary Complex Of The Catalytic Subunit Of Camp-Dependent Protein Kinase And Adenosine Further Defines Conformational Flexibility Length = 350 Back     alignment and structure
>pdb|2R5T|A Chain A, Crystal Structure Of Inactive Serum And Glucocorticoid- Regulated Kinase 1 In Complex With Amp-Pnp Length = 373 Back     alignment and structure
>pdb|3FHI|A Chain A, Crystal Structure Of A Complex Between The Catalytic And Regulatory (Ri{alpha}) Subunits Of Pka Length = 350 Back     alignment and structure
>pdb|1CTP|E Chain E, Structure Of The Mammalian Catalytic Subunit Of Camp-Dependent Protein Kinase And An Inhibitor Peptide Displays An Open Conformation Length = 350 Back     alignment and structure
>pdb|1SZM|A Chain A, Dual Binding Mode Of Bisindolylmaleimide 2 To Protein Kinase A (Pka) Length = 350 Back     alignment and structure
>pdb|2YCF|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv1531 Length = 322 Back     alignment and structure
>pdb|3ENM|A Chain A, The Structure Of The Map2k Mek6 Reveals An Autoinhibitory Dimer Length = 316 Back     alignment and structure
>pdb|1CDK|A Chain A, Camp-Dependent Protein Kinase Catalytic Subunit (E.C.2.7.1.37) (Protein Kinase A) Complexed With Protein Kinase Inhibitor Peptide Fragment 5-24 (Pki(5-24) Isoelectric Variant Ca) And Mn2+ Adenylyl Imidodiphosphate (Mnamp-Pnp) At Ph 5.6 And 7c And 4c Length = 350 Back     alignment and structure
>pdb|4DFX|E Chain E, Crystal Structure Of Myristoylated K7c Catalytic Subunit Of Camp- Dependent Protein Kinase In Complex With Sp20 And Amp-Pnp Length = 350 Back     alignment and structure
>pdb|1CMK|E Chain E, Crystal Structures Of The Myristylated Catalytic Subunit Of Camp- Dependent Protein Kinase Reveal Open And Closed Conformations Length = 350 Back     alignment and structure
>pdb|4AE6|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit Calpha 2 Length = 343 Back     alignment and structure
>pdb|3A8W|A Chain A, Crystal Structure Of Pkciota Kinase Domain Length = 345 Back     alignment and structure
>pdb|2W0J|A Chain A, Crystal Structure Of Chk2 In Complex With Nsc 109555, A Specific Inhibitor Length = 323 Back     alignment and structure
>pdb|3MVJ|A Chain A, Human Cyclic Amp-Dependent Protein Kinase Pka Inhibitor Complex Length = 371 Back     alignment and structure
>pdb|1ZRZ|A Chain A, Crystal Structure Of The Catalytic Domain Of Atypical Protein Kinase C-Iota Length = 364 Back     alignment and structure
>pdb|4AW2|A Chain A, Crystal Structure Of Cdc42 Binding Protein Kinase Alpha (Mrck Alpha) Length = 437 Back     alignment and structure
>pdb|3ZH8|A Chain A, A Novel Small Molecule Apkc Inhibitor Length = 349 Back     alignment and structure
>pdb|2YCR|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv976 Length = 323 Back     alignment and structure
>pdb|3NX8|A Chain A, Human Camp Dependent Protein Kinase In Complex With Phenol Length = 351 Back     alignment and structure
>pdb|2GU8|A Chain A, Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel And Potent Inhibitors For Akt: Synthesis And Sar Studies Length = 337 Back     alignment and structure
>pdb|3AGL|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-1039 Length = 351 Back     alignment and structure
>pdb|3AGM|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-670 Length = 351 Back     alignment and structure
>pdb|2CN5|A Chain A, Crystal Structure Of Human Chk2 In Complex With Adp Length = 329 Back     alignment and structure
>pdb|4DG3|E Chain E, Crystal Structure Of R336a Mutant Of Camp-dependent Protein Kinase With Unphosphorylated Turn Motif Length = 371 Back     alignment and structure
>pdb|2QCS|A Chain A, A Complex Structure Between The Catalytic And Regulatory Subunit Of Protein Kinase A That Represents The Inhibited State Length = 350 Back     alignment and structure
>pdb|2ZV2|A Chain A, Crystal Structure Of Human CalciumCALMODULIN-Dependent Protein Kinase Kinase 2, Beta, Camkk2 Kinase Domain In Complex With Sto-609 Length = 298 Back     alignment and structure
>pdb|2XK9|A Chain A, Structural Analysis Of Checkpoint Kinase 2 (Chk2) In Complex With Inhibitor Pv1533 Length = 322 Back     alignment and structure
>pdb|3PVB|A Chain A, Crystal Structure Of (73-244)ria:c Holoenzyme Of Camp-Dependent Protein Kinase Length = 345 Back     alignment and structure
>pdb|1L3R|E Chain E, Crystal Structure Of A Transition State Mimic Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3MI9|A Chain A, Crystal Structure Of Hiv-1 Tat Complexed With Human P-Tefb Length = 351 Back     alignment and structure
>pdb|2PHK|A Chain A, The Crystal Structure Of A Phosphorylase Kinase Peptide Substrate Complex: Kinase Substrate Recognition Length = 277 Back     alignment and structure
>pdb|4AE9|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit C Alpha 2 Length = 343 Back     alignment and structure
>pdb|1APM|E Chain E, 2.0 Angstrom Refined Crystal Structure Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With A Peptide Inhibitor And Detergent Length = 350 Back     alignment and structure
>pdb|1Q24|A Chain A, Pka Double Mutant Model Of Pkb In Complex With Mgatp Length = 350 Back     alignment and structure
>pdb|4DC2|A Chain A, Structure Of Pkc In Complex With A Substrate Peptide From Par-3 Length = 396 Back     alignment and structure
>pdb|4BCF|A Chain A, Structure Of Cdk9 In Complex With Cyclin T And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 331 Back     alignment and structure
>pdb|3O7L|B Chain B, Crystal Structure Of Phospholamban (1-19):pka C-Subunit:amp-Pnp:mg2+ Complex Length = 350 Back     alignment and structure
>pdb|1SYK|A Chain A, Crystal Structure Of E230q Mutant Of Camp-Dependent Protein Kinase Reveals Unexpected Apoenzyme Conformation Length = 350 Back     alignment and structure
>pdb|2VZ6|A Chain A, Structure Of Human Calcium Calmodulin Dependent Protein Kinase Type Ii Alpha (Camk2a) In Complex With Indirubin E804 Length = 313 Back     alignment and structure
>pdb|3BLH|A Chain A, Crystal Structure Of Human Cdk9CYCLINT1 Length = 331 Back     alignment and structure
>pdb|3GBZ|A Chain A, Structure Of The Cmgc Cdk Kinase From Giardia Lamblia Length = 329 Back     alignment and structure
>pdb|2VO0|A Chain A, Structure Of Pka-Pkb Chimera Complexed With C-(4-(4- Chlorophenyl)-1-(7h-Pyrrolo(2, 3-D)pyrimidin-4-Yl)piperidin- 4-Yl)methylamine Length = 351 Back     alignment and structure
>pdb|3DLS|A Chain A, Crystal Structure Of Human Pas Kinase Bound To Adp Length = 335 Back     alignment and structure
>pdb|2JDT|A Chain A, Structure Of Pka-Pkb Chimera Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 351 Back     alignment and structure
>pdb|3L9M|A Chain A, Crystal Structure Of Pkab3 (Pka Triple Mutant V123a, L173m, Q181k) With Compound 18 Length = 351 Back     alignment and structure
>pdb|1JBP|E Chain E, Crystal Structure Of The Catalytic Subunit Of Camp- Dependent Protein Kinase Complexed With A Substrate Peptide, Adp And Detergent Length = 350 Back     alignment and structure
>pdb|2Y7J|A Chain A, Structure Of Human Phosphorylase Kinase, Gamma 2 Length = 365 Back     alignment and structure
>pdb|4G3D|A Chain A, Crystal Structure Of Human Nf-kappab Inducing Kinase (nik) Length = 371 Back     alignment and structure
>pdb|2UVY|A Chain A, Structure Of Pka-pkb Chimera Complexed With Methyl-(4-(9h- Purin-6-yl)-benzyl)-amine Length = 351 Back     alignment and structure
>pdb|2WEL|A Chain A, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 327 Back     alignment and structure
>pdb|4DN5|A Chain A, Crystal Structure Of Nf-kb-inducing Kinase (nik) Length = 356 Back     alignment and structure
>pdb|3NIE|A Chain A, Crystal Structure Of Pf11_0147 Length = 429 Back     alignment and structure
>pdb|1ZWS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Drp-1 Kinase Length = 288 Back     alignment and structure
>pdb|3FPQ|A Chain A, Crystal Structure Of The Kinase Domain Of Wnk1 Length = 290 Back     alignment and structure
>pdb|3AMA|A Chain A, Protein Kinase A Sixfold Mutant Model Of Aurora B With Inhibitor Jnj- 7706621 Length = 351 Back     alignment and structure
>pdb|2A27|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 8 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|2VN9|A Chain A, Crystal Structure Of Human Calcium Calmodulin Dependent Protein Kinase Ii Delta Isoform 1, Camkd Length = 301 Back     alignment and structure
>pdb|2YA9|A Chain A, Crystal Structure Of The Autoinhibited Form Of Mouse Dapk2 Length = 361 Back     alignment and structure
>pdb|1WMK|A Chain A, Human Death-Associated Kinase Drp-1, Mutant S308d D40 Length = 321 Back     alignment and structure
>pdb|2A2A|A Chain A, High-resolution Crystallographic Analysis Of The Autoinhibited Conformation Of A Human Death-associated Protein Kinase Length = 321 Back     alignment and structure
>pdb|1Z9X|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 3 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|4AGU|A Chain A, Crystal Structure Of The Human Cdkl1 Kinase Domain Length = 311 Back     alignment and structure
>pdb|2Y4I|B Chain B, Ksr2-Mek1 Heterodimer Length = 319 Back     alignment and structure
>pdb|3QAM|E Chain E, Crystal Structure Of Glu208ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3I6U|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 419 Back     alignment and structure
>pdb|3I6W|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 443 Back     alignment and structure
>pdb|3UIB|A Chain A, Map Kinase Lmampk10 From Leishmania Major In Complex With Sb203580 Length = 362 Back     alignment and structure
>pdb|3PG1|A Chain A, Map Kinase Lmampk10 From Leishmania Major (1.95 Angs Resolution) Length = 362 Back     alignment and structure
>pdb|2QR8|A Chain A, 2.0a X-ray Structure Of C-terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 (rsk2) Length = 342 Back     alignment and structure
>pdb|3KMW|A Chain A, Crystal Structure Of The IlkALPHA-Parvin Core Complex (Mgatp) Length = 271 Back     alignment and structure
>pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 Back     alignment and structure
>pdb|2V7O|A Chain A, Crystal Structure Of Human Calcium-Calmodulin-Dependent Protein Kinase Ii Gamma Length = 336 Back     alignment and structure
>pdb|1RDQ|E Chain E, Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|1KOB|A Chain A, Twitchin Kinase Fragment (Aplysia), Autoregulated Protein Kinase Domain Length = 387 Back     alignment and structure
>pdb|2I0E|A Chain A, Structure Of Catalytic Domain Of Human Protein Kinase C Beta Ii Complexed With A Bisindolylmaleimide Inhibitor Length = 353 Back     alignment and structure
>pdb|2H34|A Chain A, Apoenzyme Crystal Structure Of The Tuberculosis SerineTHREONINE Kinase, Pkne Length = 309 Back     alignment and structure
>pdb|4G3F|A Chain A, Crystal Structure Of Murine Nf-kappab Inducing Kinase (nik) Bound To A 2-(aminothiazoly)phenol (cmp2) Length = 336 Back     alignment and structure
>pdb|4E7W|A Chain A, Structure Of Gsk3 From Ustilago Maydis Length = 394 Back     alignment and structure
>pdb|3V8S|A Chain A, Human Rho-Associated Protein Kinase 1 (Rock 1) In Complex With Indazole Derivative (Compound 18) Length = 410 Back     alignment and structure
>pdb|2JC6|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase 1d Length = 334 Back     alignment and structure
>pdb|4G3C|A Chain A, Crystal Structure Of Apo Murine Nf-kappab Inducing Kinase (nik) Length = 352 Back     alignment and structure
>pdb|2ESM|A Chain A, Crystal Structure Of Rock 1 Bound To Fasudil Length = 415 Back     alignment and structure
>pdb|3SOA|A Chain A, Full-Length Human Camkii Length = 444 Back     alignment and structure
>pdb|2V55|A Chain A, Mechanism Of Multi-site Phosphorylation From A Rock-i:rhoe Complex Structure Length = 406 Back     alignment and structure
>pdb|3F3Z|A Chain A, Crystal Structure Of Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 In Presence Of Indirubin E804 Length = 277 Back     alignment and structure
>pdb|2QR7|A Chain A, 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2: Se-Met Derivative Length = 342 Back     alignment and structure
>pdb|4G3G|A Chain A, Crystal Structure Of Murine Nf-kappab Inducing Kinase (nik) V408l Bound To A 2-(aminothiazolyl)phenol (cmp3) Length = 350 Back     alignment and structure
>pdb|2QG5|A Chain A, Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 Length = 294 Back     alignment and structure
>pdb|3LM0|A Chain A, Crystal Structure Of Human SerineTHREONINE KINASE 17B (STK17B) Length = 327 Back     alignment and structure
>pdb|1VZO|A Chain A, The Structure Of The N-Terminal Kinase Domain Of Msk1 Reveals A Novel Autoinhibitory Conformation For A Dual Kinase Protein Length = 355 Back     alignment and structure
>pdb|2F2U|A Chain A, Crystal Structure Of The Rho-Kinase Kinase Domain Length = 402 Back     alignment and structure
>pdb|3KMU|A Chain A, Crystal Structure Of The IlkALPHA-Parvin Core Complex (Apo) Length = 271 Back     alignment and structure
>pdb|3UC3|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.3 Length = 361 Back     alignment and structure
>pdb|3QD2|B Chain B, Crsytal Structure Of Mouse Perk Kinase Domain Length = 332 Back     alignment and structure
>pdb|3UJG|A Chain A, Crystal Structure Of Snrk2.6 In Complex With Hab1 Length = 361 Back     alignment and structure
>pdb|3UC4|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.6 Length = 362 Back     alignment and structure
>pdb|3UDB|A Chain A, Crystal Structure Of Snrk2.6 Length = 317 Back     alignment and structure
>pdb|4EUT|A Chain A, Structure Of Bx-795 Complexed With Unphosphorylated Human Tbk1 Kinase- Uld Domain Length = 396 Back     alignment and structure
>pdb|3KVW|A Chain A, Crystal Structure Of Dual-Specificity Tyrosine Phosphorylation Regulated Kinase 2 (Dyrk2) In Complex With An Indirubin Ligand Length = 429 Back     alignment and structure
>pdb|3RP9|A Chain A, Crystal Structure Of The Apo Mapk From Toxoplasma Gondii, 25.M01780 Or Tgme49_007820 Length = 458 Back     alignment and structure
>pdb|1A06|A Chain A, Calmodulin-Dependent Protein Kinase From Rat Length = 332 Back     alignment and structure
>pdb|3KN5|A Chain A, Crystal Structure Of The C-Terminal Kinase Domain Of Msk1 In With Amp-Pnp Length = 325 Back     alignment and structure
>pdb|3RNY|A Chain A, Crystal Structure Of Human Rsk1 C-Terminal Kinase Domain Length = 346 Back     alignment and structure
>pdb|4AZF|A Chain A, Human Dyrk2 In Complex With Leucettine L41 Length = 417 Back     alignment and structure
>pdb|2WNT|A Chain A, Crystal Structure Of The Human Ribosomal Protein S6 Kinase Length = 330 Back     alignment and structure
>pdb|4FG7|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-293 In Complex With Atp Length = 293 Back     alignment and structure
>pdb|4FG8|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-315 In Complex With Atp Length = 315 Back     alignment and structure
>pdb|4FG9|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-320 In Complex With Atp Length = 320 Back     alignment and structure
>pdb|3QFV|A Chain A, Mrck Beta In Complex With Tpca-1 Length = 415 Back     alignment and structure
>pdb|3TKU|A Chain A, Mrck Beta In Complex With Fasudil Length = 433 Back     alignment and structure
>pdb|3ZUT|A Chain A, The Structure Of Ost1 (D160a) Kinase Length = 362 Back     alignment and structure
>pdb|3MFR|A Chain A, Cask-4m Cam Kinase Domain, Native Length = 351 Back     alignment and structure
>pdb|4EUU|A Chain A, Structure Of Bx-795 Complexed With Human Tbk1 Kinase Domain Phosphorylated On Ser172 Length = 319 Back     alignment and structure
>pdb|3ZUU|A Chain A, The Structure Of Ost1 (D160a, S175d) Kinase In Complex With Gold Length = 362 Back     alignment and structure
>pdb|1Z57|A Chain A, Crystal Structure Of Human Clk1 In Complex With 10z-Hymenialdisine Length = 339 Back     alignment and structure
>pdb|3K2L|A Chain A, Crystal Structure Of Dual-Specificity Tyrosine Phosphorylation Regulated Kinase 2 (Dyrk2) Length = 429 Back     alignment and structure
>pdb|3E3P|A Chain A, Glycogen Synthase Kinase From Leishmania Major Length = 360 Back     alignment and structure
>pdb|2RIO|A Chain A, Structure Of The Dual Enzyme Ire1 Reveals The Basis For Catalysis And Regulation Of Non-conventional Splicing Length = 434 Back     alignment and structure
>pdb|3P23|A Chain A, Crystal Structure Of The Human Kinase And Rnase Domains In Complex With Adp Length = 432 Back     alignment and structure
>pdb|3SDJ|A Chain A, Structure Of Rnase-Inactive Point Mutant Of Oligomeric KinaseRNASE Ire1 Length = 448 Back     alignment and structure
>pdb|2IN6|A Chain A, Wee1 Kinase Complex With Inhibitor Pd311839 Length = 287 Back     alignment and structure
>pdb|2VAG|A Chain A, Crystal Structure Of Di-Phosphorylated Human Clk1 In Complex With A Novel Substituted Indole Inhibitor Length = 339 Back     alignment and structure
>pdb|1X8B|A Chain A, Structure Of Human Wee1a Kinase: Kinase Domain Complexed With Inhibitor Pd0407824 Length = 289 Back     alignment and structure
>pdb|3BI6|A Chain A, Wee1 Kinase Complex With Inhibitor Pd352396 Length = 287 Back     alignment and structure
>pdb|2Z2W|A Chain A, Humand Wee1 Kinase Complexed With Inhibitor Pf0335770 Length = 285 Back     alignment and structure
>pdb|3FBV|A Chain A, Crystal Structure Of The Oligomer Formed By The Kinase-Ribonuclease Domain Of Ire1 Length = 448 Back     alignment and structure
