Citrus Sinensis ID: 002676

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890----

MENEEELKEPEKKKPHLNLNSHSHSHSHSLSPTMARNTPSSPSSNKSVDSAVLQYQNQKLVQQLDSQKHELQSLEAKIKELQEKQTSYDEMLITVNQLWNLFVDDLILLGVRAGGGSNVLQKLDSENQTRDSIPSGPPEDMFLCRLLQVNSIESSSKDGILQYVEEALASRHSSARELMKFIEEVIDAQRVKTKSIAEAFHEKLSAEDAIIQLSKIDDMMKEEAKNLHEVMEIIHLKHKEYADQIENYISSHSVDQAEIQHLAGELEETMAELEESRRKLVSLKMQKDIASGTHSLVPAAAMVNGSVSPEKRPADGRMDLQELKDSVEEAKILAADRLSEVEEAQQDNINLSKQLENLQNELNDDKYVHSSRLYNLVNDQLQHWNVEVERYKALTDSLLIDRSLVLRREKEINVRAESADAARNTVDDSESRIERLEVQLQKSIIEKNDLGLKMEEAIQDSGRKDIKAEFRVMASALSKEMGMMEAQLNRWKETADEALSLREKAVSLKVSLSAKTNEQKRLTDKCVEQMAEIKSLKALIEKLQKDKLESQIMLDMYGQEGRDPRDLMEIKESERRAHSQAEVLKNALDEHSLELRVKAANEAEAACQQRLSAAEAEIIELVAKLDASERDVMELEEAMKSKDREAEAYIAEMETIGQAFEDMQTQNQHLLQQVAERDDLNIKLVSESVKTKQVQSFLLSEKQALARQLQQINALVESAKLRILHAEEQMKACLTEALRYNSEDRHLAVNLETTKWELADAEKELKWLKSAVTSSDKEYEQIQRKTEDMRKELENERNERKKLEEELMEVNNKVAELTSETGEAAIQKLQDEIKDCKAILKCGVCFDRPKEVVITKCFHLFCNPCIQRNLEIRHRKCPGCGTAFGQSDVRFVKI

cccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHccccccccccccccccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHccccccHHHHHHHHHHHHcccccccccccccccccccc

***************************************************************************************YDEMLITVNQLWNLFVDDLILLGVRAG**************************MFLCRLLQVNSI*****DGILQYVEEAL*******RELMKFIEEVIDAQRVKTKSIAEAFHEKLSAEDAIIQLSKIDDMMK*EAKNLHEVMEIIHLKHKEYADQIENYISS*****************************************************************************************************************DKYVHSSRLYNLVNDQLQHWNVEVERYKALTDSLLIDRSLVLRRE***************************************************************************************************************************IKSLKALI**************************************************************************EAEIIELVAK******************************************************DLNIKLVSESVKTKQVQSFLLSEKQALARQLQQINALVESAKLRILHAEEQMKACLTEALRYNSEDRHLAVNLETTKWELADAEKELKWLK********************************************************IQKLQDEIKDCKAILKCGVCFDRPKEVVITKCFHLFCNPCIQRNLEIRHRKCPGCGTAFGQSDVRFVKI

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MENEEELKEPEKKKPHLNLNSHSHSHSHSLSPTMARNTPSSPSSNKSVDSAVLQYQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLITVNQLWNLFVDDLILLGVRAGGGSNVLQKLDSENQTRDSIPSGPPEDMFLCRLLQVNSIESSSKDGILQYVEEALASRHSSARELMKFIEEVIDAQRVKTKSIAEAFHEKLSAEDAIIQLSKIDDMMKEEAKNLHEVMEIIHLKHKEYADQIENYISSHSVDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKDIASGTHSLVPAAAMVNGSVSPEKRPADGRMDLQELKDSVEEAKILAADRLSExxxxxxxxxxxxxxxxxxxxxLNDDKYVHSSRLYNLVNDQLQHWNVEVERYKALTDSLLIDRSLVLRREKEINVRAESxxxxxxxxxxxxxxxxxxxxxxxxxxxxKNDLGLKMEEAIQDSGRKDIKAEFRVMASALSKEMGMMEAQLNRWKETADEALSLREKAVSLKVSLSAKTNEQKRLTDKxxxxxxxxxxxxxxxxxxxxxKLESQIMLDMYGQEGRDPRDLMExxxxxxxxxxxxxxxxxxxxxHSLELRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMETIGQAFEDMQTQNQHLLQQVAERDDLNIKLVSESVKTKQVQSFLLSExxxxxxxxxxxxxxxxxxxxxxxxxxxxMKACLTEALRYNSEDRHLAVNxxxxxxxxxxxxxxxxxxxxxVTSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTGEAAIQKLQDEIKDCKAILKCGVCFDRPKEVVITKCFHLFCNPCIQRNLEIRHRKCPGCGTAFGQSDVRFVKI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
E3 ubiquitin-protein ligase BRE1-like 2	E3 ubiquitin-protein ligase that monoubiquitinates H2B to form H2BK143ub1. H2BK143ub1 gives a specific tag for epigenetic transcriptional activation and is also prerequisite for H3K4me and maybe H3K79me. It thereby plays a central role in histone code and gene regulation. Forms a ubiquitin ligase complex in cooperation with the E2 enzyme UBC2/RAD6.	probable	Q336R3
E3 ubiquitin-protein ligase BRE1-like 2	E3 ubiquitin-protein ligase that monoubiquitinates H2B to form H2BK143ub1. H2BK143ub1 gives a specific tag for epigenetic transcriptional activation and is also prerequisite for H3K4me and maybe H3K79me. It thereby plays a central role in histone code and gene regulation. Forms a ubiquitin ligase complex in cooperation with the E2 enzyme UBC2/RAD6.	probable	Q9C895
E3 ubiquitin-protein ligase BRE1-like 2	E3 ubiquitin-protein ligase that monoubiquitinates H2B to form H2BK143ub1. H2BK143ub1 gives a specific tag for epigenetic transcriptional activation and is also prerequisite for H3K4me and maybe H3K79me. It thereby plays a central role in histone code and gene regulation. Forms a ubiquitin ligase complex in cooperation with the E2 enzyme UBC2/RAD6.	probable	A2ZAC2

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4EPO, chain C
Confidence level:probable
Coverage over the Query: 824-884
View the alignment between query and template
View the model in PyMOL

Template: 1I84, chain S
Confidence level:probable
Coverage over the Query: 534-590
View the alignment between query and template
View the model in PyMOL