Citrus Sinensis ID: 002705

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890

MWLLVDMQRLSSPATGILCSSKLHNNETKLWGFGFRFKLQRRNESVRRRVKLVVSAELSKSFSLNLGLDSQVIQSNDPSQLPWIGPVPGDIAEVEAYCRIFRAAERLHAALMDTLCNPLTGECTVSYEFTPEEKPLLEDKIVSVLGCMLSLLNKGREDVLSGRSSIMNAYRVADISMTEDQLPPLAIFRSEMKRCCESMHIALENYLTPEDVRSLDVWRKLQRLKNVCYDSGFPRGDDYPIHTLFANWSPVYLSNSKDDIASKDSEVTFCRGGQVTEEGLKWLMEKGYKTIVDIRAERVKDNFYEAAIDDAILSGKVELIKIPVEVRTAPTMEQVEKFASLVSNSSKKPLYLHSKEGVWRTYAMVSRWRQYMARCASQISGQTITSNDVLLKDSTRTRKLKASAGKFLLEEKYETVKENQDEIQTKNGVFGFGLSVDMDKRNQSNGAYKGLSSVEGVESAKEVDTAVGSLGTTFSKETDPFKAQVPPSNFVSKKEMSRFFRSKTTSPPRYFNYQSKRMDVLPSEIVSSGPVSGVAETRYSQWSLSGNNLSPNHQNLPAGSEKSSDNNGYVSAGCSTNGFDRGDRSSMTEANLLTSVTKNLDEQVISSSVRDVQRSNGKPSNSGDDDLGPIVGNMCASSTGVVRVQSRKKAEMFLVRTDGFSCNREKVTESSLAFTHPSTQQQMLMWKTTPRTVLVLKKPGPALMEEAKEVASFLYHQEKMNILVEPDVHDIFARIPGFGFVQTFYLQDTSDLHERVDFVACLGGDGVILHASNLFRGAVPPVISFNLGSLGFLTSHPFEDYRQDLRQVIYGNNTLDGVYITLRMRLCCEIFRNGKAMPGKVFDVLNEVVVDRGSNPYLSKIECYEHDRLITKVRPVNCFLNVKIFFFNYA

cEEEEECccccccccEEEEccccccccccEEECccEEEEEEccHHHHHEEEEEEEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccCEEECcccccccccHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHcccccccccccccHHcHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccccccccccccccccccccCEEEEcccccccccccccEEEEccccccHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHHccccEEEEEEcccccccccHHHHHHHHHHHcccccccEEEECccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccccccEEccccccccccCCcccccEEEEEcccccHHHHHHHHHHHHHHHcccCEEEEcccHHHHHHccccccccccccccccccccccccEEEEEcccHHHHHHHHHcccccccEEEEEcccccccccccccHHHHHHHHHHcccccccccccccEEEEEEEEEEccccccccccccccEEEEcccccccEEEEEEEEccCEEEEEEccCEEEcccccccccc

MWLLVDMQRLSSPATGILCSSKLHNNETKLWGFGFRFKLQRRNESVRRRVKLVVSAELSKSFSLNLGLDSQVIQSNDPSQLPWIGPVPGDIAEVEAYCRIFRAAERLHAALMDTLCNPLTGECTVSYEFTPEEKPLLEDKIVSVLGCMLSLLNKGREDVLSGR**************TEDQLPPLAIFRSEMKRCCESMHIALENYLTPEDVRSLDVWRKLQRLKNVCYDSGFPRGDDYPIHTLFANWSPVYLSNSKDDIASKDSEVTFCRGGQVTEEGLKWLMEKGYKTIVDIRAERVKDNFYEAAIDDAILSGKVELIKIPVEVRTAPTMEQVEKFASLVSNSSKKPLYLHSKEGVWRTYAMVSRWRQYMARCASQISG*******************************************************************************************************************************************************************************************************************************************************************VVRVQSRKKAEMFLVRTDGFSCNREKV*****AF*******QMLMWKTTPRTVLVLKKPGPALMEEAKEVASFLYHQEKMNILVEPDVHDIFARIPGFGFVQTFYLQDTSDLHERVDFVACLGGDGVILHASNLFRGAVPPVISFNLGSLGFLTSHPFEDYRQDLRQVIYGNNTLDGVYITLRMRLCCEIFRNGKAMPGKVFDVLNEVVVDRGSNPYLSKIECYEHDRLITKVRPVNCFLNVKIFFFNY*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable NAD kinase 2, chloroplastic	Involved in chlorophyll synthesis and chloroplast protection against oxidative damage.	probable	Q53NI2
NAD kinase 2, chloroplastic	Involved in chlorophyll synthesis and chloroplast protection against oxidative damage.	probable	Q9C5W3

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
2.-.-.-	Transferases.	probable
2.7.-.-	Transferring phosphorous-containing groups.	probable
2.7.1.-	Phosphotransferases with an alcohol group as acceptor.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3AFO, chain A
Confidence level:very confident
Coverage over the Query: 661-874
View the alignment between query and template
View the model in PyMOL

Template: 2F46, chain A
Confidence level:probable
Coverage over the Query: 268-379
View the alignment between query and template
View the model in PyMOL