>pdb|2PML|X Chain X, Crystal Structure Of Pfpk7 In Complex With An Atp Analogue Length = 348 Back     alignment and structure
>pdb|2WTK|C Chain C, Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo25alpha Complex Length = 305 Back     alignment and structure
>pdb|3LJ0|A Chain A, Ire1 Complexed With Adp And Quercetin Length = 434 Back     alignment and structure
>pdb|3LLT|A Chain A, Crystal Structure Of Pf14_0431, Kinase Domain Length = 360 Back     alignment and structure
>pdb|3HMN|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain In Complex With Atp Length = 342 Back     alignment and structure
>pdb|2X9E|A Chain A, Human Mps1 In Complex With Nms-P715 Length = 317 Back     alignment and structure
>pdb|2IWI|A Chain A, Crystal Structure Of The Human Pim2 In Complex With A Ruthenium Organometallic Ligand Ru1 Length = 312 Back     alignment and structure
>pdb|3VQU|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain In Complex With 4- [(4-Amino-5-Cyano-6-Ethoxypyridin-2- Yl)amino]benzamide Length = 320 Back     alignment and structure
>pdb|3DBQ|A Chain A, Crystal Structure Of Ttk Kinase Domain Length = 343 Back     alignment and structure
>pdb|3CEK|A Chain A, Crystal Structure Of Human Dual Specificity Protein Kinase (ttk) Length = 313 Back     alignment and structure
>pdb|2ZMC|A Chain A, Crystal Structure Of Human Mitotic Checkpoint Kinase Mps1 Catalytic Domain Apo Form Length = 390 Back     alignment and structure
>pdb|3TAC|A Chain A, Crystal Structure Of The Liprin-AlphaCASK COMPLEX Length = 361 Back     alignment and structure
>pdb|3SV0|A Chain A, Crystal Structure Of Casein Kinase-1 Like Protein In Plant Length = 483 Back     alignment and structure
>pdb|3H9F|A Chain A, Crystal Structure Of Human Dual Specificity Protein Kinase (Ttk) In Complex With A Pyrimido-Diazepin Ligand Length = 313 Back     alignment and structure
>pdb|3C0G|A Chain A, Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Length = 351 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query898
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 1e-177
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 1e-176
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 1e-165
3soc_A322 Activin receptor type-2A; structural genomics cons 3e-93
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 2e-70
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 4e-69
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 7e-68
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 8e-68
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 3e-66
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 6e-66
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 2e-63
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 2e-63
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 5e-63
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 9e-63
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 9e-61
3q4u_A301 Activin receptor type-1; structural genomics conso 3e-60
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 4e-60
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 4e-58
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 8e-47
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 1e-43
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 1e-43
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 3e-43
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 3e-43
3lzb_A327 Epidermal growth factor receptor; epidermal growth 5e-43
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 7e-43
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 8e-43
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 1e-42
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 1e-42
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 1e-42
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 1e-42
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 2e-42
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 3e-42
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 4e-42
3pls_A298 Macrophage-stimulating protein receptor; protein k 4e-42
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 6e-42
3v5q_A297 NT-3 growth factor receptor; kinase domain, kinase 7e-42
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 8e-42
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 1e-41
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 1e-41
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 1e-41
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 1e-41
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 1e-41
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 2e-41
4aoj_A329 High affinity nerve growth factor receptor; transf 2e-41
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 3e-41
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 3e-41
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 3e-41
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 3e-41
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 3e-41
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 4e-41
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 6e-41
3zzw_A289 Tyrosine-protein kinase transmembrane receptor RO; 7e-41
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 1e-40
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 1e-40
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 1e-40
3poz_A327 Epidermal growth factor receptor; kinase domain, a 2e-40
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 3e-40
3ork_A311 Serine/threonine protein kinase; structural genomi 3e-40
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 3e-40
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 1e-39
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 1e-39
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 1e-39
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 4e-39
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 5e-39
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 1e-38
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 1e-38
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 2e-38
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 3e-38
2a19_B284 Interferon-induced, double-stranded RNA-activated 4e-38
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 5e-38
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 7e-38
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 8e-38
2xir_A316 Vascular endothelial growth factor receptor 2; ang 9e-38
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 1e-37
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 1e-37
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 2e-37
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 3e-37
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 3e-37
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 4e-37
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 5e-37
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 1e-36
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 2e-36
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 5e-36
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 1e-35
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 2e-35
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 5e-35
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 7e-35
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 2e-34
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 2e-34
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 4e-34
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 4e-34
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 9e-34
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 9e-34
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 4e-33
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 5e-33
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 1e-32
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 1e-32
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 2e-32
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 2e-32
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 6e-32
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 8e-32
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 1e-30
3lij_A494 Calcium/calmodulin dependent protein kinase with A 2e-30
3eqc_A360 Dual specificity mitogen-activated protein kinase; 3e-30
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 8e-30
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 1e-29
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 5e-29
3fme_A290 Dual specificity mitogen-activated protein kinase; 5e-29
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 6e-29
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 7e-29
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 8e-29
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 3e-28
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 4e-28
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 7e-28
3an0_A340 Dual specificity mitogen-activated protein kinase; 1e-27
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 1e-27
3aln_A327 Dual specificity mitogen-activated protein kinase; 2e-27
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 2e-27
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 3e-27
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 3e-27
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 4e-27
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 5e-27
3o0g_A292 Cell division protein kinase 5; kinase activator c 5e-27
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 8e-27
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 1e-26
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 1e-26
3niz_A311 Rhodanese family protein; structural genomics, str 2e-26
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 3e-26
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 4e-26
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 5e-26
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 6e-26
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 6e-26
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 6e-26
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 7e-26
3bhy_A283 Death-associated protein kinase 3; death associate 8e-26
2dyl_A318 Dual specificity mitogen-activated protein kinase 8e-26
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 1e-25
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 1e-25
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 1e-25
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 2e-25
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 2e-25
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 2e-25
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 2e-25
2y0a_A326 Death-associated protein kinase 1; transferase, ca 3e-25
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 4e-25
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 4e-25
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 4e-25
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 4e-25
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 7e-25
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 7e-25
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 1e-24
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 1e-24
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 2e-24
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 2e-24
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 2e-24
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 3e-24
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 4e-24
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 6e-24
3uqc_A286 Probable conserved transmembrane protein; structur 2e-23
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 2e-23
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 2e-23
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 2e-23
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 2e-23
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 2e-23
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 2e-23
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 3e-23
3dls_A335 PAS domain-containing serine/threonine-protein KI; 3e-23
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 4e-23
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 5e-23
1uu3_A310 HPDK1, 3-phosphoinositide dependent protein kinase 5e-23
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 1e-22
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 1e-22
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 1e-22
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 2e-22
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 3e-22
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 4e-22
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 6e-22
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 7e-22
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 1e-21
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 2e-21
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 3e-21
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 3e-21
2eue_A275 Carbon catabolite derepressing protein kinase; kin 4e-21
3pvu_A 695 Beta-adrenergic receptor kinase 1; transferase, se 4e-21
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 6e-21
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 1e-20
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 1e-20
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 1e-20
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 1e-20
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 1e-20
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 1e-20
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 2e-20
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 2e-20
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 2e-20
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 2e-20
3rp9_A458 Mitogen-activated protein kinase; structural genom 3e-20
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 5e-20
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 6e-20
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 7e-20
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 9e-20
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 2e-19
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 6e-19
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 7e-19
2fst_X367 Mitogen-activated protein kinase 14; active mutant 7e-19
3g51_A325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 9e-19
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 9e-19
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 1e-18
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 1e-18
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 7e-18
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 4e-17
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 7e-17
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 1e-16
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 4e-16
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 5e-16
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 2e-15
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 2e-15
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 2e-15
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 3e-15
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 5e-15
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 6e-15
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 7e-15
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 1e-14
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 1e-14
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 1e-14
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 2e-14
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 4e-14
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 4e-14
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 2e-13
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 7e-13
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 1e-12
3sv0_A483 Casein kinase I-like; typical kinase domain fold, 5e-12
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 1e-11
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 1e-11
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 3e-11
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 3e-10
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 4e-10
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 6e-10
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 8e-09
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 2e-05
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 3e-09
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 3e-07
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 2e-06
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 1e-05
3dzy_A467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 5e-05
3dzy_A467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 9e-04
3tm0_A263 Aminoglycoside 3'-phosphotransferase; protein kina 8e-05
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 7e-04
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
 Score =  514 bits (1326), Expect = e-177
 Identities = 123/310 (39%), Positives = 173/310 (55%), Gaps = 4/310 (1%)

