Citrus Sinensis ID: 002649

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890------
MLNLQFHNQSQSIRTLSPLPNPFLHGNGPAFRPAQLRPSFKKAPKIGVGFSPSINSIKAIFNLTAEKSTKVKAVITVKPIVSDPLAVEKLIGTLVLELVSAELDPETGKEKPTIKSRAHRSLFTDDDGNLKYKTEFDVPSNFGEVGAILVEADQLTETFLKDIALDGLRNGPVNIACDSWIQPKIVDKQKRIFFTNKSYLPSQTPNGLARLRAEELNNLQGDGQGERKIHERIYDYDVYNDLGMPDSILKSDLVRPVLGGKEHPYPRRCRTGHPKSSKDPASESWSLSVYVPRDEAFSLLKTAQFSATGVYSALHAVIPFVESILRIGKDKGFPSLEAIDKLFNEGVELPPEIEKLPSWLKILPNFFKSIANTGKDILRFETPETLKRDKLFWLRDEEFGRETLAGLNPYGISLVADWPLKSTLDPETYGPTESAITKELIEKEIGGSMTVEEAIKQKKLFIIDYHDALLPYVEKVRQIKDTTLYGSRTVFFLNPDGTLRPLAIELTRPPMDGKPQWKQVFTPSTGNSTESWLWRLAKAHVLAHDSGYHQLISHWLRTHCCVEPYVIATNRRLSAMHPINRLLKPHFRYTMEINALARKVLINADGIFETNFFPGKYCMEFSSVIYDKHWRFDNEGLPKDLIRRGIAVEDPKAPHGLKLNIEDYPYANDGLDLWDALKQWVTNYVNHYYPDPSLVESDEELQAWWTEIRTVGHAEKKDEPWWPVLKTPQDLIEIITTIAWVASGHHAAVNFGQYLYGGYFPNRPTVARTNLPNEDQTKEEWKSFLEKPEAALLRCFPAQFQALTVMLVIDLLSTHSPDEEYLGKEMEPAWGDDPVIKAAFEEFNLKMQELERIIDDRNSNENLKNRTGAAIVPYELLKPFSEPGATGKGVPYSISI
ccccccccccccccccccccccccccccccccccccccccccccccEEECcccccccEEEEEEEEEEEEEEEEEEEEcccccccHHHHHHHccEEEEEEEECcccccccccccccccccccccccccccEEEEEEEEEccccccEEEEEEEEcccccEEEEEEEEECcccccEEEEcccccccccccccccEEEcccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccHHHHHHHcccccccccHHHHHHHHHcccccccccccccHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHcccccHHHHHHccccccccccccccccccccccccccEECccEEEEEEccccccccEEEEEccccccccccccEEECcccccccccHHHHHHHHHHHHcccHHHHHHHHHHHcccccccHHHHHcccccccccccccccccccccccccHHHHHHcccccccEEEEcccccHHHHHHHHHHHHccccccccccHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHcccHHHHHHHccccHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccCECccccccccccccccccccc
********************************************KIGVGFSPSINSIKAIFNLTAEKSTKVKAVITVKPIVSDPLAVEKLIGTLVLELVSA******************RSLFTDDDGNLKYKTEFDVPSNFGEVGAILVEADQLTETFLKDIALDGLRNGPVNIACDSWIQPKIVDKQKRIFFTNKSYLPSQTPNGLARLRAEELNNLQGDGQGERKIHERIYDYDVYNDLGMPDSILKSDLVRPVLGGKEHPYPRRCRTGHP*SS*****ESWSLSVYVPRDEAFSLLKTAQFSATGVYSALHAVIPFVESILRIGKDKGFPSLEAIDKLFNEGVELPPEIEKLPSWLKILPNFFKSIANTGKDILRFETPETLKRDKLFWLRDEEFGRETLAGLNPYGISLVADWPLKSTLDPETYGPTESAITKELIEKEIGGSMTVEEAIKQKKLFIIDYHDALLPYVEKVRQIKDTTLYGSRTVFFLNPDGTLRPLAIELT********QWKQVFTPSTGNSTESWLWRLAKAHVLAHDSGYHQLISHWLRTHCCVEPYVIATNRRLSAMHPINRLLKPHFRYTMEINALARKVLINADGIFETNFFPGKYCMEFSSVIYDKHWRFDNEGLPKDLIRRGIAVEDPKAPHGLKLNIEDYPYANDGLDLWDALKQWVTNYVNHYYPDPSLVESDEELQAWWTEIRTVGHAEKKDEPWWPVLKTPQDLIEIITTIAWVASGHHAAVNFGQYLYGGYFPNRPTVARTNLPNEDQTKEEWKSFLEKPEAALLRCFPAQFQALTVMLVIDLLSTHSPDEEYLGKEMEPAWGDDPVIKAAFEEFNLKMQELERIIDDRNSNENLKNRTGAAIVPYELLKPFSEPGATGKGVPYSISI