Citrus Sinensis ID: 002661

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-----

MAKAEAGQSPPLPPSPPLMPPNVKPEHVDLPRHSIMSRRGVGNCGRRISLLTNHFKVSVNTTDAVFYHYTVTISGEDKRIAKGKGIGRKVVDKLYQTYSAELAGKRFAYDGEKSLYTVGPLPQNKFEFTVVLEESRAKQQNGSPRGRDSPIGPGKRSKHSFQSKTFMVEISFATKIPLRSIALALKGNEVDNTQDALRVLDIVLRQQAANWGCLLVRQSFFHDDSRNLVDVGGGVSGIRGFHSSFRPTQGGLSLNMDVSTTMILKPGPVIDFLIANQNVREPRFIDWTKAKKMLRNLRVKPRHRNMEFKIVGLSEKPCNQQFFPMKVKSTEGTNEGETLEITVYDYFTQHCRIELTYSAYLPCLDVGKPKRPNYLPLELCSLVSLQRYTKALSSMQRASLVEKSRQKPQDRMRTLTDALRSYSYDEDPVLAACGISIGKQLTQVDGRILEIPKLKVGKSEDCIPRNGRWNFNNKRFLEATRIDRWIVVNFSARCDTSHISRELINCGRNKGIHIERPFTLIEEDQQTRRGNPVVRVERMFELITEKLPGPPQFILCVLPERKNSDIYGPWKKKSLSDFGIATQCISPTKINDQYLTNVLLKINSKLGGINSLLALEQSSLIPLIKDTPTMILGMDVSHGSPGRSDIPSVAAVVGSQSWPLISRYRAAVRTQSSKVEMIDALYKPIANGNDDGIIRELLLDFYRTSKQRKPKQIIIFRDGVSESQFNQVLNIELEQIIKAYQHLGEADIPKFTVIVAQKNHHTKLFQASGPENVPPGTVVDTRIVHPRNYDFYMCAHAGMIGTSRPAHYHVLLDEIGFSPDDLQNLIHSLSYVYQRSTTAISIVAPICYAHLAASQMGQFIKFEDSSDTSITSAGSVPVPELPRLHKNVESSMFFC

ccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEEcccccEEEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHccccCEECccccEECccccccccEEEEEEEccccccccccccccccccccccccccccccccEEEEEEEEEEEEcHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEEECccCEEECccccCEEEEEEcccEEECccccHHHHHHHHcccccccHHHHHHHHHHccccEEEcccccccEEEEccccccccccccccccccccccccccccEEEHHHHHHHHcccEEECcccccCECcccccccccccccEEEEcccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccHHHHHcccEEccccccccEEECccccccccccccccccccEEEcccccccccccccEEEEEEEcccccHHHHHHHHHHHHHHcccccccccCEECccccccccccHHHHHHHHHHHHHHccccccEEEEEEccccccccHHHHHHHHccccccccEEEccccccHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEECccccccccccccCEEEEEEECccccccEEEEEEEEcccccHHHHccccccccccccHHHHHHHHHHHHHcccccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEccccccccccccccccccCEEccccccccccCEEEECccccccccccccEEEEEccccccHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccHccccccccccc

**************************************RGVGNCGRRISLLTNHFKVSVNTTDAVFYHYTVTISGEDKRIAKGKGIGRKVVDKLYQTYSAELAGKRFAYDGEKSLYTVGPLPQNKFEFTVVLEE**************************FQSKTFMVEISFATKIPLRSIALALKGNEVDNTQDALRVLDIVLRQQAANWGCLLVRQSFFHDDSRNLVDVGGGVSGIRGFHSSFRPTQGGLSLNMDVSTTMILKPGPVIDFLIANQNVREPRFIDWTKAKKMLRNLRVKPRHRNMEFKIVGLSEKPCNQQFFPMKVKSTEGTNEGETLEITVYDYFTQHCRIELTYSAYLPCLDVGKPKRPNYLPLELCSLVSLQRYTKALSSMQRASLVEKSRQKPQDRMRTLTDALRSYSYDEDPVLAACGISIGKQLTQVDGRILEIPKLKVGKSEDCIPRNGRWNFNNKRFLEATRIDRWIVVNFSARCDTSHISRELINCGRNKGIHIERPFTLIEEDQQTRRGNPVVRVERMFELITEKLPGPPQFILCVLPERKNSDIYGPWKKKSLSDFGIATQCISPTKINDQYLTNVLLKINSKLGGINSLLALEQSSLIPLIKDTPTMILGMDVSHGSP*****PSVAAVVGSQSWPLISRYRAAVRTQSSKVEMIDALYKPIANGNDDGIIRELLLDFYRTSKQRKPKQIIIFRDGVSESQFNQVLNIELEQIIKAYQHLGEADIPKFTVIVAQKNHHTKLFQASGPENVPPGTVVDTRIVHPRNYDFYMCAHAGMIGTSRPAHYHVLLDEIGFSPDDLQNLIHSLSYVYQRSTTAISIVAPICYAHLAASQMGQFIKF**********************HKNVESSMFFC

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein argonaute 6	Involved in transcriptional gene silencing (TGS). Component of the RISC complex that associate with the small interfering RNA (siRNA) pathway involved in direct cytosine methylation at endogenous DNA repeats. Required for the accumulation of specific siRNAs derived from transgene and heterochromatin-related endogenous loci. Involved in RNA-directed DNA methylation (RdDM) at specific endogenous loci. Probably not required for the accumulation of siRNAs derived from transgene inverted repeats that induce post-transcriptional gene silencing (PTGS). Associates mainly with small RNAs of 24 nucleotide in length and preferentially recruits small RNAs with a 5' terminal adenosine. Targeted by turnip yellows virus (TuYV) protein P0 (via F-box-like domain) for probable proteasome degradation and thereby inactivating AGO6 function in RNA silencing.	probable	O48771
Protein argonaute 4A	Probably involved in the RNA silencing pathway. May bind to short RNAs such as microRNAs (miRNAs) or short interfering RNAs (siRNAs), and represses the translation of mRNAs which are complementary to them.	probable	Q9SDG8
Protein argonaute 16	Probably involved in the RNA silencing pathway. May bind to short RNAs such as microRNAs (miRNAs) or short interfering RNAs (siRNAs), and represses the translation of mRNAs which are complementary to them.	probable	Q6YSJ5

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YHB, chain A
Confidence level:very confident
Coverage over the Query: 474-747,771-779,805-832,843-894
View the alignment between query and template
View the model in PyMOL

Template: 3HO1, chain A
Confidence level:confident
Coverage over the Query: 43-88,99-126,155-180,194-281,298-321,342-679,692-861
View the alignment between query and template
View the model in PyMOL

Template: 1U04, chain A
Confidence level:confident
Coverage over the Query: 240-503,523-682,693-865
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID	Alignment Graph	Confidence Level	View Alignment and Template
Query
4f3t, chain A		very confident	Alignment \| Template Structure