Query: 467 SMLSSSSVSIDSCAVTYTGTAKTFTLNDIEKATNGFHTSRIIGEGGFGVVYRGILDDGRE 526
           S  ++S     S +      +    L D+E+ATN F    +IG G FG VY+G+L DG +
Sbjct: 6   SKATNSINDALSSSYLVPFESYRVPLVDLEEATNNFDHKFLIGHGVFGKVYKGVLRDGAK 65

Query: 527 VAVKVLKRANQHGGREFLAELEMLSRLHHRNLVKLFGVCIEDNNRCLVYELIHNGSLESH 586
           VA+K     +  G  EF  E+E LS   H +LV L G C E N   L+Y+ + NG+L+ H
Sbjct: 66  VALKRRTPESSQGIEEFETEIETLSFCRHPHLVSLIGFCDERNEMILIYKYMENGNLKRH 125

Query: 587 LHGDDKVNGPLDWDARMKIALGAARGLAYLHEDSSPRVIHRDFKSSNILLEHDFTPKVSD 646
           L+G D     + W+ R++I +GAARGL YLH  +   +IHRD KS NILL+ +F PK++D
Sbjct: 126 LYGSDLPTMSMSWEQRLEICIGAARGLHYLHTRA---IIHRDVKSINILLDENFVPKITD 182

Query: 647 FGLARTALDEGNKHISTHVMGTFGYLAPEYAMTGHLLVKSDVYSYGVVLLELLTGRKPVD 706
           FG+++   +    H+ST V GT GY+ PEY + G L  KSDVYS+GVVL E+L  R  + 
Sbjct: 183 FGISKKGTELDQTHLSTVVKGTLGYIDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAIV 242

Query: 707 LSQPPGQENLVAWARPLLTTKEGLKTIIDPVIESNISYDTLVKVAAIASMCVQPEVSHRP 766
            S P    NL  WA         L+ I+DP +   I  ++L K    A  C+      RP
Sbjct: 243 QSLPREMVNLAEWAVESH-NNGQLEQIVDPNLADKIRPESLRKFGDTAVKCLALSSEDRP 301

Query: 767 FMGEVVQALK 776
            MG+V+  L+
Sbjct: 302 SMGDVLWKLE 311


>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Length = 336 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Length = 330 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Length = 296 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Length = 298 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Length = 364 Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Length = 345 Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Length = 483 Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Length = 360 Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Length = 397 Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Length = 355 Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Length = 352 Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Length = 339 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Length = 263 Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Length = 282 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 898
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 1e-73
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 1e-69
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 1e-68
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 2e-68
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 2e-67
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 3e-67
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 1e-66
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 2e-65
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 9e-65
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 9e-65
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 8e-64
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 3e-63
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 3e-63
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 4e-63
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 8e-63
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 5e-62
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 9e-62
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 1e-61
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 1e-61
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 2e-61
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 3e-61
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 1e-60
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 3e-60
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 6e-60
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 2e-59
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 4e-58
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 5e-58
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 8e-57
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 1e-56
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 2e-55
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 4e-54
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 1e-53
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 2e-53
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 1e-52
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 3e-52
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 2e-50
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 2e-50
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 6e-50
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 9e-49
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 7e-48
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 2e-47
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 2e-46
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 2e-46
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 6e-46
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 8e-46
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 1e-45
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 6e-45
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 2e-44
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 3e-44
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 5e-44
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 5e-43
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 1e-42
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 6e-42
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 2e-41
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 9e-41
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 4e-40
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 6e-39
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 7e-36
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 9e-36
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 1e-35
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 9e-35
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 1e-30
d1zara2191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 9e-28
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: B-Raf kinase
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  241 bits (615), Expect = 1e-73
 Identities = 73/276 (26%), Positives = 118/276 (42%), Gaps = 26/276 (9%)

Query: 506 RIIGEGGFGVVYRGILDDGREVAVKVLK--RANQHGGREFLAELEMLSRLHHRNLVKLFG 563
           + IG G FG VY+G      +VAVK+L          + F  E+ +L +  H N++   G
Sbjct: 14  QRIGSGSFGTVYKGKWHG--DVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMG 71

Query: 564 VCIEDNNRCLVYELIHNGSLESHLHGDDKVNGPLDWDARMKIALGAARGLAYLHEDSSPR 623
                    +V +     SL  HLH    +    +    + IA   A+G+ YLH      
Sbjct: 72  YS-TAPQLAIVTQWCEGSSLYHHLH---IIETKFEMIKLIDIARQTAQGMDYLHA---KS 124

Query: 624 VIHRDFKSSNILLEHDFTPKVSDFGLARTALDEGNKHISTHVMGTFGYLAPEYAMT---G 680
           +IHRD KS+NI L  D T K+ DFGLA         H    + G+  ++APE        
Sbjct: 125 IIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKN 184

Query: 681 HLLVKSDVYSYGVVLLELLTGRKPVDLSQPPGQENLVAWARPLLTTKEGLKTIIDPVIES 740
               +SDVY++G+VL EL+TG+ P        Q   +           G  +     + S
Sbjct: 185 PYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMV--------GRGYLSPDLSKVRS 236

Query: 741 NISYDTLVKVAAIASMCVQPEVSHRPFMGEVVQALK 776
           N        +  + + C++ +   RP   +++ +++
Sbjct: 237 NCPKA----MKRLMAECLKKKRDERPLFPQILASIE 268