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLNLQFHNQSQSIRTLSPLPNPFLHGNGPAFRPAQLRPSFKKAPKIGVGFSPSINSIKAIFNLTAEKSTKVKAVITVKPIVSDPLAVEKLIGTLVLELVSAELDPETGKEKPTIKSRAHRSLFTDDDGNLKYKTEFDVPSNFGEVGAILVEADQLTETFLKDIALDGLRNGPVNIACDSWIQPKIVDKQKRIFFTNKSYLPSQTPNGLARLRAEELNNLQGDGQGERKIHERIYDYDVYNDLGMPDSILKSDLVRPVLGGKEHPYPRRCRTGHPKSSKDPASESWSLSVYVPRDEAFSLLKTAQFSATGVYSALHAVIPFVESILRIGKDKGFPSLEAIDKLFNEGVELPPEIEKLPSWLKILPNFFKSIANTGKDILRFETPETLKRDKLFWLRDEEFGRETLAGLNPYGISLVADWPLKSTLDPETYGPTESAITKELIEKEIGGSMTVEEAIKQKKLFIIDYHDALLPYVEKVRQIKDTTLYGSRTVFFLNPDGTLRPLAIELTRPPMDGKPQWKQVFTPSTGNSTESWLWRLAKAHVLAHDSGYHQLISHWLRTHCCVEPYVIATNRRLSAMHPINRLLKPHFRYTMEINALARKVLINADGIFETNFFPGKYCMEFSSVIYDKHWRFDNEGLPKDLIRRGIAVEDPKAPHGLKLNIEDYPYANDGLDLWDALKQWVTNYVNHYYPDPSLVESDEELQAWWTEIRTVGHAEKKDEPWWPVLKTPQDLIEIITTIAWVASGHHAAVNFGQYLYGGYFPNRPTVARTNLPNEDQTKEEWKSFLEKPEAALLRCFPAQFQALTVMLVIDLLSTHSPDEEYLGKEMEPAWGDDPVIKAAFEEFNLKMQELERIIDDRNSNENLKNRTGAAIVPYELLKPFSEPGATGKGVPYSISI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Lipoxygenase 2, chloroplastic 13S-lipoxygenase that can use linolenic acid as substrates. Plant lipoxygenases may be involved in a number of diverse aspects of plant physiology including growth and development, pest resistance, and senescence or responses to wounding. Catalyzes the hydroperoxidation of lipids containing a cis,cis-1,4-pentadiene structure. Required for the wound-induced synthesis of jasmonic acid (JA) in leaves.probableP38418
Lipoxygenase 7, chloroplastic Plant lipoxygenase may be involved in a number of diverse aspects of plant physiology including growth and development, pest resistance, and senescence or responses to wounding. This lipoxygenase introduces molecular oxygen exclusively into the C-13 position of linoleic and linolenic acids.probableP38419
Lipoxygenase 2.1, chloroplastic Plant lipoxygenase may be involved in a number of diverse aspects of plant physiology including growth and development, pest resistance, and senescence or responses to wounding. This enzyme is possibly involved in jasmonic acid synthesis. It exhibits linoleate 13-lipoxygenase and arachidonate 15-lipoxygenase activity.probableP93184

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.13.-.-Acting on single donors with incorporation of molecular oxygen.probable
1.13.11.-With incorporation of two atoms of oxygen.probable
1.13.11.12Transferred entry: 1.13.11.12.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IUJ, chain A
Confidence level:very confident
Coverage over the Query: 55-896
View the alignment between query and template
View the model in PyMOL