>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query898
d2bhua3420 Glycosyltrehalose trehalohydrolase, central domain 100.0
d2df7a1419 Birnavirus VP2 {Infectious bursal disease virus [T 100.0
d1ejda_419 UDP-N-acetylglucosamine enolpyruvyl transferase (E 100.0
d1om4a_418 Nitric oxide (NO) synthase oxygenase domain {Rat ( 100.0
d2gp4a2418 6-phosphogluconate dehydratase EDD {Shewanella one 100.0
d1f61a_418 Isocitrate lyase {Mycobacterium tuberculosis [TaxI 100.0
d2r5ea1418 Kynurenine--oxoglutarate transaminase I {Yellowfev 100.0
d1w7la_418 Kynurenine--oxoglutarate transaminase I {Human (Ho 100.0
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 100.0
d3bona1417 Botulinum neurotoxin {Clostridium botulinum, serot 100.0
d1q7ea_417 Hypothetical protein YfdW {Escherichia coli [TaxId 100.0
d2csga1417 Hypothetical protein YbiU {Salmonella typhimurium 100.0
d1gff1_417 Microvirus capsid proteins {Bacteriophage G4 [TaxI 100.0
d1w6ga1417 Copper amine oxidase, domain 3 {Arthrobacter globi 100.0
d1ltka_417 Phosphoglycerate kinase {Malaria parasite (Plasmod 100.0
d1vema2417 Bacterial beta-amylase {Bacillus cereus [TaxId: 13 100.0
d1q2oa_416 Nitric oxide (NO) synthase oxygenase domain {Cow ( 100.0
d1dfoa_416 Serine hydroxymethyltransferase {Escherichia coli 100.0
d1d8wa_416 L-rhamnose isomerase {Escherichia coli [TaxId: 562 100.0
d1igwa_416 Isocitrate lyase {Escherichia coli [TaxId: 562]} 100.0
d2vnud4416 Exosome complex exonuclease RRP44 {Saccharomyces c 100.0
d1pb1a_416 Isocitrate dehydrogenase, ICDH {Escherichia coli [ 100.0
d1dnva_415 Densovirus capsid protein {Galleria mellonella den 100.0
d1so2a_415 cGMP-inhibited 3',5'-cyclic phosphodiesterase B, p 100.0
d2ieaa2415 Pyruvate dehydrogenase E1 component, PP module {Es 100.0
d16pka_415 Phosphoglycerate kinase {Trypanosoma brucei [TaxId 100.0
d1qpga_415 Phosphoglycerate kinase {Baker's yeast (Saccharomy 100.0
d2qeec1415 Uncharacterized protein BH0493 {Bacillus haloduran 100.0
d1s5ja2415 Family B DNA polymerase {Sulfolobus solfataricus [ 100.0
d1kbia1414 Flavocytochrome b2, C-terminal domain {Baker's yea 100.0
d2b8na1414 Putative glycerate kinase (hypothetical protein TM 100.0
d1o20a_414 Gamma-glutamyl phosphate reductase {Thermotoga mar 100.0
d1t0la_414 NADP-dependent isocitrate dehydrogenase {Human (Ho 100.0
d1vh4a_413 Stabilizer of iron transporter SufD {Escherichia c 100.0
d1hdia_413 Phosphoglycerate kinase {Pig (Sus scrofa) [TaxId: 100.0
d2qgma1413 Succinoglycan biosynthesis protein BC3205 {Bacillu 100.0
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 100.0
d1lwda_413 NADP-dependent isocitrate dehydrogenase {Pig (Sus 100.0
d1zjca1413 Aminopeptidase S, AMPS {Staphylococcus aureus [Tax 100.0
d1ulva1413 Glucodextranase, domain A {Arthrobacter globiformi 100.0
d1a0tp_413 Sucrose-specific porin {Enterobacterium (Salmonell 100.0
d1ocka_412 Malonamidase E2 {Bradyrhizobium japonicum [TaxId: 100.0
d1yzya1412 Hypothetical protein HI1011 {Haemophilus influenza 100.0
d1yaaa_412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 100.0
d1bw0a_412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 100.0
d1rxxa_412 Arginine deiminase {Pseudomonas aeruginosa [TaxId: 100.0
d1ajsa_412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 100.0
d1ufaa2412 Hypothetical protein TT1467, N-terminal domain {Th 100.0
d1t3ca_411 Botulinum neurotoxin {Clostridium botulinum, serot 100.0
d2afaa1411 Putative NAG isomerase YihS {Salmonella typhimuriu 100.0
d1ux5a_411 Bni1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 100.0
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 100.0
d2ccaa1410 Catalase-peroxidase KatG {Mycobacterium tuberculos 100.0
d1p1ja1410 Myo-inositol 1-phosphate synthase {Baker's yeast ( 100.0
d1kfsa2410 DNA polymerase I (Klenow fragment) {Escherichia co 100.0
d1uuqa_410 Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} 100.0
d1s5ja1410 Exonuclease domain of family B DNA polymerases {Su 100.0
d2cmza1409 Spike glycoprotein {Vesicular stomatitis indiana v 100.0
d2g0da1409 Nisin biosynthesis protein NisC {Lactococcus lacti 100.0
d1tv5a1409 Dihydroorotate dehydrogenase {Plasmodium falciparu 100.0
d1qtma2409 DNA polymerase I (Klenow fragment) {Thermus aquati 100.0
d1b25a1409 Formaldehyde ferredoxin oxidoreductase {Archaeon P 100.0
d1s9ra_409 Arginine deiminase {Mycoplasma arginini [TaxId: 20 100.0
g1wht.1409 Serine carboxypeptidase II {Wheat (Triticum vulgar 100.0
d1dkla_409 Phytase (myo-inositol-hexakisphosphate-3-phosphohy 100.0
d1wzaa2409 Bacterial alpha-amylase {Halothermothrix orenii [T 100.0
d1r76a_408 Polygalacturonic acid lyase (pectate lyase) {Azosp 100.0
d1f1oa_408 Adenylosuccinate lyase {Bacillus subtilis [TaxId: 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1t3ia_408 Probable cysteine desulfurase SufS {Synechocystis 100.0
d1h4pa_408 Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharom 100.0
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 100.0
d2hhva2408 DNA polymerase I (Klenow fragment) {Bacillus stear 100.0
d1qs0a_407 2-oxoisovalerate dehydrogenase (E1B), PP module {P 100.0
d1eu8a_407 D-maltodextrin-binding protein, MBP {Archaeon Ther 100.0
d1qhoa4407 Cyclodextrin glycosyltransferase {Bacillus stearot 100.0
d1itka1406 Catalase-peroxidase KatG {Archaeon Haloarcula mari 100.0
d1mwva1406 Catalase-peroxidase KatG {Burkholderia pseudomalle 100.0
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 100.0
d1ei6a_406 Phosphonoacetate hydrolase {Pseudomonas fluorescen 100.0
d1ub2a1406 Catalase-peroxidase KatG {Synechococcus sp. pcc 79 100.0
d2ayia1406 Aminopeptidase T {Thermus thermophilus [TaxId: 274 100.0
d3bmva4406 Cyclodextrin glycosyltransferase {Thermoanaerobact 100.0
d1kl1a_405 Serine hydroxymethyltransferase {Bacillus stearoth 100.0
d2nwwa1405 Proton glutamate symport protein {Pyrococcus horik 100.0
d1h6za3405 Pyruvate phosphate dikinase, N-terminal domain {Tr 100.0
d1jf9a_405 NifS-like protein/selenocysteine lyase {Escherichi 100.0
d1lnsa3405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 100.0
d1qz9a_404 Kynureninase {Pseudomonas fluorescens [TaxId: 294] 100.0
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 100.0
d1z7da1404 Ornithine aminotransferase {Plasmodium yoelii yoel 100.0
d2b5dx2404 Alpha-amylase AmyC {Thermotoga maritima [TaxId: 23 100.0
d1h12a_404 Endo-1,4-beta-xylanase {Pseudoalteromonas haloplan 100.0
d2byla1404 Ornithine aminotransferase {Human (Homo sapiens) [ 100.0
d1uyra2404 Acetyl-coenzyme A carboxylase {Baker's yeast (Sacc 100.0
d1wsta1403 Multiple substrate aminotransferase, MSAT {Thermoc 100.0
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 100.0
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 100.0
d1xksa_403 Nuclear pore complex protein Nup133 {Human (Homo s 100.0
d1hx0a2403 Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 982 100.0
d3b55a1403 Succinoglycan biosynthesis protein BC3120 {Bacillu 100.0
d1dofa_402 Adenylosuccinate lyase {Archaeon Pyrobaculum aerop 100.0
d2g5da1402 Membrane-bound lytic murein transglycosylase A, ML 100.0
d1xk7a1402 Crotonobetainyl-CoA:carnitine CoA-transferase, Cai 100.0
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 100.0
d1fp3a_402 N-acyl-D-glucosamine 2-epimerase {Pig (Sus scrofa) 100.0
g1w2w.1402 Putative methylthioribose-1-phosphate isomerase Yp 100.0
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 100.0
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 100.0
d1fc4a_401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 100.0
d1iira_401 UDP-glucosyltransferase GtfB {Amycolatopsis orient 100.0
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 100.0
d1rrva_401 TDP-vancosaminyltransferase GftD {Amycolatopsis or 100.0
d1a12a_401 Regulator of chromosome condensation RCC1 {Human ( 100.0
d1jdpa_401 Hormone binding domain of the atrial natriuretic p 100.0
d7aata_401 Aspartate aminotransferase, AAT {Chicken (Gallus g 100.0
d2h6fb1401 Protein farnesyltransferase, beta-subunit {Human ( 100.0
d2r7da2401 Ribonuclease II family protein DR0020 {Deinococcus 100.0
d3ovwa_400 Cellobiohydrolase I (cellulase, Endoglucanase I, C 100.0
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 100.0
d1ru4a_400 Pectate transeliminase {Erwinia chrysanthemi [TaxI 100.0
d1inpa_400 Inositol polyphosphate 1-phosphatase {Cow (Bos tau 100.0
d2olua2400 Penicillin-binding protein 2, PBP2 {Staphylococcus 100.0
d1eh9a3400 Glycosyltrehalose trehalohydrolase, central domain 100.0
d1ojja_399 Cellobiohydrolase I (cellulase, Endoglucanase I, C 100.0
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 100.0
d1oyaa_399 Old yellow enzyme (OYE) {Lager yeast (Saccharomyce 100.0
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 100.0
d2ah2a2399 Trypanosoma sialidase {Parasitic flagellate protoz 100.0
d1bn8a_399 Pectate lyase {Bacillus subtilis [TaxId: 1423]} 100.0
d1qgna_398 Cystathionine gamma-synthase, CGS {Common tobacco 100.0
d1vpea_398 Phosphoglycerate kinase {Thermotoga maritima [TaxI 100.0
d1vlja_398 NADH-dependent butanol dehydrogenase A (TM0820) {T 100.0
d1y4ia1397 Methionine gamma-lyase, MGL {Citrobacter freundii 100.0
d1q1la_397 Chorismate synthase, AroC {Aquifex aeolicus [TaxId 100.0
d1vkoa1397 Myo-inositol 1-phosphate synthase {Caenorhabditis 100.0
d3tata_397 Aromatic aminoacid aminotransferase, AroAT {Escher 100.0
d1vjva_397 Ubiquitin carboxyl-terminal hydrolase 6 {Baker's y 100.0
d1lf6a1397 Bacterial glucoamylase, C-terminal domain {Thermoa 100.0
d2q7wa1396 Aspartate aminotransferase, AAT {Escherichia coli 100.0
d2bwna1396 5-aminolevulinate synthase {Rhodobacter capsulatus 100.0
d1m7xa3396 1,4-alpha-glucan branching enzyme, central domain 100.0
d1io1a_395 Phase 1 flagellin {Salmonella typhimurium [TaxId: 100.0
g1f8v.1395 Alphanodavirus capsid protein {Pariacoto virus [Ta 100.0
d2bfda1395 Branched-chain alpha-keto acid dehydrogenase, PP m 100.0
d1nw1a_395 Choline kinase {Caenorhabditis elegans [TaxId: 623 100.0
d2py6a1395 Methyltransferase FkbM {Methylobacillus flagellatu 100.0
d1aora1395 Aldehyde ferredoxin oxidoreductase {Archaeon Pyroc 100.0
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 100.0
d1xi9a_395 Putative alanine aminotransferase {Pyrococcus furi 100.0
d1w36b2395 Exodeoxyribonuclease V beta chain (RecB), N-termin 100.0
d1phpa_394 Phosphoglycerate kinase {Bacillus stearothermophil 100.0
d1e5ea_394 Methionine gamma-lyase, MGL {Trichomonas vaginalis 100.0
d2ay1a_394 Aromatic aminoacid aminotransferase, AroAT {Paraco 100.0
d1u1ha1394 5-methyltetrahydropteroyltriglutamate--homocystein 100.0
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 100.0
d1atia2394 Glycyl-tRNA synthetase (GlyRS) {Thermus thermophil 100.0
d1q8ia2394 Family B DNA polymerase {Escherichia coli [TaxId: 100.0
d1c7na_394 Cystalysin {Treponema denticola [TaxId: 158]} 100.0
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 100.0
d2pb1a1394 Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) 100.0
d2d3na2394 Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 100.0
d1ldja2394 Cullin homolog 1, Cul-1 {Human (Homo sapiens) [Tax 100.0
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 100.0
d1n8pa_393 Cystathionine gamma-lyase (CYS3) {Baker's yeast (S 100.0
d1xlma_393 D-xylose isomerase {Arthrobacter, strain b3728 [Ta 100.0
d1kwga2393 A4 beta-galactosidase {Thermus thermophilus [TaxId 100.0
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 100.0
d1g8ma2393 AICAR transformylase domain of bifunctional purine 100.0
d1hvxa2393 Bacterial alpha-amylase {Bacillus stearothermophil 100.0
d1e43a2393 Bacterial alpha-amylase {Chimera (Bacillus amyloli 100.0
d1gc0a_392 Methionine gamma-lyase, MGL {Pseudomonas putida [T 100.0
d1yvua2392 Argonaute homologue Aq_1447 {Aquifex aeolicus [Tax 100.0
d2d0ta1392 Indoleamine 2,3-dioxygenase {Human (Homo sapiens) 100.0
d2pula1392 Methylthioribose kinase MtnK {Bacillus subtilis [T 100.0
d1xima_392 D-xylose isomerase {Actinoplanes missouriensis [Ta 100.0
d1cl1a_391 Cystathionine beta-lyase, CBL {Escherichia coli [T 100.0
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 100.0
d1pn3a_391 TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi 100.0
d1nt4a_391 Glucose-1-phosphatase {Escherichia coli [TaxId: 56 100.0
d1p3wa_391 Cysteine desulfurase IscS {Escherichia coli [TaxId 100.0
d1lwha2391 4-alpha-glucanotransferase {Thermotoga maritima [T 100.0
d4ubpc2390 alpha-subunit of urease, catalytic domain {Bacillu 100.0
d1v6sa_390 Phosphoglycerate kinase {Thermus thermophilus [Tax 100.0
d1nsca_390 Influenza neuraminidase {Influenza B virus, differ 100.0
d1qopb_390 Tryptophan synthase, beta-subunit {Salmonella typh 100.0
d1oj7a_390 Hypothetical oxidoreductase yqhD {Escherichia coli 100.0
d1ud2a2390 Bacterial alpha-amylase {Bacillus sp., ksm-k38 [Ta 100.0
d1e9yb2389 alpha-subunit of urease, catalytic domain {Helicob 100.0
d1sg6a_389 Dehydroquinate synthase, DHQS {Aspergillus nidulan 100.0
d2gb3a1389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 100.0
d1jiha2389 DNA polymerase eta {Baker's yeast (Saccharomyces c 100.0
d2o3ia1389 Hypothetical protein CV3147 {Chromobacterium viola 100.0
d1f8ea_388 Influenza neuraminidase {Influenza A virus, differ 100.0
d1u7la_388 Vacuolar ATP synthase subunit C {Baker's yeast (Sa 100.0
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1qxoa_388 Chorismate synthase, AroC {Streptococcus pneumonia 100.0
d1h0ca_388 Alanine-glyoxylate aminotransferase {Human (Homo s 100.0
d1eepa_388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 100.0
d2dcfa1388 6-aminohexanoate-dimer hydrolase NylC {Flavobacter 100.0
d2ch1a1388 3-hydroxykynurenine transaminase {Malaria mosquito 100.0
d1gdea_388 Aromatic aminoacid aminotransferase, AroAT {Archae 100.0
d1q8ia1388 Exonuclease domain of family B DNA polymerases {Es 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1j32a_388 Aspartate aminotransferase, AAT {Phormidium lapide 100.0
d2py5a2388 phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 100.0
d1ku0a_388 Lipase L1 {Bacillus stearothermophilus [TaxId: 142 100.0
d1x38a1388 Beta-D-glucan exohydrolase, N-terminal domain {Bar 100.0
d2ex0a1387 Alpha-2,3/2,6-sialyltransferase/sialidase {Pasteur 100.0
d1zeea1387 Hypothetical protein SO4414 {Shewanella oneidensis 100.0
d2aepa1387 Influenza neuraminidase {Influenza A virus, differ 100.0
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 100.0
d1ur4a_387 Beta-1,4-galactanase {Bacillus licheniformis [TaxI 100.0
d1bxba_387 D-xylose isomerase {Thermus aquaticus, subsp. Ther 100.0
d1zsqa2387 Myotubularin-related protein 2, C-terminal domain 100.0
d1vefa1387 Acetylornithine/acetyl-lysine aminotransferase Arg 100.0
d2qp8a1387 beta-secretase (memapsin) {Human (Homo sapiens) [T 100.0
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 100.0
d1v8za1386 Tryptophan synthase, beta-subunit {Archaeon Pyroco 100.0
d1r6ta2386 Tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo 100.0
d1muwa_386 D-xylose isomerase {Streptomyces olivochromogenes 100.0
d3c10a1386 Histone deacetylase 7, HDAC7 {Human (Homo sapiens) 100.0
d1v5da_386 Chitosanase {Bacillus sp., strain k17 [TaxId: 1409 100.0
d1ejxc2385 alpha-subunit of urease, catalytic domain {Klebsie 100.0
d1rrma_385 Lactaldehyde reductase FucO {Escherichia coli [Tax 100.0
d1ir6a_385 Exonuclease RecJ {Thermus thermophilus [TaxId: 274 100.0
d1xmxa_385 Hypothetical protein VC1899 {Vibrio cholerae [TaxI 100.0
d1uhga_385 Ovalbumin {Hen (Gallus gallus) [TaxId: 9031]} 100.0
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 100.0
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 100.0
d2ix0a4385 Exoribonuclease 2, RNB {Escherichia coli [TaxId: 5 100.0
d2c5wb1385 Penicillin-binding protein 1a, transpeptidase doma 100.0
d2b9va2385 Alpha-amino acid ester hydrolase {Acetobacter past 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 100.0
d1cs1a_384 Cystathionine gamma-synthase, CGS {Escherichia col 100.0
d3c0na2384 (Pro)aerolysin, pore-forming lobe {Aeromonas hydro 100.0
d1mtyb_384 Methane monooxygenase hydrolase beta subunit {Meth 100.0
d1b9ha_384 3-amino-5-hydroxybenzoic acid synthase (AHBA synth 100.0
d1hn0a1384 Chondroitin ABC lyase I {Proteus vulgaris [TaxId: 100.0
d2fvka2384 Dihydropyrimidine amidohydrolase Pyd2 {Yeast (Sacc 100.0
d1bs0a_383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 100.0
d1vz6a_383 Glutamate N-acetyltransferase 2 (ornithine acetylt 100.0
d1u7ga_383 Ammonium transporter AmtB {Escherichia coli [TaxId 100.0
d1mhyb_383 Methane monooxygenase hydrolase beta subunit {Meth 100.0
d1bo1a_383 Phosphatidylinositol phosphate kinase IIbeta, PIPK 100.0
d1imva_383 Pigment epithelium-derived factor, PEDF {Human (Ho 100.0
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 100.0
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 100.0
d2ayna1383 Ubiquitin carboxyl-terminal hydrolase 14 {Human (H 100.0
d1t1ua1382 Choline O-acetyltransferase {Rat (Rattus norvegicu 100.0
d2bkwa1382 Alanine-glyoxylate aminotransferase {Baker's yeast 100.0
d1u08a_382 Putative methionine aminotransferase YdbL {Escheri 100.0
d1ea9c3382 Maltogenic amylase, central domain {Bacillus sp., 100.0
d1b5pa_382 Aspartate aminotransferase, AAT {Thermus thermophi 100.0
d1wkva1382 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1xl7a1382 Peroxisomal carnitine O-octanoyltransferase, COT { 100.0
d1wzla3382 Maltogenic amylase, central domain {Thermoactinomy 100.0
d1j0ha3382 Neopullulanase, central domain {Bacillus stearothe 100.0
d2bo4a1381 Mannosylglycerate synthase, MGS {Rhodothermus mari 100.0
d1by7a_381 Plasminogen activator inhibitor-2 {Human (Homo sap 100.0
d1odza_381 Mannanase A, ManA {Pseudomonas cellulosa (Cellvibr 100.0
d1t6ex_381 Xylanase inhibitor TAXI-I {Wheat (Triticum aestivu 100.0
d3bvua3381 Golgi alpha-mannosidase II {Fruit fly (Drosophila 100.0
d1elua_381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 100.0
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 100.0
d1mpxa2381 Alpha-amino acid ester hydrolase {Xanthomonas citr 100.0
d2guya2381 Fungal alpha-amylases {Aspergillus oryzae, Taka-am 100.0
d2aaaa2381 Fungal alpha-amylases {Aspergillus niger, acid amy 100.0
d1ibja_380 Cystathionine beta-lyase, CBL {Thale cress (Arabid 100.0
d1vbga3380 Pyruvate phosphate dikinase, N-terminal domain {Ma 100.0
d1q45a_380 12-oxophytodienoate reductase (OPR, OYE homolog) { 100.0
d1qyia_380 Hypothetical protein MW1667 (SA1546) {Staphylococc 100.0
d1edga_380 Endoglucanase CelA {Clostridium cellulolyticum [Ta 100.0
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 100.0
d1elja_380 D-maltodextrin-binding protein, MBP {Archaeon Pyro 100.0
d1lj5a_379 Plasminogen activator inhibitor-1 {Human (Homo sap 100.0
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 100.0
d3sila_379 Salmonella sialidase {Salmonella typhimurium, stra 100.0
d1jr1a1378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 100.0
d2icya2378 UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale c 100.0
d1xqga_378 Maspin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1jaea2378 Animal alpha-amylase {Yellow mealworm (Tenebrio mo 100.0
d1a59a_377 Citrate synthase {Antarctic bacterium DS2-3R [TaxI 100.0
d1vjoa_377 Alanine-glyoxylate aminotransferase {Cyanobacteria 100.0
d1o6ca_377 UDP-N-acetylglucosamine 2-epimerase {Bacillus subt 100.0
d2d5ja1377 Unsaturated glucuronyl hydrolase {Bacillus sp. GL1 100.0
d1ci9a_377 Esterase EstB {Burkholderia gladioli [TaxId: 28095 100.0
d2i71a1377 Hypothetical protein SSO1389 {Sulfolobus solfatari 100.0
d1jmma_377 V-region of surface antigen I/II (SA I/II, PAC) {S 100.0
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 100.0
d1nm8a1377 Carnitine acetyltransferase {Human (Homo sapiens) 100.0
d1mdoa_376 Aminotransferase ArnB {Salmonella typhimurium [Tax 100.0
d1f6da_376 UDP-N-acetylglucosamine 2-epimerase {Escherichia c 100.0
d2vata1376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 100.0
d1k9oi_376 Alaserpin (serpin 1) {Tobacco hornworm (Manduca se 100.0
d1eg5a_376 NifS-like protein/selenocysteine lyase {Thermotoga 100.0
d2v3qa1376 PstS-like phosphate-binding protein {Human (Homo s 100.0
d1wu4a1376 Xylanase Y {Bacillus halodurans [TaxId: 86665]} 100.0
d1bhea_376 Polygalacturonase {Erwinia carotovora, subsp. caro 100.0
d2fug41375 NADH-quinone oxidoreductase chain 4, Nqo4 {Thermus 100.0
d1o4sa_375 Aspartate aminotransferase, AAT {Thermotoga mariti 100.0
d2dula1375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 100.0
d1kbla3375 Pyruvate phosphate dikinase, N-terminal domain {Cl 100.0
g1hle.1375 Elastase inhibitor {Horse (Equus caballus) [TaxId: 100.0
d1ih7a1375 Exonuclease domain of family B DNA polymerases {Ba 100.0
d1txka2374 Glucans biosynthesis protein G (MdoG, OpgG), N-ter 100.0
d1ioma_374 Citrate synthase {Thermus thermophilus [TaxId: 274 100.0
d1gwja_374 Morphinone reductase {Pseudomonas putida [TaxId: 3 100.0
d2a0ua1374 Initiation factor 2b {Leishmania major [TaxId: 566 100.0
d1o69a_374 Aminotransferase homolog WlaK (PglE, Cj1121c) {Cam 100.0
d1nd7a_374 WW domain-containing protein 1, WWP1 {Human (Homo 100.0
d1rp4a_374 Endoplasmic oxidoreductin 1, Ero1p {Baker's yeast 100.0
d1so7a_374 Sialidase 2 (Neu2) {Human (Homo sapiens) [TaxId: 9 100.0
d2bvca2374 Glutamine synthetase, C-terminal domain {Mycobacte 100.0
d1kfwa1374 Psychrophilic chitinase B {Arthrobacter sp., tad20 100.0
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 100.0
d1v4va_373 UDP-N-acetylglucosamine 2-epimerase {Thermus therm 100.0
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 100.0
d1ogmx2373 Dextranase, catalytic domain {Penicillium miniolut 100.0
d1qo0a_373 Amide receptor/negative regulator of the amidase o 100.0
d1miqa_373 Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo 100.0
d1m0wa2373 Eukaryotic glutathione synthetase ATP-binding doma 100.0
d1r5ya_372 Queosine tRNA-guanine transglycosylase {Zymomonas 100.0
d1c3pa_372 HDAC homologue {Aquifex aeolicus [TaxId: 63363]} 100.0
d1j58a_372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 100.0
d1noya_372 Exonuclease domain of family B DNA polymerases {Ba 100.0
d1qlpa_372 Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 100.0
d1vkpa_372 Agmatine iminohydrolase {Thale-cress (Arabidopsis 100.0
g1htr.1372 Pepsin(ogen) {Human (Homo sapiens), progastricsin 100.0
d1teda_372 Polyketide synthase PKS18 {Mycobacterium tuberculo 100.0
d1mkfa_371 Viral chemokine binding protein m3 {Murid herpesvi 100.0
d1r53a_371 Chorismate synthase, AroC {Baker's yeast (Saccharo 100.0
d1to6a_371 Glycerate kinase GlxK {Neisseria meningitidis, (se 100.0
d1aj8a_371 Citrate synthase {Archaeon Pyrococcus furiosus [Ta 100.0
d1c8ba_371 Germination protease {Bacillus megaterium [TaxId: 100.0
d1n7oa1371 Hyaluronate lyase {Streptococcus pneumoniae [TaxId 100.0
d1f1sa1371 Hyaluronate lyase {Streptococcus agalactiae [TaxId 100.0
d1eg1a_371 Cellobiohydrolase I (cellulase, Endoglucanase I, C 100.0
d1r85a_371 Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d2fnua1371 Spore coat polysaccharide biosynthesis protein C { 100.0
d2dexx3370 Peptidylarginine deiminase Pad4, catalytic C-termi 100.0
d2hgsa4370 Eukaryotic glutathione synthetase ATP-binding doma 100.0
d2gx8a1370 Nif3-related protein BC4286 {Bacillus cereus [TaxI 100.0
d2iw1a1370 Lipopolysaccharide core biosynthesis protein RfaG 100.0
d3psga_370 Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} 100.0
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 100.0
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 100.0
d1rh9a1370 Beta-mannanase {Tomato (Lycopersicon esculentum) [ 100.0
d1iq0a2370 Arginyl-tRNA synthetase (ArgRS) {Thermus thermophi 100.0
d1itua_369 Renal dipeptidase {Human (Homo sapiens) [TaxId: 96 100.0
d1rwha1369 Chondroitinase AC {Arthrobacter aurescens [TaxId: 100.0
d2ewoa1369 Agmatine iminohydrolase {Streptococcus mutans [Tax 100.0
d2heka1369 Hypothetical protein aq_1910 {Aquifex aeolicus [Ta 100.0
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 100.0
g1as4.1369 Antichymotrypsin, alpha-1 {Human (Homo sapiens) [T 100.0
d1ga6a_369 Serine-carboxyl proteinase, SCP {Pseudomonas sp., 100.0
d1laxa_369 D-maltodextrin-binding protein, MBP {Escherichia c 100.0
d1e7ua4369 Phoshoinositide 3-kinase (PI3K), catalytic domain 100.0
d2ncda_368 Kinesin motor Ncd (non-claret disjunctional) {Frui 100.0
d1r8ga_368 Carboxylate-amine ligase YbdK {Escherichia coli [T 100.0
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 100.0
d2cu0a1368 Inosine monophosphate dehydrogenase (IMPDH) {Pyroc 100.0
d1v2da_368 Glutamine aminotransferase {Thermus thermophilus [ 100.0
d1pyya4368 Penicillin-binding protein 2x (pbp-2x), transpepti 100.0
d1f52a2368 Glutamine synthetase, C-terminal domain {Salmonell 100.0
d1qw9a2367 Alpha-L-arabinofuranosidase, catalytic domain {Bac 100.0
d1o7xa_367 Citrate synthase {Archaeon Sulfolobus solfataricus 100.0
d1d3ga_367 Dihydroorotate dehydrogenase {Human (Homo sapiens) 100.0
d1ursa_367 D-maltodextrin-binding protein, MBP {Alicyclobacil 100.0
d1b65a_367 L-aminopeptidase D-Ala-esterase/amidase DmpA {Ochr 100.0
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 100.0
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 100.0
d1iuqa_367 Glycerol-3-phosphate (1)-acyltransferase {Cushaw s 100.0
d1hz4a_366 Transcription factor MalT domain III {Escherichia 100.0
d1moqa_366 "Isomerase domain" of glucosamine 6-phosphate synt 100.0
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 100.0
d1h6za1366 Pyruvate phosphate dikinase, C-terminal domain {Tr 100.0
d2bvya2366 Mannanase A, ManA {Cellulomonas fimi [TaxId: 1708] 100.0
d1u5ua_366 Allene oxide synthase-lipoxygenase protein, N-term 100.0
d1jq5a_366 Glycerol dehydrogenase {Bacillus stearothermophilu 100.0
d2aeua1366 Hypothetical protein MJ0158 {Archaeon Methanococcu 100.0
d1fn9a_365 Outer capsid protein sigma 3 {Reovirus [TaxId: 108 100.0
d1w85a_365 Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus st 100.0
d1zfja1365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 100.0
d1um0a_365 Chorismate synthase, AroC {Helicobacter pylori [Ta 100.0
d2pnwa1365 Membrane-bound lytic murein transglycosylase A, ML 100.0
d1zkda1365 Hypothetical protein RPA4359 {Rhodopseudomonas pal 100.0
d3c8ya1365 Fe-only hydrogenase, catalytic domain {Clostridium 100.0
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 100.0
d1u1ha2365 5-methyltetrahydropteroyltriglutamate--homocystein 100.0
d1w0pa3364 Vibrio cholerae sialidase {Vibrio cholerae [TaxId: 100.0
d1t64a_364 Histone deacetylase 8, HDAC8 {Human (Homo sapiens) 100.0
d2jera1364 Agmatine iminohydrolase {Enterococcus faecalis [Ta 100.0
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 100.0
d1icpa_364 12-oxophytodienoate reductase (OPR, OYE homolog) { 100.0
d1sdma_364 Kinesin heavy chain-like protein {Potato (Solanum 100.0
d1kbla1364 Pyruvate phosphate dikinase, C-terminal domain {Cl 100.0
d1kq3a_364 Glycerol dehydrogenase {Thermotoga maritima [TaxId 100.0
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d1oc7a_364 Cellobiohydrolase II (Cel6) {Humicola insolens, Ce 100.0
d1us3a2364 Xylanase 10c {Cellvibrio japonicus [TaxId: 155077] 100.0
d2e7ja1364 Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl 100.0
d1m7va_363 Nitric oxide (NO) synthase oxygenase domain {Bacil 100.0
d1zaia1363 Fructose-1,6-bisphosphate aldolase {Rabbit (Orycto 100.0
d1khba1363 Cytosolic phosphoenolpyruvate carboxykinase (GTP-h 100.0
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 100.0
d1zq1a2363 Glutamyl-tRNA(Gln) amidotransferase subunit D, Gat 100.0
d1cnza_363 3-isopropylmalate dehydrogenase, IPMDH {Salmonella 100.0
d1vyra_363 Pentaerythritol tetranirate reductase {Enterobacte 100.0
d1onha_363 AMPC beta-Lactamase, class C {Enterobacter cloacae 100.0
d1nc5a_363 Hypothetical protein YteR {Bacillus subtilis [TaxI 100.0
d1kwfa_363 CelA cellulase {Clostridium thermocellum [TaxId: 1 100.0
d2a1ha1363 Branched-chain aminoacid aminotransferase {Human ( 100.0
d1umga_362 ST0318 {Archaeon Sulfolobus tokodaii [TaxId: 11195 100.0
d1gqea_362 Polypeptide chain release factor 2 (RF2) {Escheric 100.0
d1umda_362 Branched-chain alpha-keto acid dehydrogenase, PP m 100.0
d3thia_362 Thiaminase I {Paenibacillus thiaminolyticus [TaxId 100.0
d2pl5a1362 Homoserine O-acetyltransferase {Leptospira interro 100.0
d1pvna1362 Inosine monophosphate dehydrogenase (IMPDH) {Tritr 100.0
d1nqka_362 Alkanesulfonate monooxygenase SsuD {Escherichia co 100.0
d1v8ka_362 Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 100.0
d1vlca_362 3-isopropylmalate dehydrogenase, IPMDH {Thermotoga 100.0
d1svma_362 Papillomavirus large T antigen helicase domain {Si 100.0
d2drwa1362 D-Amino acid amidase DaaA {Ochrobactrum anthropi [ 100.0
d2gjxa1362 beta-hexosaminidase A {Human (Homo sapiens) [TaxId 100.0
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 100.0
d1qjwa_362 Cellobiohydrolase II (Cel6) {Trichoderma reesei, C 100.0
d2ozla1361 E1-beta subunit of pyruvate dehydrogenase (PP modu 100.0
d1x1ia1361 Xanthan lyase {Bacillus sp. gl1 [TaxId: 84635]} 100.0
d2c0ra1361 Phosphoserine aminotransferase, PSAT {Bacillus cir 100.0
d1dhsa_361 Deoxyhypusine synthase, DHS {Human (Homo sapiens) 100.0
d1m32a_361 2-aminoethylphosphonate transaminase {Salmonella t 100.0
d1lt7a_361 Betaine-homocysteine S-methyltransferase {Human (H 100.0
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 100.0
d1d2fa_361 Modulator in mal gene expression, MalY {Escherichi 100.0
d1pe9a_361 Pectate lyase {Erwinia chrysanthemi, type A [TaxId 100.0
d1mxga2361 Bacterial alpha-amylase {Archaeon Pyrococcus woese 100.0
d1rqga2361 Methionyl-tRNA synthetase (MetRS) {Pyrococcus abys 100.0
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 100.0
d1sq1a_360 Chorismate synthase, AroC {Campylobacter jejuni [T 100.0
d1qo5a_360 Fructose-1,6-bisphosphate aldolase {Human (Homo sa 100.0
d1bjna_360 Phosphoserine aminotransferase, PSAT {Escherichia 100.0
d1w23a_360 Phosphoserine aminotransferase, PSAT {Bacillus alc 100.0
d1jdwa_360 L-arginine: glycine amidinotransferase {Human (Hom 100.0
d1xfia_360 Hypothetical protein At2g17340 {Thale cress (Arabi 100.0
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 100.0
d1oxwa_360 Patatin {Heartleaf nightshade (Solanum cardiophyll 100.0
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 100.0
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 100.0
d4bcla_359 Bacteriochlorophyll A protein {Prosthecochloris ae 100.0
d1goxa_359 Glycolate oxidase {Spinach (Spinacia oleracea) [Ta 100.0
d1x74a1359 2-methylacyl-CoA racemase Mcr {Mycobacterium tuber 100.0
d1o2da_359 Alcohol dehydrogenase TM0920 {Thermotoga maritima 100.0
d1m6ex_359 Salicylic acid carboxyl methyltransferase (SAMT) { 100.0
d1yvra1359 60-kda SS-aARo ribonucleoprotein {African clawed f 100.0
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 100.0
d2hrca1359 Ferrochelatase {Human (Homo sapiens) [TaxId: 9606] 100.0
d1idka_359 Pectin lyase {Aspergillus niger, type A [TaxId: 50 100.0
d1qcxa_359 Pectin lyase {Aspergillus niger, type B [TaxId: 50 100.0
d1m7ja3358 N-acyl-D-aminoacid amidohydrolase, catalytic domai 100.0
g1lq8.1358 Protein C inhibitor {Human (Homo sapiens) [TaxId: 100.0
d2hdsa1358 AMPC beta-Lactamase, class C {Escherichia coli, ce 100.0
d1ecea_358 Endocellulase E1 {Acidothermus cellulolyticus [Tax 100.0
d1dosa_358 Fructose-bisphosphate aldolase (FBP aldolase) {Esc 100.0
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 100.0
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 100.0
d1edqa2358 Chitinase A, catalytic domain {Serratia marcescens 100.0
d2qapa1357 Fructose-1,6-bisphosphate aldolase {Trypanosome (L 100.0
d1taza_357 Catalytic domain of cyclic nucleotide phosphodiest 100.0
d2b61a1357 Homoserine O-acetyltransferase {Haemophilus influe 100.0
d1yyda1357 Fungal peroxidase (ligninase) {Basidomycetos fungu 100.0
d1a05a_357 3-isopropylmalate dehydrogenase, IPMDH {Thiobacill 100.0
d1gcya2357 G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase 100.0
d1t1ga_357 Serine-carboxyl proteinase, SCP {Bacillus novosp. 100.0
d2amxa1357 Adenosine deaminase (ADA) {Plasmodium yoelii [TaxI 100.0
d1mppa_357 Pepsin {Mucor pusillus [TaxId: 4840]} 100.0
d1g01a_357 Alkaline cellulase K catalytic domain {Bacillus sp 100.0
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 100.0
d16vpa_356 Conserved core of transcriptional regulatory prote 100.0
d1r3sa_356 Uroporphyrinogen decarboxylase, UROD {Human (Homo 100.0
d1lbqa_356 Ferrochelatase {Baker's yeast (Saccharomyces cerev 100.0
d1l0wa3356 Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph 100.0
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 100.0
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 100.0
d2ebsa2356 Oligoxyloglucan reducing end-specific cellobiohydr 100.0
d1v53a1356 3-isopropylmalate dehydrogenase, IPMDH {Bacillus c 100.0
d1jaka1356 beta-N-acetylhexosaminidase {Streptomyces plicatus 100.0
d1w8oa3356 Micromonospora sialidase, N-terminal domain {Micro 100.0
d1vbga1356 Pyruvate phosphate dikinase, C-terminal domain {Ma 100.0
d1goia2356 Chitinase B, catalytic domain {Serratia marcescens 100.0
d3bu7a1355 Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ 100.0
d1jbqa_355 Cystathionine beta-synthase {Human (Homo sapiens) 100.0
g1mtp.1355 Thermopin {Thermobifida fusca [TaxId: 2021]} 100.0
d1luca_355 Bacterial luciferase alpha chain, LuxA {Vibrio har 100.0
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 100.0
d1fuia2355 L-fucose isomerase, N-terminal and second domains 100.0
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1lc5a_355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 100.0
>d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Amylase, catalytic domain
domain: Glycosyltrehalose trehalohydrolase, central domain
species: Deinococcus radiodurans [TaxId: 1299]
Probab=100.00  E-value=0  Score=31721.26  Aligned_cols=1  Identities=0%  Similarity=-0.393  Sum_probs=0.0

Q ss_pred             E-------------------------------------------------------------------------------
Q ss_conf             7-------------------------------------------------------------------------------
Q 002632          518 R-------------------------------------------------------------------------------  518 (898)
Q Consensus       518 k-------------------------------------------------------------------------------  518 (898)
                      -                                                                               
T Consensus         1 ~~~w~~~~~~~~~~~~~viYe~~~~~f~~~Gd~~g~~~~ldyl~~LGv~~i~L~Pv~~~~~~~~~GY~~~d~~~vdp~~G   80 (420)
T d2bhua3           1 TFDWTDADWHGIKLADCVFYEVHVGTFTPEGTYRAAAEKLPYLKELGVTAIQVMPLAAFDGQRGWGYDGAAFYAPYAPYG   80 (420)
T ss_dssp             SSCCCCTTCCCCCGGGCCEEEECHHHHSSSCSHHHHHHTHHHHHHHTCCEEEECCCEECSSSCCCSTTCCEEEEECGGGC
T ss_pred             CCCCCCCCCCCCCCCCCEEEEEEHHHCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             96899989798884224899996002188999999998679999769998995998768888998888566888685659


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q 002632          519 --------------------------------------------------------------------------------  518 (898)
Q Consensus       519 --------------------------------------------------------------------------------  518 (898)
                                                                                                      
T Consensus        81 ~~~d~~~lv~~aH~~gi~VilD~V~NH~~~~~~~~~~~~~~~~~~~~~~~~~~dlN~~np~v~~~~~~~~~~Wl~~~GVD  160 (420)
T d2bhua3          81 RPEDLMALVDAAHRLGLGVFLDVVYNHFGPSGNYLSSYAPSYFTDRFSSAWGMGLDYAEPHMRRYVTGNARMWLRDYHFD  160 (420)
T ss_dssp             CHHHHHHHHHHHHHTTCEEEEEECCSCCCSSSCCHHHHCGGGEEEEEECSSSEEECTTSHHHHHHHHHHHHHHHHHHCCS
T ss_pred             CHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHEEEECCCCC
T ss_conf             99999999999974054534465535667777633334443334554322345545368699999988764032014653


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q 002632          519 --------------------------------------------------------------------------------  518 (898)
Q Consensus       519 --------------------------------------------------------------------------------  518 (898)
                                                                                                      
T Consensus       161 GfR~D~~~~l~~~~~~~~~~~~~~~~~~~~p~~~~i~E~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  240 (420)
T d2bhua3         161 GLRLDATPYMTDDSETHILTELAQEIHELGGTHLLLAEDHRNLPDLVTVNHLDGIWTDDFHHETRVTLTGEQEGYYAGYR  240 (420)
T ss_dssp             EEEETTGGGCCCCSSSCHHHHHHHHHHTTCSCCEEEEECSSCCTHHHHTTCCSEEECTHHHHHHHHHHHCCCSGGGGGCC
T ss_pred             EEEEEEEEEECCCCCCCCHHHHHHHHHHHCCCCEEEECCCCCCHHHHCCCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCC
T ss_conf             78873333202122310079998888764687425620357753121001125422323210444301334445312330


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q 002632          519 --------------------------------------------------------------------------------  518 (898)
Q Consensus       519 --------------------------------------------------------------------------------  518 (898)
                                                                                                      
T Consensus       241 ~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~nHD~~~~~~~~~r~~~~~~~~~~~~k~a~~~ll  320 (420)
T d2bhua3         241 GGAEALAYTIRRGWRYEGQFWAVKGEEHERGHPSDALEAPNFVYCIQNHDQIGNRPLGERLHQSDGVTLHEYRGAAALLL  320 (420)
T ss_dssp             CSHHHHHHHHHHSSSCEEEEECCTTCCEEEECCCTTCCGGGEEEESCCHHHHHTSTTCCCGGGSTTCCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCCCCCHHHHHCHHHHHCCCCCCCCHHHEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             26678999985144446520443153554126433455213034321566323553112356643565999999999998


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q 002632          519 --------------------------------------------------------------------------------  518 (898)
Q Consensus       519 --------------------------------------------------------------------------------  518 (898)
                                                                                                      
T Consensus       321 t~pG~P~iy~GdEig~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~~~  400 (420)
T d2bhua3         321 TLPMTPLLFQGQEWAASTPFQFFSDHAGELGQAVSEGRKKEFGGFSGFSGEDVPDPQAEQTFLNSKLNWAEREGGEHART  400 (420)
T ss_dssp             HSSSEEEEETTGGGTCSSCCCCCCCCCHHHHHHHHHHHHHHC---------CCCCTTSHHHHHTTSCCSGGGGSHHHHHH
T ss_pred             HCCCCCEEECCHHHCCCCCCCCCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCHHH
T ss_conf             48998798577511789986323456402203544466311367776665557886555544456678788623476899


Q ss_pred             -------------------E
Q ss_conf             -------------------7
Q 002632          519 -------------------G  519 (898)
Q Consensus       519 -------------------a  519 (898)
                                         -
T Consensus       401 ~~~yr~Li~lRk~~p~l~~~  420 (420)
T d2bhua3         401 LRLYRDLLRLRREDPVLHNR  420 (420)
T ss_dssp             HHHHHHHHHHHHHCTTTTCC
T ss_pred             HHHHHHHHHHHHCCHHHHCC
T ss_conf             99999999999568987575



>d2df7a1 b.121.4.9 (A:11-429) Birnavirus VP2 {Infectious bursal disease virus [TaxId: 10995]} Back     information, alignment and structure
>d1ejda_ d.68.2.2 (A:) UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ) {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1om4a_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gp4a2 d.334.1.1 (A:1-418) 6-phosphogluconate dehydratase EDD {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure
>d1f61a_ c.1.12.7 (A:) Isocitrate lyase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3bona1 d.92.1.7 (A:3-419) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]} Back     information, alignment and structure
>d1q7ea_ c.123.1.1 (A:) Hypothetical protein YfdW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2csga1 b.82.2.12 (A:3-419) Hypothetical protein YbiU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1gff1_ b.121.5.1 (1:) Microvirus capsid proteins {Bacteriophage G4 [TaxId: 10843]} Back     information, alignment and structure
>d1w6ga1 b.30.2.1 (A:212-628) Copper amine oxidase, domain 3 {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1ltka_ c.86.1.1 (A:) Phosphoglycerate kinase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1vema2 c.1.8.1 (A:1-417) Bacterial beta-amylase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1q2oa_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d8wa_ c.1.15.2 (A:) L-rhamnose isomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1igwa_ c.1.12.7 (A:) Isocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vnud4 b.40.4.16 (D:495-910) Exosome complex exonuclease RRP44 {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1pb1a_ c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dnva_ b.121.5.3 (A:) Densovirus capsid protein {Galleria mellonella densovirus [TaxId: 37138]} Back     information, alignment and structure
>d1so2a_ a.211.1.2 (A:) cGMP-inhibited 3',5'-cyclic phosphodiesterase B, pde3b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ieaa2 c.36.1.10 (A:56-470) Pyruvate dehydrogenase E1 component, PP module {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d16pka_ c.86.1.1 (A:) Phosphoglycerate kinase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1qpga_ c.86.1.1 (A:) Phosphoglycerate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qeec1 c.1.9.8 (C:2-416) Uncharacterized protein BH0493 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1s5ja2 e.8.1.1 (A:450-864) Family B DNA polymerase {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1kbia1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b8na1 c.118.1.1 (A:4-417) Putative glycerate kinase (hypothetical protein TM1585) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o20a_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t0la_ c.77.1.1 (A:) NADP-dependent isocitrate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vh4a_ b.80.6.1 (A:) Stabilizer of iron transporter SufD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdia_ c.86.1.1 (A:) Phosphoglycerate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2qgma1 c.150.1.3 (A:33-445) Succinoglycan biosynthesis protein BC3205 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1lwda_ c.77.1.1 (A:) NADP-dependent isocitrate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1zjca1 e.60.1.1 (A:3-415) Aminopeptidase S, AMPS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ulva1 a.102.1.5 (A:274-686) Glucodextranase, domain A {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1a0tp_ f.4.3.2 (P:) Sucrose-specific porin {Enterobacterium (Salmonella typhimurium) [TaxId: 90371]} Back     information, alignment and structure
>d1ocka_ c.117.1.1 (A:) Malonamidase E2 {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1yzya1 c.146.1.1 (A:1-412) Hypothetical protein HI1011 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1rxxa_ d.126.1.4 (A:) Arginine deiminase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d1ufaa2 c.6.2.4 (A:1-412) Hypothetical protein TT1467, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t3ca_ d.92.1.7 (A:) Botulinum neurotoxin {Clostridium botulinum, serotype E [TaxId: 1491]} Back     information, alignment and structure
>d2afaa1 a.102.1.3 (A:4-415) Putative NAG isomerase YihS {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ux5a_ a.207.1.1 (A:) Bni1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ccaa1 a.93.1.3 (A:26-435) Catalase-peroxidase KatG {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p1ja1 c.2.1.3 (A:9-322,A:438-533) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kfsa2 e.8.1.1 (A:519-928) DNA polymerase I (Klenow fragment) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d1s5ja1 c.55.3.5 (A:40-449) Exonuclease domain of family B DNA polymerases {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2cmza1 e.76.1.2 (A:1-409) Spike glycoprotein {Vesicular stomatitis indiana virus [TaxId: 11277]} Back     information, alignment and structure
>d2g0da1 a.102.6.1 (A:7-415) Nisin biosynthesis protein NisC {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1tv5a1 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1qtma2 e.8.1.1 (A:423-831) DNA polymerase I (Klenow fragment) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1b25a1 a.110.1.1 (A:211-619) Formaldehyde ferredoxin oxidoreductase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1s9ra_ d.126.1.4 (A:) Arginine deiminase {Mycoplasma arginini [TaxId: 2094]} Back     information, alignment and structure
>d1dkla_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} Back     information, alignment and structure
>d1r76a_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Azospirillum irakense [TaxId: 34011]} Back     information, alignment and structure
>d1f1oa_ a.127.1.1 (A:) Adenylosuccinate lyase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2hhva2 e.8.1.1 (A:469-876) DNA polymerase I (Klenow fragment) {Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId: 1422]} Back     information, alignment and structure
>d1qs0a_ c.36.1.11 (A:) 2-oxoisovalerate dehydrogenase (E1B), PP module {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1eu8a_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Back     information, alignment and structure
>d1itka1 a.93.1.3 (A:18-423) Catalase-peroxidase KatG {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1mwva1 a.93.1.3 (A:35-440) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ei6a_ c.76.1.4 (A:) Phosphonoacetate hydrolase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1ub2a1 a.93.1.3 (A:21-426) Catalase-peroxidase KatG {Synechococcus sp. pcc 7942 [TaxId: 1140]} Back     information, alignment and structure
>d2ayia1 e.60.1.1 (A:3-408) Aminopeptidase T {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Back     information, alignment and structure
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2nwwa1 f.49.1.1 (A:12-416) Proton glutamate symport protein {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1h6za3 d.142.1.5 (A:1-405) Pyruvate phosphate dikinase, N-terminal domain {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d2b5dx2 c.6.2.4 (X:1-404) Alpha-amylase AmyC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h12a_ a.102.1.2 (A:) Endo-1,4-beta-xylanase {Pseudoalteromonas haloplanktis [TaxId: 228]} Back     information, alignment and structure
>d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uyra2 c.14.1.4 (A:1815-2218) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1xksa_ b.69.14.1 (A:) Nuclear pore complex protein Nup133 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3b55a1 c.150.1.3 (A:40-442) Succinoglycan biosynthesis protein BC3120 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1dofa_ a.127.1.1 (A:) Adenylosuccinate lyase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2g5da1 b.52.1.4 (A:40-441) Membrane-bound lytic murein transglycosylase A, MLTA {Neisseria gonorrhoeae [TaxId: 485]} Back     information, alignment and structure
>d1xk7a1 c.123.1.1 (A:4-405) Crotonobetainyl-CoA:carnitine CoA-transferase, CaiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1fp3a_ a.102.1.3 (A:) N-acyl-D-glucosamine 2-epimerase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1a12a_ b.69.5.1 (A:) Regulator of chromosome condensation RCC1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jdpa_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
>d2h6fb1 a.102.4.3 (B:521-921) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2r7da2 b.40.4.16 (A:3-403) Ribonuclease II family protein DR0020 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d3ovwa_ b.29.1.10 (A:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Fusarium oxysporum [TaxId: 5507]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ru4a_ b.80.1.9 (A:) Pectate transeliminase {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1inpa_ e.7.1.1 (A:) Inositol polyphosphate 1-phosphatase {Cow (Bos taurus), brain [TaxId: 9913]} Back     information, alignment and structure
>d2olua2 e.3.1.1 (A:293-692) Penicillin-binding protein 2, PBP2 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1oyaa_ c.1.4.1 (A:) Old yellow enzyme (OYE) {Lager yeast (Saccharomyces pastorianus) [TaxId: 27292]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d2ah2a2 b.68.1.1 (A:1-399) Trypanosoma sialidase {Parasitic flagellate protozoan (Trypanosoma cruzi) [TaxId: 5693]} Back     information, alignment and structure
>d1bn8a_ b.80.1.1 (A:) Pectate lyase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1vpea_ c.86.1.1 (A:) Phosphoglycerate kinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vlja_ e.22.1.2 (A:) NADH-dependent butanol dehydrogenase A (TM0820) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]} Back     information, alignment and structure
>d1q1la_ d.258.1.1 (A:) Chorismate synthase, AroC {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1vkoa1 c.2.1.3 (A:11-314,A:429-521) Myo-inositol 1-phosphate synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vjva_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lf6a1 a.102.1.5 (A:288-684) Bacterial glucoamylase, C-terminal domain {Thermoanaerobacterium thermosaccharolyticum [TaxId: 1517]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1io1a_ e.32.1.1 (A:) Phase 1 flagellin {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2bfda1 c.36.1.11 (A:6-400) Branched-chain alpha-keto acid dehydrogenase, PP module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nw1a_ d.144.1.8 (A:) Choline kinase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1aora1 a.110.1.1 (A:211-605) Aldehyde ferredoxin oxidoreductase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w36b2 c.37.1.19 (B:486-880) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1phpa_ c.86.1.1 (A:) Phosphoglycerate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e5ea_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL1 [TaxId: 5722]} Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1u1ha1 c.1.22.2 (A:2-395) 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase MetE {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1atia2 d.104.1.1 (A:1-394) Glycyl-tRNA synthetase (GlyRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1q8ia2 e.8.1.1 (A:390-783) Family B DNA polymerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Back     information, alignment and structure
>d1ldja2 a.118.17.1 (A:17-410) Cullin homolog 1, Cul-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1n8pa_ c.67.1.3 (A:) Cystathionine gamma-lyase (CYS3) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xlma_ c.1.15.3 (A:) D-xylose isomerase {Arthrobacter, strain b3728 [TaxId: 1663]} Back     information, alignment and structure
>d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g8ma2 c.97.1.4 (A:201-593) AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} Back     information, alignment and structure
>d1gc0a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1yvua2 c.55.3.10 (A:315-706) Argonaute homologue Aq_1447 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2d0ta1 a.266.1.2 (A:12-403) Indoleamine 2,3-dioxygenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xima_ c.1.15.3 (A:) D-xylose isomerase {Actinoplanes missouriensis [TaxId: 1866]} Back     information, alignment and structure
>d1cl1a_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1nt4a_ c.60.1.2 (A:) Glucose-1-phosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d4ubpc2 c.1.9.2 (C:132-434,C:484-570) alpha-subunit of urease, catalytic domain {Bacillus pasteurii [TaxId: 1474]} Back     information, alignment and structure
>d1v6sa_ c.86.1.1 (A:) Phosphoglycerate kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nsca_ b.68.1.1 (A:) Influenza neuraminidase {Influenza B virus, different strains [TaxId: 11520]} Back     information, alignment and structure
>d1qopb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1oj7a_ e.22.1.2 (A:) Hypothetical oxidoreductase yqhD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Back     information, alignment and structure
>d1e9yb2 c.1.9.2 (B:132-431,B:481-569) alpha-subunit of urease, catalytic domain {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1sg6a_ e.22.1.1 (A:) Dehydroquinate synthase, DHQS {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jiha2 e.8.1.7 (A:1-389) DNA polymerase eta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2o3ia1 e.73.1.1 (A:2-390) Hypothetical protein CV3147 {Chromobacterium violaceum [TaxId: 536]} Back     information, alignment and structure
>d1f8ea_ b.68.1.1 (A:) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]} Back     information, alignment and structure
>d1u7la_ e.57.1.1 (A:) Vacuolar ATP synthase subunit C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qxoa_ d.258.1.1 (A:) Chorismate synthase, AroC {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d2dcfa1 e.3.1.1 (A:5-392) 6-aminohexanoate-dimer hydrolase NylC {Flavobacterium sp. [TaxId: 239]} Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1q8ia1 c.55.3.5 (A:2-389) Exonuclease domain of family B DNA polymerases {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d2py5a2 e.8.1.1 (A:188-575) phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 10756]} Back     information, alignment and structure
>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1x38a1 c.1.8.7 (A:1-388) Beta-D-glucan exohydrolase, N-terminal domain {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
>d2ex0a1 c.87.1.9 (A:26-412) Alpha-2,3/2,6-sialyltransferase/sialidase {Pasteurella multocida [TaxId: 747]} Back     information, alignment and structure
>d1zeea1 a.266.1.2 (A:6-392) Hypothetical protein SO4414 {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure
>d2aepa1 b.68.1.1 (A:83-469) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d1bxba_ c.1.15.3 (A:) D-xylose isomerase {Thermus aquaticus, subsp. Thermophilus [TaxId: 271]} Back     information, alignment and structure
>d1zsqa2 c.45.1.3 (A:199-585) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qp8a1 b.50.1.2 (A:60-446) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1v8za1 c.79.1.1 (A:1-386) Tryptophan synthase, beta-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r6ta2 c.26.1.1 (A:82-467) Tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1muwa_ c.1.15.3 (A:) D-xylose isomerase {Streptomyces olivochromogenes [TaxId: 1963]} Back     information, alignment and structure
>d3c10a1 c.42.1.2 (A:515-900) Histone deacetylase 7, HDAC7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5da_ a.102.1.2 (A:) Chitosanase {Bacillus sp., strain k17 [TaxId: 1409]} Back     information, alignment and structure
>d1ejxc2 c.1.9.2 (C:1130-1422,C:1476-1567) alpha-subunit of urease, catalytic domain {Klebsiella aerogenes [TaxId: 28451]} Back     information, alignment and structure
>d1rrma_ e.22.1.2 (A:) Lactaldehyde reductase FucO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ir6a_ c.107.1.2 (A:) Exonuclease RecJ {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xmxa_ c.52.1.26 (A:) Hypothetical protein VC1899 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1uhga_ e.1.1.1 (A:) Ovalbumin {Hen (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ix0a4 b.40.4.16 (A:173-557) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c5wb1 e.3.1.1 (B:266-650) Penicillin-binding protein 1a, transpeptidase domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1cs1a_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c0na2 f.8.1.1 (A:85-468) (Pro)aerolysin, pore-forming lobe {Aeromonas hydrophila [TaxId: 644]} Back     information, alignment and structure
>d1mtyb_ a.25.1.2 (B:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]} Back     information, alignment and structure
>d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Back     information, alignment and structure
>d1hn0a1 a.102.3.2 (A:235-618) Chondroitin ABC lyase I {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d2fvka2 c.1.9.6 (A:57-440) Dihydropyrimidine amidohydrolase Pyd2 {Yeast (Saccharomyces kluyveri) [TaxId: 4934]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vz6a_ d.154.1.2 (A:) Glutamate N-acetyltransferase 2 (ornithine acetyltransferase) {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1u7ga_ f.44.1.1 (A:) Ammonium transporter AmtB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mhyb_ a.25.1.2 (B:) Methane monooxygenase hydrolase beta subunit {Methylosinus trichosporium [TaxId: 426]} Back     information, alignment and structure
>d1bo1a_ d.143.1.2 (A:) Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1imva_ e.1.1.1 (A:) Pigment epithelium-derived factor, PEDF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ayna1 d.3.1.9 (A:100-482) Ubiquitin carboxyl-terminal hydrolase 14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ua1 c.43.1.3 (A:20-401) Choline O-acetyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wkva1 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (Cysteine synthase) {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1xl7a1 c.43.1.3 (A:11-392) Peroxisomal carnitine O-octanoyltransferase, COT {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Back     information, alignment and structure
>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2bo4a1 c.68.1.18 (A:2-382) Mannosylglycerate synthase, MGS {Rhodothermus marinus [TaxId: 29549]} Back     information, alignment and structure
>d1by7a_ e.1.1.1 (A:) Plasminogen activator inhibitor-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1odza_ c.1.8.3 (A:) Mannanase A, ManA {Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId: 155077]} Back     information, alignment and structure
>d1t6ex_ b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure
>d3bvua3 c.6.2.1 (A:31-411) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} Back     information, alignment and structure
>d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Back     information, alignment and structure
>d1ibja_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vbga3 d.142.1.5 (A:3-382) Pyruvate phosphate dikinase, N-terminal domain {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1q45a_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR3 [TaxId: 3702]} Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1elja_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1lj5a_ e.1.1.1 (A:) Plasminogen activator inhibitor-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d3sila_ b.68.1.1 (A:) Salmonella sialidase {Salmonella typhimurium, strain lt2 [TaxId: 90371]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1xqga_ e.1.1.1 (A:) Maspin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} Back     information, alignment and structure
>d1a59a_ a.103.1.1 (A:) Citrate synthase {Antarctic bacterium DS2-3R [TaxId: 56673]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure
>d1o6ca_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2d5ja1 a.102.1.7 (A:1-377) Unsaturated glucuronyl hydrolase {Bacillus sp. GL1 [TaxId: 84635]} Back     information, alignment and structure
>d1ci9a_ e.3.1.1 (A:) Esterase EstB {Burkholderia gladioli [TaxId: 28095]} Back     information, alignment and structure
>d2i71a1 e.72.1.1 (A:1-377) Hypothetical protein SSO1389 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1jmma_ b.30.6.1 (A:) V-region of surface antigen I/II (SA I/II, PAC) {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1nm8a1 c.43.1.3 (A:9-385) Carnitine acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1f6da_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d1k9oi_ e.1.1.1 (I:) Alaserpin (serpin 1) {Tobacco hornworm (Manduca sexta) [TaxId: 7130]} Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2v3qa1 c.94.1.1 (A:1-376) PstS-like phosphate-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wu4a1 a.102.1.2 (A:6-381) Xylanase Y {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1bhea_ b.80.1.3 (A:) Polygalacturonase {Erwinia carotovora, subsp. carotovora [TaxId: 554]} Back     information, alignment and structure
>d2fug41 e.18.1.2 (4:35-409) NADH-quinone oxidoreductase chain 4, Nqo4 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kbla3 d.142.1.5 (A:2-376) Pyruvate phosphate dikinase, N-terminal domain {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1ih7a1 c.55.3.5 (A:1-375) Exonuclease domain of family B DNA polymerases {Bacteriophage RB69 [TaxId: 12353]} Back     information, alignment and structure
>d1txka2 b.30.5.9 (A:23-396) Glucans biosynthesis protein G (MdoG, OpgG), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ioma_ a.103.1.1 (A:) Citrate synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gwja_ c.1.4.1 (A:) Morphinone reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2a0ua1 c.124.1.5 (A:10-383) Initiation factor 2b {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1nd7a_ d.148.1.1 (A:) WW domain-containing protein 1, WWP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rp4a_ a.227.1.1 (A:) Endoplasmic oxidoreductin 1, Ero1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1so7a_ b.68.1.1 (A:) Sialidase 2 (Neu2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bvca2 d.128.1.1 (A:105-478) Glutamine synthetase, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1v4va_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1ogmx2 b.80.1.10 (X:202-574) Dextranase, catalytic domain {Penicillium minioluteum [TaxId: 28574]} Back     information, alignment and structure
>d1qo0a_ c.93.1.1 (A:) Amide receptor/negative regulator of the amidase operon (AmiC) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1miqa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1m0wa2 d.142.1.6 (A:6-210,A:324-491) Eukaryotic glutathione synthetase ATP-binding domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r5ya_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1c3pa_ c.42.1.2 (A:) HDAC homologue {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1noya_ c.55.3.5 (A:) Exonuclease domain of family B DNA polymerases {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1qlpa_ e.1.1.1 (A:) Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vkpa_ d.126.1.6 (A:) Agmatine iminohydrolase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1teda_ c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mkfa_ b.116.1.1 (A:) Viral chemokine binding protein m3 {Murid herpesvirus 4, MuHV-4 [TaxId: 33708]} Back     information, alignment and structure
>d1r53a_ d.258.1.1 (A:) Chorismate synthase, AroC {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1to6a_ c.141.1.1 (A:) Glycerate kinase GlxK {Neisseria meningitidis, (serogroup A) [TaxId: 487]} Back     information, alignment and structure
>d1aj8a_ a.103.1.1 (A:) Citrate synthase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1c8ba_ c.56.1.2 (A:) Germination protease {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1n7oa1 a.102.3.2 (A:170-540) Hyaluronate lyase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1f1sa1 a.102.3.2 (A:249-619) Hyaluronate lyase {Streptococcus agalactiae [TaxId: 1311]} Back     information, alignment and structure
>d1eg1a_ b.29.1.10 (A:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Trichoderma reesei, Endoglucanase I [TaxId: 51453]} Back     information, alignment and structure
>d1r85a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 1422]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fnua1 c.67.1.4 (A:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2dexx3 d.126.1.5 (X:294-663) Peptidylarginine deiminase Pad4, catalytic C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hgsa4 d.142.1.6 (A:3-201,A:304-474) Eukaryotic glutathione synthetase ATP-binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gx8a1 c.135.1.1 (A:4-373) Nif3-related protein BC4286 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3psga_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1iq0a2 c.26.1.1 (A:97-466) Arginyl-tRNA synthetase (ArgRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1itua_ c.1.9.7 (A:) Renal dipeptidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwha1 a.102.3.2 (A:4-372) Chondroitinase AC {Arthrobacter aurescens [TaxId: 43663]} Back     information, alignment and structure
>d2ewoa1 d.126.1.6 (A:2-370) Agmatine iminohydrolase {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2heka1 a.211.1.1 (A:1-369) Hypothetical protein aq_1910 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ga6a_ c.41.1.2 (A:) Serine-carboxyl proteinase, SCP {Pseudomonas sp., sedolisin [TaxId: 306]} Back     information, alignment and structure
>d1laxa_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1r8ga_ d.128.1.3 (A:) Carboxylate-amine ligase YbdK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pyya4 e.3.1.1 (A:264-631) Penicillin-binding protein 2x (pbp-2x), transpeptidase domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1f52a2 d.128.1.1 (A:101-468) Glutamine synthetase, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qw9a2 c.1.8.3 (A:18-384) Alpha-L-arabinofuranosidase, catalytic domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1o7xa_ a.103.1.1 (A:) Citrate synthase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1d3ga_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ursa_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1b65a_ d.154.1.1 (A:) L-aminopeptidase D-Ala-esterase/amidase DmpA {Ochrobactrum anthropi [TaxId: 529]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1iuqa_ c.112.1.1 (A:) Glycerol-3-phosphate (1)-acyltransferase {Cushaw squash (Cucurbita moschata) [TaxId: 3662]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1moqa_ c.80.1.1 (A:) "Isomerase domain" of glucosamine 6-phosphate synthase (GLMS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1h6za1 c.1.12.2 (A:538-903) Pyruvate phosphate dikinase, C-terminal domain {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2bvya2 c.1.8.3 (A:5-370) Mannanase A, ManA {Cellulomonas fimi [TaxId: 1708]} Back     information, alignment and structure
>d1u5ua_ e.5.1.2 (A:) Allene oxide synthase-lipoxygenase protein, N-terminal domain {Black sea rod (Plexaura homomalla) [TaxId: 47982]} Back     information, alignment and structure
>d1jq5a_ e.22.1.2 (A:) Glycerol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1fn9a_ d.196.1.1 (A:) Outer capsid protein sigma 3 {Reovirus [TaxId: 10891]} Back     information, alignment and structure
>d1w85a_ c.36.1.11 (A:) Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1um0a_ d.258.1.1 (A:) Chorismate synthase, AroC {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pnwa1 b.52.1.4 (A:5-369) Membrane-bound lytic murein transglycosylase A, MLTA {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1zkda1 c.66.1.52 (A:2-366) Hypothetical protein RPA4359 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d3c8ya1 c.96.1.1 (A:210-574) Fe-only hydrogenase, catalytic domain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1u1ha2 c.1.22.2 (A:396-760) 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase MetE {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1w0pa3 b.68.1.1 (A:217-346,A:544-777) Vibrio cholerae sialidase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1t64a_ c.42.1.2 (A:) Histone deacetylase 8, HDAC8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jera1 d.126.1.6 (A:2-365) Agmatine iminohydrolase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1icpa_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Tomato (Lycopersicon esculentum), OPR1 [TaxId: 4081]} Back     information, alignment and structure
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1kbla1 c.1.12.2 (A:510-873) Pyruvate phosphate dikinase, C-terminal domain {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1kq3a_ e.22.1.2 (A:) Glycerol dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1oc7a_ c.6.1.1 (A:) Cellobiohydrolase II (Cel6) {Humicola insolens, Cel6a [TaxId: 34413]} Back     information, alignment and structure
>d1us3a2 c.1.8.3 (A:243-606) Xylanase 10c {Cellvibrio japonicus [TaxId: 155077]} Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1m7va_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zaia1 c.1.10.1 (A:1-363) Fructose-1,6-bisphosphate aldolase {Rabbit (Oryctolagus cuniculus), muscle isozyme [TaxId: 9986]} Back     information, alignment and structure
>d1khba1 c.91.1.1 (A:260-622) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zq1a2 c.88.1.1 (A:76-438) Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1cnza_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1onha_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Enterobacter cloacae, P99, cephalosporinase [TaxId: 550]} Back     information, alignment and structure
>d1nc5a_ a.102.1.6 (A:) Hypothetical protein YteR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kwfa_ a.102.1.2 (A:) CelA cellulase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2a1ha1 e.17.1.1 (A:3-365) Branched-chain aminoacid aminotransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1umga_ d.280.1.1 (A:) ST0318 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1gqea_ e.38.1.1 (A:) Polypeptide chain release factor 2 (RF2) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1umda_ c.36.1.11 (A:) Branched-chain alpha-keto acid dehydrogenase, PP module {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3thia_ c.94.1.1 (A:) Thiaminase I {Paenibacillus thiaminolyticus [TaxId: 49283]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d1nqka_ c.1.16.4 (A:) Alkanesulfonate monooxygenase SsuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Back     information, alignment and structure
>d1vlca_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d2drwa1 e.3.1.1 (A:2-363) D-Amino acid amidase DaaA {Ochrobactrum anthropi [TaxId: 529]} Back     information, alignment and structure
>d2gjxa1 c.1.8.6 (A:167-528) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qjwa_ c.6.1.1 (A:) Cellobiohydrolase II (Cel6) {Trichoderma reesei, Cel6a [TaxId: 51453]} Back     information, alignment and structure
>d2ozla1 c.36.1.11 (A:1-361) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ia1 a.102.3.2 (A:26-386) Xanthan lyase {Bacillus sp. gl1 [TaxId: 84635]} Back     information, alignment and structure
>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1dhsa_ c.31.1.1 (A:) Deoxyhypusine synthase, DHS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1lt7a_ c.1.26.1 (A:) Betaine-homocysteine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pe9a_ b.80.1.1 (A:) Pectate lyase {Erwinia chrysanthemi, type A [TaxId: 556]} Back     information, alignment and structure
>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1rqga2 c.26.1.1 (A:1-138,A:174-396) Methionyl-tRNA synthetase (MetRS) {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1sq1a_ d.258.1.1 (A:) Chorismate synthase, AroC {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1qo5a_ c.1.10.1 (A:) Fructose-1,6-bisphosphate aldolase {Human (Homo sapiens), liver isozyme [TaxId: 9606]} Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} Back     information, alignment and structure
>d1jdwa_ d.126.1.2 (A:) L-arginine: glycine amidinotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfia_ e.50.1.1 (A:) Hypothetical protein At2g17340 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1oxwa_ c.19.1.3 (A:) Patatin {Heartleaf nightshade (Solanum cardiophyllum) [TaxId: 160510]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d4bcla_ b.75.1.1 (A:) Bacteriochlorophyll A protein {Prosthecochloris aestuarii, strain 2k [TaxId: 1102]} Back     information, alignment and structure
>d1goxa_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1x74a1 c.123.1.1 (A:2-360) 2-methylacyl-CoA racemase Mcr {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1o2da_ e.22.1.2 (A:) Alcohol dehydrogenase TM0920 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Back     information, alignment and structure
>d1yvra1 a.118.25.1 (A:5-363) 60-kda SS-aARo ribonucleoprotein {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hrca1 c.92.1.1 (A:65-423) Ferrochelatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1idka_ b.80.1.2 (A:) Pectin lyase {Aspergillus niger, type A [TaxId: 5061]} Back     information, alignment and structure
>d1qcxa_ b.80.1.2 (A:) Pectin lyase {Aspergillus niger, type B [TaxId: 5061]} Back     information, alignment and structure
>d1m7ja3 c.1.9.11 (A:62-419) N-acyl-D-aminoacid amidohydrolase, catalytic domain {Alcaligenes faecalis [TaxId: 511]} Back     information, alignment and structure
>d2hdsa1 e.3.1.1 (A:4-361) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]} Back     information, alignment and structure
>d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} Back     information, alignment and structure
>d1dosa_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d2qapa1 c.1.10.1 (A:1-357) Fructose-1,6-bisphosphate aldolase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1taza_ a.211.1.2 (A:) Catalytic domain of cyclic nucleotide phosphodiesterase 1b, PDE1B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1yyda1 a.93.1.1 (A:1-357) Fungal peroxidase (ligninase) {Basidomycetos fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1a05a_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure
>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Back     information, alignment and structure
>d1t1ga_ c.41.1.2 (A:) Serine-carboxyl proteinase, SCP {Bacillus novosp. MN-32, kumamolisin [TaxId: 198803]} Back     information, alignment and structure
>d2amxa1 c.1.9.1 (A:20-376) Adenosine deaminase (ADA) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1mppa_ b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840]} Back     information, alignment and structure
>d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d16vpa_ d.180.1.1 (A:) Conserved core of transcriptional regulatory protein vp16 {Herpes simplex virus type 1 [TaxId: 10298]} Back     information, alignment and structure
>d1r3sa_ c.1.22.1 (A:) Uroporphyrinogen decarboxylase, UROD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lbqa_ c.92.1.1 (A:) Ferrochelatase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l0wa3 d.104.1.1 (A:105-294,A:415-580) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1 [TaxId: 274]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ebsa2 b.69.13.1 (A:431-786) Oligoxyloglucan reducing end-specific cellobiohydrolase {Yeast (Geotrichum sp. M128) [TaxId: 203496]} Back     information, alignment and structure
>d1v53a1 c.77.1.1 (A:1-356) 3-isopropylmalate dehydrogenase, IPMDH {Bacillus coagulans [TaxId: 1398]} Back     information, alignment and structure
>d1jaka1 c.1.8.6 (A:151-506) beta-N-acetylhexosaminidase {Streptomyces plicatus [TaxId: 1922]} Back     information, alignment and structure
>d1w8oa3 b.68.1.1 (A:47-402) Micromonospora sialidase, N-terminal domain {Micromonospora viridifaciens [TaxId: 1881]} Back     information, alignment and structure
>d1vbga1 c.1.12.2 (A:521-876) Pyruvate phosphate dikinase, C-terminal domain {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
>d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1luca_ c.1.16.1 (A:) Bacterial luciferase alpha chain, LuxA {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1fuia2 c.85.1.1 (A:1-355) L-fucose isomerase, N-terminal and second domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure